Your browser is old and dusty. Try Google Chrome!

Details for sll1245

ORF sll1245
Accession NP_441492.1
Symbol cytM
Category Soluble electron carriers
Definition cytochrome cM
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -282 -268 -1.27871 0.255
NP_440795.1_7 Reverse -275 -282 10.8555 0.132
NP_441418.1_6 Reverse -351 -370 -1.47551 0.0136
NP_441418.1_6 Forward -283 -264 -28.6149 0.206
NP_442291.1_5 Forward -374 -358 -1.90808 0.204
NP_442291.1_5 Reverse -350 -366 -4.36636 0.272
NP_441453.1_4 Reverse -351 -359 6.80426 0.121
NP_441453.1_4 Forward -283 -275 3.85433 0.284
NP_441818.1_9 Reverse -167 -186 -9.44032 0.291
NP_440226.1_1 Reverse -351 -370 15.9291 0.0222
NP_441098.1_3 Forward -65 -46 -5.2577 0.28
NP_440150.1_6 Forward -91 -72 2.26107 0.275
NP_442655.1_10 Forward -286 -267 -19.7651 0.289
NP_442173.1_1 Forward -359 -351 5.72262 0.203
NP_442752.1_4 Reverse -351 -358 13.8055 0.0199
NP_442752.1_4 Forward -162 -155 5.25066 0.256
NP_443027.1_4 Reverse -272 -282 9.91146 0.147
NP_443027.1_4 Reverse -349 -359 8.04317 0.219
NP_440784.1_7 Forward -282 -275 9.67555 0.104
NP_440784.1_7 Reverse -352 -359 6.23397 0.241
NP_440784.1_7 Forward -359 -352 6.13563 0.241
NP_441476.1_5 Forward -393 -374 -2.95047 0.231
NP_439979.1_9 Forward -393 -375 16.0471 0.22
NP_442062.1_8 Reverse -351 -361 6.66654 0.119
NP_442062.1_8 Forward -236 -226 4.69992 0.201
NP_441900.1_2 Reverse -21 -39 -1.45654 0.27
NP_441859.1_3 Reverse -350 -369 18.0915 0.0353
NP_441802.1_1 Forward -352 -333 6.68596 0.267
NP_442242.1_4 Forward -359 -352 10.8555 0.127
NP_441492.1_1 Forward -373 -354 18.3873 0.148
NP_441492.1_7 Forward -200 -181 19.0748 0.0931
NP_441200.1_4 Forward -354 -335 9.24257 0.24
NP_441594.1_6 Forward -385 -366 6.19431 0.193
NP_441925.1_4 Forward -194 -175 -17.6025 0.297
NP_440856.1_1 Reverse -341 -360 -5.40875 0.276
NP_441083.1_5 Reverse -206 -216 1.84832 0.198
NP_441083.1_5 Reverse -351 -361 1.06167 0.218
NP_441083.1_5 Forward -360 -350 0.766681 0.218
NP_441738.1_2 Forward -358 -351 15.28 0.0102
NP_441558.1_5 Forward -362 -343 4.71934 0.271
NP_440209.1_1 Forward -360 -352 11.9175 0.0184
NP_440209.1_1 Reverse -351 -359 8.57422 0.0425
NP_442570.1_3 Forward -164 -145 -5.01543 0.237
NP_441792.1_5 Forward -311 -295 8.80999 0.251
NP_441716.1_1 Forward -34 -20 4.32615 0.256
NP_440644.1_3 Forward -393 -374 2.55606 0.224
NP_442111.1_4 Forward -361 -347 13.6676 0.0383
NP_440906.1_5 Reverse -352 -359 6.23397 0.234
NP_440906.1_5 Forward -359 -352 6.13563 0.241
NP_440747.1_10 Reverse -348 -360 -2.4193 0.0434
NP_440747.1_10 Forward -363 -351 -12.1541 0.227
NP_442634.1_4 Reverse -272 -286 -5.60527 0.264
NP_440842.1_2 Reverse -102 -120 13.9821 0.201
NP_440057.1_4 Reverse -95 -114 15.4548 0.184
NP_442848.1_5 Reverse -24 -42 -2.63579 0.286
NP_441012.1_4 Forward -358 -345 6.60746 0.278
NP_443018.1_3 Reverse -352 -359 12.6255 0.0471
NP_443018.1_3 Forward -359 -352 5.25066 0.214
NP_443018.1_3 Reverse -275 -282 4.07068 0.299
NP_441634.1_8 Reverse -349 -363 2.45787 0.167
NP_441634.1_9 Reverse -275 -294 8.06178 0.294
NP_440376.1_1 Reverse -351 -360 0.0980582 0.285
NP_440376.1_1 Forward -360 -351 -0.196935 0.285
NP_441682.1_2 Forward -33 -14 0.392778 0.29
NP_441950.1_7 Forward -353 -334 -0.983855 0.191
NP_442658.1_1 Reverse -349 -359 7.35439 0.214
NP_440528.1_1 Forward -201 -188 20.6231 0.0687
NP_440617.1_1 Reverse -61 -80 21.4356 0.00323
NP_440662.1_2 Reverse -219 -238 -5.40875 0.298
NP_441487.1_9 Forward -241 -222 9.0459 0.0988
NP_442937.1_5 Reverse -20 -39 13.2741 0.095
NP_441958.1_5 Reverse -350 -360 -6.31315 0.28
NP_439905.1_1 Reverse -17 -30 9.45906 0.219
NP_442376.1_5 Forward -388 -374 8.16106 0.275
NP_440153.1_6 Reverse -273 -292 11.9958 0.222
NP_440153.1_8 Reverse -373 -386 -3.22564 0.292
NP_443055.1_6 Forward -368 -350 18.6029 0.0484
NP_440827.1_3 Reverse -374 -393 15.4374 0.172
NP_441099.1_5 Reverse -341 -360 -0.197208 0.0896
NP_441099.1_5 Forward -370 -351 -3.24547 0.131
NP_442002.1_1 Reverse -171 -189 -7.15901 0.249
NP_442002.1_9 Reverse -350 -357 10.7572 0.185
NP_442885.1_1 Reverse -377 -396 10.5209 0.282
NP_441674.1_2 Forward -392 -373 4.81767 0.299
NP_440147.1_4 Reverse -349 -362 0.707601 0.247
NP_441550.1_8 Forward -285 -275 6.96107 0.183
NP_441916.1_7 Forward -360 -350 6.96153 0.0784
NP_441916.1_7 Reverse -274 -284 5.09324 0.146
NP_441041.1_4 Forward -400 -381 -4.22878 0.132
NP_441041.1_4 Forward -360 -341 -6.58872 0.169
NP_441041.1_4 Reverse -274 -293 -11.8986 0.254
NP_441041.1_4 Reverse -285 -304 -12.2919 0.262
NP_440703.1_9 Reverse -25 -38 8.57349 0.226
NP_441725.1_4 Reverse -346 -360 11.012 0.0977
NP_439966.1_7 Forward -362 -352 13.2542 0.0297
NP_439966.1_7 Reverse -349 -359 8.23937 0.14
NP_439966.1_9 Reverse -349 -358 0.884706 0.253
NP_442941.1_3 Forward -359 -349 0.963343 0.16
NP_440289.1_2 Reverse -348 -361 0.117615 0.175
NP_442281.1_1 Reverse -346 -360 4.62054 0.187
NP_441334.1_7 Reverse -272 -291 -12.7836 0.171
NP_441334.1_7 Forward -285 -266 -21.0434 0.287
NP_440018.1_3 Reverse -221 -240 3.53937 0.28
NP_442847.1_7 Forward -394 -375 18.584 0.0958
NP_440375.1_8 Reverse -341 -360 -0.39387 0.266
NP_441644.1_6 Reverse -351 -361 4.01116 0.253
NP_443049.1_6 Reverse -350 -360 13.6904 0.149
NP_440867.1_9 Forward -246 -227 14.4541 0.249
NP_440253.1_2 Reverse -351 -369 14.1788 0.0208
NP_442933.1_10 Forward -360 -351 6.48957 0.119
NP_442933.1_10 Reverse -274 -283 4.52295 0.24
NP_442933.1_10 Forward -283 -274 4.12963 0.28
NP_441751.2_8 Forward -359 -345 -5.21195 0.199
NP_442554.1_8 Forward -359 -349 4.3066 0.189
NP_441762.1_7 Reverse -350 -362 4.16888 0.0533
NP_442142.1_4 Forward -363 -350 8.86849 0.106
NP_442142.1_4 Reverse -348 -361 7.88518 0.127
NP_442292.1_1 Reverse -352 -361 -0.0986038 0.239
NP_442292.1_1 Forward -359 -350 -0.196935 0.239
NP_442476.1_6 Forward -359 -345 1.76955 0.205
NP_442197.1_6 Reverse -338 -357 14.9458 0.0693
NP_442381.1_8 Reverse -348 -367 -15.0452 0.292
NP_441711.1_4 Forward -369 -350 18.289 0.0413
NP_443009.1_5 Forward -237 -226 3.99143 0.268
NP_441741.1_6 Forward -209 -190 7.27595 0.275
NP_441715.1_4 Forward -359 -349 9.02648 0.105
NP_440183.1_9 Forward -32 -13 -14.9469 0.273
NP_440379.1_5 Reverse -336 -355 -9.83364 0.267
NP_441468.1_1 Reverse -352 -359 6.13563 0.209
NP_441468.1_1 Forward -359 -352 6.0373 0.223
NP_441468.1_1 Reverse -275 -282 4.07068 0.263
NP_441015.1_10 Reverse -170 -189 -5.70374 0.23
NP_441015.1_10 Forward -288 -269 -9.34199 0.282
NP_441673.1_1 Reverse -351 -360 1.37636 0.114
NP_441673.1_1 Forward -360 -351 1.1797 0.163
NP_442757.1_7 Forward -32 -13 13.4708 0.201
NP_441826.1_2 Forward -289 -275 -4.13031 0.292
NP_441826.1_5 Reverse -374 -393 0.58944 0.3
NP_442490.1_4 Reverse -15 -34 16.9718 0.283
NP_442490.1_9 Forward -34 -15 1.76941 0.165
NP_442868.1_6 Forward -362 -352 7.35486 0.0808
NP_442868.1_6 Reverse -349 -359 0.57002 0.217
NP_442719.1_2 Forward -202 -184 -11.1913 0.29
NP_441056.1_1 Forward -360 -341 3.6377 0.131
NP_441612.1_2 Forward -98 -88 8.93654 0.21
NP_442559.1_3 Reverse -205 -224 17.6007 0.125
NP_442808.1_1 Forward -361 -351 7.74772 0.0697
NP_442050.1_5 Forward -362 -352 10.5993 0.141
NP_442050.1_8 Reverse -348 -367 12.7233 0.272
NP_440558.1_2 Reverse -342 -361 -3.54046 0.236
NP_442789.1_4 Reverse -374 -393 -2.36049 0.233
NP_442789.1_4 Reverse -272 -291 -4.91709 0.265
NP_440274.1_4 Forward -228 -210 3.65739 0.163
NP_441518.1_3 Forward -370 -351 -5.40875 0.123
NP_442792.1_8 Forward -399 -380 11.5042 0.205
NP_441878.1_6 Forward -237 -227 0.471689 0.142
NP_441036.1_8 Reverse -350 -360 7.05986 0.21
NP_442721.1_3 Forward -383 -364 12.2908 0.29
NP_441557.1_5 Reverse -351 -360 1.08137 0.0794
NP_441557.1_5 Forward -360 -351 0.589713 0.134
NP_442066.2_4 Reverse -274 -293 -6.1954 0.247
NP_442777.1_3 Reverse -377 -395 6.99988 0.195
NP_440101.1_10 Reverse -268 -287 15.0441 0.126
NP_442830.1_5 Forward -242 -228 -1.37762 0.299
NP_442183.1_1 Reverse -351 -365 11.701 0.0693
NP_440356.1_2 Forward -340 -321 2.45773 0.263
NP_441574.1_1 Forward -40 -21 2.26107 0.161
NP_441574.1_1 Forward -397 -378 -4.72043 0.254
NP_441549.1_1 Reverse -330 -349 13.6666 0.281
NP_441549.1_9 Reverse -177 -195 -6.37237 0.198
NP_442347.1_2 Forward -359 -350 10.9145 0.0571
NP_442347.1_2 Reverse -154 -163 5.80125 0.219
NP_442888.1_9 Forward -289 -270 13.7658 0.235
NP_442508.1_9 Reverse -290 -304 13.9626 0.273
NP_441633.1_3 Reverse -349 -362 -4.01229 0.179
NP_440136.1_2 Reverse -352 -359 6.23397 0.171
NP_440136.1_2 Forward -359 -352 6.13563 0.193
NP_442590.1_9 Forward -44 -25 5.40766 0.273
NP_442998.1_5 Reverse -24 -34 9.61647 0.238
NP_442998.1_5 Forward -208 -198 8.1415 0.271
NP_442998.1_10 Forward -358 -351 15.5754 0.0102
NP_440299.1_1 Reverse -347 -360 5.72191 0.166
NP_442333.2_5 Forward -29 -10 -9.73531 0.246
NP_441559.1_8 Reverse -75 -89 -5.31028 0.259
NP_441559.1_8 Reverse -346 -360 -7.17857 0.287
NP_441559.1_8 Reverse -380 -394 -7.2769 0.289
NP_441270.1_5 Reverse -169 -188 12.5063 0.236
NP_440915.1_6 Reverse -347 -361 2.16287 0.124
NP_440915.1_6 Reverse -270 -284 0.88457 0.151
NP_441296.1_9 Reverse -375 -388 8.67183 0.294
NP_440717.1_3 Forward -189 -175 11.5037 0.23
NP_442866.1_1 Forward -288 -269 -6.1954 0.251
NP_441494.1_6 Forward -288 -275 11.3273 0.225
NP_442386.1_9 Forward -89 -80 6.58748 0.219
NP_442386.1_9 Forward -361 -352 6.09583 0.23
NP_442386.1_9 Reverse -350 -359 5.9975 0.23
NP_441750.1_4 Reverse -347 -366 1.76941 0.276
NP_441340.1_2 Reverse -190 -209 14.6251 0.277
NP_441340.1_5 Reverse -352 -359 6.23397 0.132
NP_441340.1_5 Forward -359 -352 5.84064 0.208
NP_440327.1_6 Reverse -292 -311 6.29264 0.244
NP_442240.1_2 Forward -359 -340 -14.7502 0.188
NP_440586.1_8 Reverse -352 -359 14.69 0.026
NP_440586.1_8 Reverse -275 -282 7.41359 0.251
NP_442251.1_6 Forward -359 -352 12.0355 0.0627
NP_441262.1_3 Reverse -351 -358 14.7888 0.0223
NP_443051.1_1 Reverse -350 -359 0.884706 0.125
NP_440408.1_7 Forward -110 -91 7.86593 0.284
NP_440439.1_1 Forward -243 -230 0.117615 0.202
NP_440372.1_2 Reverse -352 -359 6.82395 0.0854
NP_440372.1_2 Forward -359 -352 6.52896 0.188
NP_440755.1_1 Reverse -187 -205 15.9145 0.224
NP_441181.1_6 Forward -282 -264 8.67227 0.219
NP_441181.1_6 Forward -396 -378 5.82068 0.22
NP_440139.1_1 Forward -242 -223 2.55527 0.229
NP_440139.1_1 Forward -355 -336 0.293673 0.293
NP_442384.1_10 Reverse -340 -353 12.999 0.0235
NP_442384.1_10 Reverse -227 -240 1.69091 0.249
NP_442384.1_10 Forward -360 -347 0.707601 0.282
NP_442114.1_4 Forward -360 -349 8.4168 0.197
NP_440364.1_10 Forward -42 -23 14.1591 0.299
NP_442262.1_10 Reverse -352 -359 12.9205 0.0422
NP_440344.1_10 Forward -367 -350 -4.97604 0.102
NP_440531.1_6 Forward -244 -225 -2.75381 0.258
NP_441335.1_8 Forward -29 -10 8.16093 0.264
NP_441965.1_10 Forward -91 -75 3.40179 0.265
NP_442556.1_10 Reverse -363 -382 10.8361 0.254
NP_440894.1_10 Reverse -362 -381 5.01433 0.24
NP_440999.1_9 Forward -287 -273 2.45787 0.149
NP_440999.1_9 Reverse -347 -361 0.491246 0.183
NP_440888.1_2 Forward -283 -269 7.76712 0.184
NP_440052.1_5 Reverse -340 -359 11.1109 0.0714
NP_440052.1_8 Forward -42 -23 11.3075 0.202
NP_441543.1_2 Forward -359 -350 8.65285 0.0968
NP_441543.1_2 Reverse -352 -361 5.50626 0.197
NP_441469.1_8 Reverse -350 -359 6.39124 0.227
NP_443064.1_6 Reverse -220 -230 11.4034 0.13
NP_442578.1_7 Reverse -352 -359 14.6904 0.026
NP_441462.1_2 Reverse -351 -361 -0.0199663 0.177
NP_441621.1_7 Forward -362 -348 -3.34366 0.188
NP_441621.1_7 Reverse -377 -391 -5.40861 0.252
NP_443062.1_1 Forward -360 -342 10.106 0.121
NP_443062.1_1 Reverse -274 -292 6.01073 0.211
NP_440519.1_8 Reverse -274 -290 8.515 0.199
NP_440519.1_8 Forward -161 -145 3.69678 0.244
NP_442204.1_1 Reverse -347 -358 11.5634 0.0565
NP_442487.1_5 Reverse -373 -392 6.48849 0.198
NP_440516.1_2 Forward -246 -228 -1.06249 0.274
NP_440516.1_8 Reverse -351 -360 10.5211 0.00816
NP_442428.1_5 Reverse -352 -359 6.13563 0.209
NP_442428.1_5 Forward -359 -352 6.0373 0.212
NP_442428.1_5 Reverse -275 -282 4.56234 0.249
NP_440783.1_3 Forward -27 -8 14.9458 0.0536
NP_440673.1_3 Forward -358 -351 12.4288 0.0426
NP_440673.1_3 Forward -281 -274 10.9539 0.106
NP_441052.1_2 Reverse -351 -361 6.8632 0.0857
NP_441052.1_2 Forward -334 -324 2.04498 0.22
NP_441052.1_2 Forward -34 -24 1.74999 0.229
NP_441052.1_2 Forward -360 -350 1.25834 0.249
NP_442219.1_8 Forward -29 -10 10.5829 0.202
NP_442219.1_8 Reverse -15 -34 9.42334 0.23
NP_442219.1_8 Forward -370 -351 8.26374 0.251
NP_442219.1_9 Reverse -352 -361 8.65285 0.0681
NP_442219.1_9 Forward -282 -273 5.40793 0.166
NP_440436.1_4 Forward -359 -350 8.55409 0.0997
NP_440436.1_4 Forward -235 -226 8.06244 0.118
NP_441884.1_9 Reverse -348 -367 -13.2752 0.138
NP_442086.1_6 Forward -400 -381 13.1758 0.255
NP_441719.1_4 Reverse -352 -359 13.5105 0.026
NP_441719.1_4 Forward -359 -352 6.52896 0.188
NP_441733.1_10 Forward -363 -350 8.27909 0.14
NP_441004.1_1 Forward -394 -375 -15.9302 0.279
NP_441004.1_5 Reverse -66 -80 12.6843 0.24
NP_442873.1_9 Forward -370 -351 11.5033 0.198
NP_441115.1_4 Reverse -226 -244 7.98318 0.266
NP_442854.1_6 Forward -354 -335 2.3594 0.272
NP_440328.1_4 Forward -235 -216 1.47442 0.224
NP_442430.1_2 Reverse -15 -34 2.3594 0.268
NP_440864.1_9 Forward -234 -215 4.62101 0.119
NP_441851.1_10 Reverse -350 -360 4.60159 0.259
NP_442001.1_1 Reverse -46 -65 -3.93454 0.276
NP_440495.1_3 Forward -371 -352 19.3707 0.16
NP_442515.1_1 Reverse -24 -38 0.687908 0.183
NP_441396.1_5 Reverse -177 -186 7.66954 0.241
NP_440593.1_9 Reverse -229 -243 9.34103 0.254
NP_441982.1_6 Reverse -307 -316 10.7665 0.292
NP_440463.1_8 Forward -44 -25 4.88595 0.297
NP_440432.1_9 Reverse -352 -367 -0.0201027 0.163
NP_442843.1_1 Forward -96 -77 -10.817 0.281
NP_439960.1_10 Reverse -344 -362 1.49411 0.198
NP_440726.1_8 Forward -369 -350 13.1758 0.205
NP_440431.1_3 Reverse -30 -49 -10.4236 0.275
NP_441031.1_1 Reverse -42 -61 6.62992 0.264
NP_442006.1_2 Forward -277 -260 -9.10594 0.197
NP_440483.1_1 Reverse -346 -365 -8.752 0.295
NP_441570.1_1 Reverse -351 -369 -9.51896 0.139
NP_441570.1_1 Forward -162 -144 -17.1888 0.267
NP_441078.1_4 Reverse -351 -360 0.196389 0.205
NP_441078.1_4 Forward -360 -351 -0.000272808 0.205
NP_442729.1_8 Reverse -321 -334 6.80412 0.178
NP_442388.1_3 Forward -91 -72 4.22769 0.293
NP_442348.1_2 Forward -148 -139 7.57121 0.28
NP_440526.1_3 Reverse -352 -363 1.53316 0.267
NP_442320.1_8 Reverse -345 -359 -1.27871 0.0817
NP_442320.1_8 Forward -366 -352 -5.80194 0.249
NP_441732.1_2 Reverse -347 -363 -16.3627 0.165
NP_442343.1_7 Forward -91 -72 19.1859 0.166
NP_442815.1_2 Reverse -182 -200 3.95239 0.255
NP_440913.1_1 Reverse -349 -367 10.0489 0.175
NP_442489.1_7 Forward -360 -351 7.47288 0.0613
NP_442489.1_7 Reverse -351 -360 0.688044 0.152
NP_440559.1_1 Reverse -352 -361 6.19458 0.134
NP_442913.1_10 Forward -43 -24 -4.91709 0.251
NP_439956.1_7 Reverse -268 -287 2.26107 0.275
NP_440779.1_5 Reverse -351 -368 -14.6125 0.254
NP_440779.1_5 Forward -283 -266 -14.7108 0.269
NP_442346.1_5 Reverse -273 -283 9.91146 0.114
NP_442346.1_5 Forward -284 -274 8.04317 0.149
NP_440545.1_3 Reverse -270 -287 -4.58271 0.229
NP_440545.1_3 Forward -364 -347 -6.84433 0.289
NP_440831.1_1 Forward -382 -363 13.6675 0.261
NP_440831.1_1 Forward -190 -171 9.63589 0.288
NP_440459.1_2 Reverse -218 -235 16.1651 0.0997
NP_440010.1_1 Reverse -289 -308 8.25926 0.213
NP_440010.1_4 Reverse -21 -40 -1.47628 0.267
NP_440010.1_10 Forward -255 -236 2.55606 0.276
NP_440010.1_10 Forward -352 -333 2.16274 0.287
NP_442551.1_4 Reverse -23 -38 -3.26502 0.287
NP_442311.1_8 Reverse -171 -190 9.43923 0.278
NP_442603.1_7 Forward -215 -201 13.2736 0.0897
NP_442603.1_7 Forward -283 -269 5.50552 0.29
NP_441233.1_2 Forward -393 -374 13.8641 0.204
NP_441585.1_10 Reverse -280 -299 19.174 0.177
NP_441888.1_7 Reverse -346 -360 3.93283 0.225
NP_441833.1_4 Forward -359 -352 6.52896 0.0924
NP_441833.1_4 Reverse -352 -359 6.23397 0.163
NP_442162.1_9 Reverse -352 -359 6.62729 0.142
NP_442162.1_9 Forward -359 -352 6.52896 0.178
NP_442796.1_2 Forward -398 -379 16.709 0.199
NP_440671.1_4 Reverse -345 -359 8.55439 0.195
NP_440671.1_5 Forward -189 -175 18.2885 0.0879
NP_440772.1_8 Forward -366 -347 8.94757 0.253
NP_442140.1_3 Reverse -352 -362 6.07655 0.184
NP_442140.1_3 Forward -359 -349 4.69992 0.238
NP_440875.1_9 Forward -358 -348 17.327 0.0126
NP_441813.1_5 Reverse -349 -359 9.7148 0.0241
NP_440590.1_4 Forward -359 -346 3.85419 0.0672
NP_440567.1_1 Forward -359 -345 7.37441 0.0726
NP_440567.1_1 Reverse -352 -366 -0.590395 0.293
NP_442497.1_10 Forward -359 -350 0.589713 0.153
NP_440821.1_4 Forward -362 -352 5.78156 0.106
NP_440821.1_4 Reverse -349 -359 0.471689 0.174
NP_441009.1_4 Forward -360 -341 12.9791 0.219
NP_442568.1_1 Forward -23 -4 3.44025 0.267
NP_441727.1_3 Reverse -267 -286 3.34271 0.291
NP_441892.1_1 Forward -292 -275 -0.157821 0.179
NP_442044.1_1 Forward -288 -269 -7.57203 0.224
NP_440212.1_9 Forward -332 -313 0.945662 0.288
NP_441526.1_6 Forward -396 -377 9.93088 0.258
NP_442041.1_5 Reverse -334 -353 0.786102 0.257
NP_440462.1_6 Reverse -349 -359 14.0414 0.0235
NP_440868.1_4 Forward -364 -352 6.92215 0.0822
NP_440868.1_4 Reverse -347 -359 1.02229 0.193
NP_442402.1_4 Forward -342 -323 -7.86776 0.278
NP_441848.1_4 Reverse -186 -202 7.35968 0.29
NP_441843.2_7 Reverse -385 -399 18.1908 0.299
NP_442837.1_3 Forward -359 -352 12.1338 0.0702
NP_442837.1_3 Reverse -352 -359 6.0373 0.25
NP_442053.1_1 Forward -360 -351 14.1594 0.0136
NP_442053.1_1 Reverse -351 -360 7.86621 0.0863
NP_440505.1_3 Reverse -349 -359 7.05986 0.165
NP_441408.2_7 Forward -285 -266 1.86774 0.215
NP_440914.1_1 Reverse -351 -361 6.66328 0.269
NP_441011.1_8 Forward -359 -350 7.07956 0.179
NP_442533.1_6 Forward -240 -231 9.14451 0.0664
NP_442533.1_6 Reverse -25 -34 3.14632 0.224
NP_442533.1_6 Reverse -274 -283 1.86802 0.284
NP_442541.1_10 Reverse -227 -241 1.27731 0.287
NP_442322.1_4 Forward -291 -274 -3.69841 0.251
NP_442535.1_5 Forward -293 -274 7.66927 0.293
NP_441482.1_7 Reverse -345 -359 -0.983719 0.0612
NP_440115.1_6 Reverse -348 -358 7.64985 0.146
NP_440115.1_6 Reverse -271 -281 5.09324 0.271
NP_442492.1_2 Reverse -351 -370 0.196116 0.241
NP_441106.1_1 Reverse -350 -359 8.45619 0.0548
NP_440444.1_5 Forward -134 -115 20.8456 0.165
NP_441186.1_4 Reverse -191 -201 15.3192 0.238
NP_441286.1_1 Reverse -350 -362 1.7106 0.0803
NP_440886.1_7 Reverse -350 -360 6.86274 0.113
NP_440886.1_7 Forward -377 -367 5.97777 0.151
NP_440886.1_7 Reverse -390 -400 4.7978 0.218
NP_440886.1_7 Reverse -146 -156 3.61784 0.272
NP_442614.1_2 Forward -349 -335 7.27608 0.275
NP_442295.1_7 Forward -182 -164 14.2763 0.289
NP_440028.1_6 Forward -399 -381 11.2289 0.265
NP_441463.1_3 Forward -370 -351 -0.295539 0.132
NP_441463.1_3 Reverse -353 -372 -5.11376 0.22
NP_442842.1_6 Forward -390 -371 13.8641 0.203
NP_441626.1_2 Reverse -352 -359 6.13563 0.177
NP_441626.1_2 Forward -359 -352 5.93897 0.231
NP_442365.1_7 Reverse -149 -168 -5.60541 0.274
NP_441962.1_4 Reverse -182 -201 -8.06369 0.195
NP_441962.1_4 Forward -288 -269 -14.8485 0.294
NP_441962.1_5 Forward -189 -170 6.4893 0.282
NP_441431.1_2 Forward -239 -225 11.5037 0.136
NP_441431.1_2 Reverse -232 -246 8.16044 0.222
NP_441836.1_2 Forward -289 -270 -2.75381 0.231
NP_442084.1_6 Forward -397 -379 6.11567 0.226
NP_441425.1_7 Reverse -41 -53 20.6885 0.196
NP_440293.1_3 Forward -396 -377 -5.50708 0.279
NP_440766.1_4 Forward -364 -350 5.1128 0.115
NP_441237.1_9 Reverse -352 -362 12.4681 0.12
NP_441237.1_9 Reverse -385 -395 10.6981 0.22
NP_439910.1_2 Reverse -219 -236 -22.2823 0.22
NP_442867.1_8 Reverse -236 -255 4.32602 0.284
NP_440457.1_1 Reverse -347 -359 7.31547 0.105
NP_440457.1_1 Forward -353 -341 0.137309 0.25
NP_441801.1_4 Reverse -141 -151 3.12662 0.231
NP_440942.1_3 Forward -114 -95 2.85105 0.298
NP_442297.1_4 Reverse -347 -366 15.0585 0.181
NP_441332.1_6 Forward -183 -173 12.1308 0.236
NP_440473.1_1 Reverse -381 -400 18.5843 0.0627
NP_441489.1_3 Reverse -190 -204 8.60589 0.234
NP_441253.1_6 Reverse -215 -234 18.9765 0.0931
NP_440734.1_9 Reverse -25 -44 8.94757 0.3
NP_440554.1_4 Forward -359 -349 6.8632 0.111
NP_441845.1_6 Reverse -237 -255 1.10079 0.274
NP_441761.1_1 Forward -282 -263 3.53937 0.265
NP_441885.1_5 Reverse -351 -361 2.33998 0.0799
NP_441885.1_5 Forward -162 -152 -0.806614 0.228
NP_441885.1_5 Forward -334 -324 -1.78992 0.284
NP_442341.1_7 Reverse -324 -338 3.24451 0.23
NP_442341.1_7 Forward -361 -347 2.75286 0.247
NP_442341.1_7 Reverse -24 -38 1.86788 0.278
NP_442341.1_9 Reverse -382 -396 6.29216 0.233
NP_441173.1_9 Forward -315 -307 14.0803 0.17
NP_442395.2_4 Forward -289 -270 5.30853 0.164
NP_443000.1_7 Reverse -349 -359 1.84832 0.228
NP_440727.1_1 Forward -105 -86 3.44104 0.249
NP_440275.1_3 Reverse -349 -359 5.87989 0.13
NP_440091.1_1 Forward -364 -352 2.0056 0.197
NP_441902.1_3 Reverse -247 -257 16.1885 0.159
NP_442451.1_2 Reverse -188 -207 -8.65367 0.252
NP_439962.1_4 Forward -393 -374 -8.35868 0.293
NP_440149.1_8 Forward -162 -143 -7.37537 0.283
NP_440216.1_1 Reverse -227 -241 -11.1118 0.163
NP_440216.1_1 Forward -360 -346 -11.8001 0.219
NP_440216.1_1 Forward -240 -226 -12.5868 0.288
NP_440216.1_9 Forward -176 -167 6.19458 0.289
NP_440172.1_1 Reverse -351 -361 6.27322 0.107
NP_440172.1_1 Reverse -274 -284 4.50326 0.184
NP_442371.1_1 Forward -209 -199 11.4843 0.299
NP_442015.1_10 Reverse -347 -360 2.18257 0.199
NP_442446.1_1 Forward -297 -278 29.1054 0.000792
NP_440117.1_1 Forward -64 -45 -3.44213 0.258
NP_441111.1_7 Forward -359 -351 8.86921 0.0589
NP_441766.1_2 Forward -360 -351 8.55452 0.054
NP_442403.1_2 Forward -348 -329 13.7658 0.104
NP_442154.1_1 Forward -42 -24 -15.9105 0.228
NP_442154.1_1 Reverse -352 -370 -17.5821 0.26
NP_440261.1_5 Reverse -228 -241 -5.88057 0.192
NP_440261.1_5 Forward -359 -346 -12.4687 0.297
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGAAGTGGCCGATGCAGTGGAAGCGGCTACCAACCAAAGTCTCGATCGCCGGGGCATCAGTCTGCCGGATATCCACAAAACTGGTTTTTACCAAGCCCAAATCAAACTGCACCCCGAAGTCATCGCTACGGTGGAAGTGCAAGTTGCTCCCCTATAAGCCGGCGGGCCCTTGCTGATCCATTGGGGCCGAGCTGGATAGATTTTTGTCAATGCTCCCCCCCCGACCTAGGAAAATTCTGGGTATCGATATCGGGGGAGTTTTAGTTTGTCAACAGGGTTAATCCGGACTTCAATCTGGGACTGAGCAAAGACAGGAATGCCCGGCATCAATACAATAGATTAAGTTAGATTAAGTTTCTGAGTGGTGGTTCTGGCCACCTTGACCAATCGTTCTTAACCC

CDS

ATGGCCCCTGTAATCGAAAAAAGTCCAACTGTTGCCACGGTAAATGCTTCCCCCACTGGGATATGGATTATGGCAGGCATTGTTTCCCTGGTGATATTGGCAGTGGCTTTGTTTAGTTTTATGAACTTTGACCCCTATGTAAGCCAGGTACTCGCTCTCAAAGGAGATGCGGATAGGGGTCGGGCCATTTTTCAAGCTAACTGTGCAGTTTGCCATGGCATCCAAGCTGACGGTTACATTGGCCCCAGTCTTTGGGGGGTATCCCAACGGCGGTCCCAGAGCCACATCATTCATCAGGTGGTGAGTGGTCAAACTCCTCCCATGCCCCAGTTTGAACCCAATCCCCAGGAGATGGCGGATTTATTGAATTACCTCAAAACCCTCTGA

Protein

MAPVIEKSPTVATVNASPTGIWIMAGIVSLVILAVALFSFMNFDPYVSQVLALKGDADRGRAIFQANCAVCHGIQADGYIGPSLWGVSQRRSQSHIIHQVVSGQTPPMPQFEPNPQEMADLLNYLKTL