Your browser is old and dusty. Try Google Chrome!

Details for sll1242

ORF sll1242
Accession NP_441495.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -340 -354 2.94952 0.168
NP_440557.1_1 Reverse -195 -214 3.44104 0.207
NP_440795.1_7 Forward -347 -340 14.6904 0.0123
NP_440795.1_7 Reverse -340 -347 14.6904 0.0123
NP_440795.1_7 Reverse -178 -185 8.8889 0.188
NP_441418.1_6 Forward -348 -329 -22.715 0.184
NP_441418.1_6 Reverse -339 -358 -29.0082 0.215
NP_442291.1_5 Reverse -338 -354 10.9733 0.0409
NP_442291.1_5 Forward -349 -333 -1.61309 0.201
NP_440897.1_6 Forward -348 -329 2.85027 0.157
NP_441453.1_4 Reverse -339 -347 16.539 0.00633
NP_441453.1_4 Forward -348 -340 16.539 0.00633
NP_441453.1_4 Forward -186 -178 11.6225 0.0403
NP_442151.1_6 Forward -348 -334 8.84938 0.164
NP_442151.1_6 Reverse -339 -353 7.76774 0.19
NP_440561.1_4 Forward -116 -97 11.8488 0.277
NP_441818.1_1 Reverse -340 -351 18.8393 0.00301
NP_441818.1_1 Forward -347 -336 14.0211 0.0577
NP_441818.1_9 Reverse -177 -196 -9.34199 0.29
NP_440226.1_1 Reverse -339 -358 14.5524 0.03
NP_440226.1_1 Forward -348 -329 2.16274 0.276
NP_441630.1_3 Reverse -331 -350 8.35759 0.113
NP_442623.1_3 Reverse -340 -359 -19.3717 0.292
NP_440150.1_6 Forward -272 -253 3.24438 0.253
NP_442744.1_9 Forward -354 -340 13.9988 0.266
NP_442173.1_1 Forward -347 -339 15.4574 0.00633
NP_442173.1_1 Reverse -340 -348 15.4574 0.00633
NP_442173.1_1 Reverse -261 -269 4.93597 0.241
NP_442752.1_4 Forward -348 -341 13.8055 0.0199
NP_442752.1_4 Reverse -339 -346 13.8055 0.0199
NP_442752.1_4 Forward -283 -276 12.1338 0.0546
NP_442752.1_4 Reverse -315 -322 5.54565 0.194
NP_443027.1_4 Forward -350 -340 14.0414 0.0452
NP_443027.1_4 Reverse -313 -323 8.63316 0.197
NP_443027.1_4 Reverse -337 -347 6.46988 0.275
NP_442975.1_10 Forward -352 -338 4.62054 0.241
NP_442975.1_10 Reverse -335 -349 3.14559 0.263
NP_440784.1_7 Forward -347 -340 15.9687 0.0123
NP_440784.1_7 Reverse -340 -347 15.9687 0.0123
NP_442909.1_7 Reverse -340 -354 11.1104 0.131
NP_440061.1_9 Forward -350 -336 22.32 0.0017
NP_440061.1_9 Forward -285 -271 9.34041 0.148
NP_442062.1_8 Forward -348 -338 17.6796 0.00193
NP_442062.1_8 Reverse -339 -349 17.3846 0.00193
NP_442062.1_8 Reverse -260 -270 4.60159 0.206
NP_442062.1_8 Reverse -251 -261 3.51995 0.267
NP_441859.1_2 Forward -299 -280 10.0284 0.287
NP_440304.1_4 Reverse -337 -347 17.9746 0.00654
NP_440304.1_4 Forward -350 -340 10.8948 0.051
NP_440304.1_4 Reverse -193 -203 2.33998 0.299
NP_442242.1_4 Forward -347 -340 14.3954 0.0124
NP_442242.1_4 Reverse -340 -347 14.3954 0.0124
NP_440044.1_8 Reverse -340 -359 9.3409 0.0691
NP_439918.1_3 Forward -105 -86 3.34271 0.266
NP_441208.1_9 Reverse -336 -350 7.17775 0.226
NP_441594.1_6 Forward -266 -247 1.57275 0.266
NP_440370.1_10 Reverse -102 -121 12.7825 0.137
NP_442110.1_7 Reverse -339 -353 0.196253 0.266
NP_442110.1_7 Forward -348 -334 -0.000409212 0.27
NP_441925.1_4 Forward -202 -183 -17.0125 0.287
NP_441083.1_5 Reverse -339 -349 20.3345 0.00053
NP_441083.1_5 Forward -348 -338 19.3512 0.000718
NP_442827.1_8 Reverse -331 -350 4.22689 0.138
NP_441738.1_2 Forward -346 -339 15.28 0.0102
NP_441738.1_2 Reverse -341 -348 15.28 0.0102
NP_441738.1_4 Forward -358 -339 5.89931 0.206
NP_441558.1_5 Forward -350 -331 10.6192 0.0955
NP_441955.1_8 Forward -275 -258 18.3284 0.107
NP_441955.1_8 Reverse -254 -271 8.39697 0.259
NP_440209.1_1 Reverse -339 -347 18.1123 0.00295
NP_440209.1_1 Forward -348 -340 18.1123 0.00295
NP_442889.1_8 Reverse -336 -350 9.43874 0.0989
NP_440178.1_7 Reverse -338 -357 14.3558 0.00536
NP_440178.1_7 Forward -349 -330 -21.0434 0.207
NP_442570.1_3 Reverse -204 -223 -7.57203 0.272
NP_442570.1_4 Reverse -373 -392 20.6481 0.0237
NP_441716.1_1 Forward -348 -334 11.406 0.0936
NP_441716.1_1 Reverse -339 -353 10.7177 0.0936
NP_441716.1_1 Forward -283 -269 8.45605 0.141
NP_441716.1_1 Forward -154 -140 5.01447 0.243
NP_442111.1_4 Forward -349 -335 18.0925 0.00833
NP_441624.1_7 Reverse -213 -227 9.83269 0.217
NP_441495.1_1 Forward -211 -192 22.4189 0.0443
NP_440906.1_5 Forward -347 -340 15.8704 0.0124
NP_440906.1_5 Reverse -340 -347 15.8704 0.0124
NP_440747.1_10 Forward -351 -339 7.51213 0.00286
NP_440747.1_10 Reverse -336 -348 -1.92764 0.0192
NP_440747.1_10 Forward -286 -274 -12.1541 0.227
NP_440747.1_10 Reverse -142 -154 -12.2524 0.254
NP_441130.1_10 Forward -350 -336 17.8958 0.0144
NP_441130.1_10 Reverse -337 -351 7.57108 0.155
NP_441486.1_1 Forward -351 -337 14.4542 0.00637
NP_441486.1_1 Reverse -336 -350 3.63784 0.0563
NP_441486.1_1 Forward -189 -175 -0.393733 0.154
NP_441486.1_1 Forward -263 -249 -5.01529 0.218
NP_442145.1_4 Forward -43 -24 8.06865 0.199
NP_442634.1_2 Reverse -268 -287 9.83255 0.141
NP_442634.1_4 Reverse -337 -351 4.22782 0.0819
NP_442634.1_4 Reverse -193 -207 0.491246 0.149
NP_441265.1_3 Reverse -333 -347 14.3559 0.059
NP_441014.1_10 Reverse -253 -272 0.686995 0.239
NP_441014.1_10 Reverse -338 -357 0.0970122 0.246
NP_442848.1_1 Forward -354 -340 16.1259 0.0143
NP_442848.1_1 Reverse -333 -347 -3.63866 0.268
NP_442848.1_5 Reverse -150 -168 1.98577 0.276
NP_441012.1_4 Reverse -173 -186 7.6891 0.272
NP_443018.1_3 Forward -347 -340 14.8871 0.0123
NP_443018.1_3 Reverse -340 -347 14.8871 0.0123
NP_443018.1_3 Reverse -261 -268 10.7572 0.0907
NP_443018.1_3 Forward -268 -261 4.56234 0.241
NP_443018.1_3 Forward -185 -178 4.56234 0.241
NP_443018.1_3 Reverse -178 -185 4.46401 0.244
NP_441634.1_8 Forward -350 -336 12.586 0.0486
NP_440376.1_1 Forward -348 -339 19.4693 0.000692
NP_440376.1_1 Reverse -339 -348 19.4693 0.000692
NP_440376.1_1 Forward -154 -145 5.3096 0.137
NP_440376.1_1 Forward -283 -274 3.93297 0.188
NP_440376.1_1 Forward -101 -92 1.37636 0.252
NP_441588.1_4 Reverse -341 -351 8.63316 0.14
NP_442687.1_7 Reverse -338 -348 18.5646 0.0028
NP_442687.1_7 Forward -349 -339 8.92815 0.0994
NP_442485.1_3 Reverse -249 -268 0.58944 0.239
NP_442485.1_3 Forward -165 -146 -1.47551 0.259
NP_441846.1_10 Forward -100 -81 -22.8133 0.266
NP_442958.1_3 Forward -280 -261 4.22769 0.252
NP_440642.1_10 Reverse -210 -224 8.25877 0.208
NP_440642.1_10 Reverse -211 -225 5.60385 0.241
NP_441013.1_2 Forward -197 -179 -3.12744 0.289
NP_440042.1_2 Reverse -89 -108 -2.26216 0.258
NP_440667.1_2 Reverse -189 -208 0.884433 0.208
NP_441950.1_7 Reverse -189 -208 9.83255 0.127
NP_442658.1_1 Reverse -337 -347 17.6791 0.00565
NP_442658.1_1 Forward -271 -261 13.7459 0.0325
NP_442658.1_1 Forward -350 -340 6.76441 0.214
NP_442658.1_1 Forward -262 -252 4.99446 0.288
NP_440353.1_2 Reverse -20 -39 9.83173 0.202
NP_442782.1_2 Reverse -183 -197 2.45787 0.275
NP_442782.1_7 Forward -356 -337 -0.197208 0.261
NP_442205.1_9 Reverse -309 -325 4.97508 0.143
NP_442205.1_9 Reverse -333 -349 -3.28472 0.282
NP_440656.1_8 Forward -359 -340 -7.96535 0.27
NP_441414.1_9 Reverse -339 -358 -3.73712 0.141
NP_441414.1_9 Forward -348 -329 -3.83545 0.143
NP_441487.1_6 Reverse -331 -350 3.83436 0.254
NP_442937.1_5 Forward -353 -334 5.80098 0.3
NP_441958.1_2 Reverse -330 -349 10.6192 0.252
NP_441958.1_5 Reverse -338 -348 20.5312 0.000966
NP_441958.1_5 Forward -349 -339 12.2714 0.00183
NP_440318.1_1 Reverse -254 -273 5.80098 0.218
NP_442836.1_5 Reverse -333 -352 4.32602 0.212
NP_440950.1_1 Forward -282 -263 4.03102 0.185
NP_440203.1_2 Forward -293 -274 15.6341 0.201
NP_440203.1_5 Forward -345 -335 9.12434 0.271
NP_440203.1_5 Forward -201 -191 9.12434 0.271
NP_439905.1_1 Forward -203 -190 12.0157 0.204
NP_439905.1_1 Forward -347 -334 10.1474 0.216
NP_440984.1_7 Reverse -334 -348 12.6843 0.122
NP_440984.1_7 Forward -288 -274 5.99778 0.231
NP_441338.2_5 Forward -108 -89 5.40766 0.275
NP_442690.1_1 Reverse -16 -35 -6.88371 0.169
NP_442690.1_1 Forward -79 -60 -13.9635 0.268
NP_442911.1_2 Reverse -329 -348 12.5858 0.0124
NP_442911.1_2 Forward -358 -339 -2.65548 0.1
NP_440153.1_5 Forward -347 -333 6.09611 0.191
NP_440153.1_5 Reverse -340 -354 5.50613 0.191
NP_440153.1_8 Forward -348 -335 3.26421 0.21
NP_442119.1_9 Forward -349 -330 11.8975 0.245
NP_442064.1_4 Reverse -202 -221 10.3234 0.202
NP_442236.1_3 Reverse -185 -204 6.39097 0.287
NP_440993.1_2 Forward -353 -337 7.92501 0.157
NP_440993.1_2 Reverse -334 -350 1.82849 0.276
NP_440993.1_4 Reverse -255 -272 4.46374 0.275
NP_440602.1_8 Reverse -339 -353 15.6342 0.116
NP_441129.1_3 Reverse -256 -275 -17.6018 0.281
NP_441099.1_5 Forward -358 -339 -10.522 0.256
NP_441099.1_8 Forward -48 -30 15.8496 0.151
NP_442002.1_9 Reverse -338 -345 14.1004 0.074
NP_441294.1_7 Reverse -335 -349 19.4254 0.00302
NP_441294.1_7 Reverse -95 -109 12.7062 0.0876
NP_441294.1_7 Forward -352 -338 11.0744 0.157
NP_441294.1_7 Reverse -270 -284 8.57871 0.294
NP_440411.1_10 Reverse -192 -211 9.18818 0.293
NP_441424.1_2 Reverse -25 -44 12.5568 0.186
NP_441646.1_1 Reverse -332 -351 8.75091 0.14
NP_442438.1_10 Reverse -334 -348 13.2743 0.0355
NP_442438.1_10 Forward -353 -339 -0.295402 0.256
NP_442431.1_10 Reverse -183 -201 1.29745 0.256
NP_441292.1_2 Reverse -328 -347 -5.11376 0.241
NP_441000.1_6 Reverse -338 -352 4.52282 0.0953
NP_441000.1_6 Forward -349 -335 -5.21195 0.266
NP_440605.1_5 Forward -116 -98 9.16393 0.271
NP_442771.1_1 Forward -350 -332 -5.48739 0.166
NP_440147.1_4 Forward -350 -337 11.819 0.0326
NP_440147.1_4 Reverse -337 -350 3.95252 0.175
NP_441550.1_8 Reverse -337 -347 19.8424 0.00352
NP_441550.1_8 Forward -350 -340 12.3692 0.0336
NP_441916.1_7 Forward -348 -338 16.893 0.00407
NP_441916.1_7 Reverse -339 -349 10.3048 0.0261
NP_441916.1_10 Forward -224 -205 5.50599 0.211
NP_441916.1_10 Forward -223 -204 2.0644 0.253
NP_440206.1_4 Reverse -106 -125 -0.00131823 0.289
NP_440345.1_5 Forward -72 -58 15.7664 0.263
NP_441041.1_4 Reverse -339 -358 -6.1954 0.164
NP_441041.1_4 Reverse -189 -208 -12.0953 0.258
NP_441041.1_7 Reverse -336 -348 12.568 0.0611
NP_442642.1_9 Forward -228 -211 1.71047 0.208
NP_442004.1_6 Forward -348 -334 8.94771 0.14
NP_442004.1_6 Forward -283 -269 4.91614 0.202
NP_441725.1_5 Forward -347 -337 18.7612 0.0119
NP_441725.1_5 Reverse -340 -350 11.2881 0.0247
NP_439966.1_7 Forward -350 -340 15.8108 0.0124
NP_439966.1_7 Reverse -337 -347 8.14104 0.14
NP_439966.1_9 Reverse -337 -346 0.983037 0.253
NP_442941.1_3 Reverse -340 -350 19.9412 0.00262
NP_442941.1_3 Forward -153 -143 5.38824 0.115
NP_442941.1_3 Forward -347 -337 2.43831 0.14
NP_440289.1_2 Forward -351 -338 16.1456 0.00946
NP_440289.1_2 Reverse -336 -349 11.524 0.0191
NP_440260.1_8 Reverse -191 -209 -0.570838 0.216
NP_442281.1_1 Forward -353 -339 17.8952 0.00513
NP_442281.1_1 Forward -274 -260 12.2903 0.0385
NP_442281.1_1 Reverse -106 -120 3.73557 0.221
NP_442281.1_1 Forward -191 -177 2.5556 0.263
NP_442281.1_1 Reverse -334 -348 1.76896 0.29
NP_441079.1_7 Forward -48 -29 10.1267 0.091
NP_440177.1_9 Reverse -325 -344 12.1925 0.238
NP_442256.1_2 Reverse -337 -355 -1.65248 0.178
NP_442256.1_2 Forward -350 -332 -4.79907 0.214
NP_440437.1_1 Reverse -333 -352 4.32602 0.106
NP_442012.1_1 Forward -266 -247 2.55606 0.198
NP_442012.1_1 Reverse -265 -284 -0.0988766 0.251
NP_442049.1_10 Reverse -252 -271 5.01433 0.289
NP_441556.1_7 Reverse -80 -99 -0.492971 0.3
NP_440498.1_1 Reverse -90 -108 0.0191479 0.218
NP_440498.1_1 Forward -357 -339 -3.71743 0.272
NP_442982.1_5 Forward -226 -207 7.66927 0.121
NP_442982.1_5 Forward -176 -157 -3.44213 0.298
NP_441644.1_6 Reverse -339 -349 17.3841 0.00127
NP_441644.1_6 Forward -348 -338 15.7125 0.0048
NP_442215.1_2 Forward -350 -334 -1.90808 0.189
NP_442215.1_2 Reverse -252 -268 -5.93965 0.262
NP_442215.1_2 Reverse -337 -353 -6.23465 0.266
NP_442215.1_2 Reverse -192 -208 -7.0213 0.284
NP_440253.1_2 Reverse -339 -357 16.1454 0.0145
NP_440929.1_8 Forward -348 -339 19.2726 0.000701
NP_440929.1_8 Reverse -339 -348 19.2726 0.000701
NP_442933.1_10 Forward -348 -339 17.601 0.00325
NP_442933.1_10 Reverse -339 -348 17.601 0.00325
NP_442933.1_10 Reverse -177 -186 4.42462 0.246
NP_441751.2_8 Reverse -340 -354 5.50613 0.0423
NP_441751.2_8 Forward -347 -333 -3.04867 0.134
NP_442926.1_5 Reverse -334 -353 14.0562 0.15
NP_442554.1_8 Forward -347 -337 16.9913 0.0065
NP_442554.1_8 Reverse -340 -350 15.9097 0.00747
NP_441762.1_7 Forward -349 -337 2.59558 0.0676
NP_441762.1_7 Reverse -338 -350 1.7106 0.0735
NP_441762.1_7 Reverse -250 -262 -4.09092 0.153
NP_442142.1_4 Forward -351 -338 7.49186 0.137
NP_442142.1_4 Reverse -257 -270 5.42692 0.192
NP_442142.1_4 Reverse -336 -349 4.05029 0.234
NP_442292.1_1 Reverse -340 -349 18.486 0.00229
NP_442292.1_1 Forward -347 -338 9.53783 0.0183
NP_440919.1_1 Reverse -334 -353 -1.7705 0.221
NP_440919.1_1 Reverse -333 -352 -2.85214 0.221
NP_441525.1_1 Reverse -270 -283 17.9155 0.136
NP_442476.1_6 Forward -347 -333 11.996 0.0525
NP_442476.1_6 Reverse -252 -266 9.2427 0.0909
NP_441523.1_6 Reverse -141 -160 3.24438 0.276
NP_443009.1_5 Forward -349 -338 15.7911 0.0107
NP_443009.1_5 Reverse -338 -349 11.1696 0.066
NP_443009.1_5 Reverse -273 -284 10.4812 0.0792
NP_443009.1_5 Reverse -250 -261 4.58141 0.239
NP_442741.1_7 Reverse -271 -290 11.6025 0.254
NP_441715.1_4 Reverse -340 -350 14.828 0.0268
NP_441715.1_4 Reverse -261 -271 5.19158 0.224
NP_441198.1_8 Reverse -337 -347 15.2245 0.0427
NP_440464.1_3 Reverse -272 -291 7.96426 0.222
NP_441468.1_1 Forward -347 -340 15.8704 0.0124
NP_441468.1_1 Reverse -340 -347 15.8704 0.0124
NP_441468.1_1 Forward -268 -261 4.07068 0.263
NP_441468.1_1 Reverse -178 -185 3.97235 0.277
NP_441020.2_6 Reverse -337 -354 9.87194 0.159
NP_441020.2_6 Forward -350 -333 6.92201 0.249
NP_441015.1_10 Forward -179 -160 -9.34199 0.282
NP_441673.1_1 Forward -348 -339 20.8459 0.000698
NP_441673.1_1 Reverse -339 -348 20.8459 0.000698
NP_441876.1_9 Reverse -147 -157 10.8943 0.284
NP_441826.1_2 Reverse -333 -347 11.701 0.0351
NP_441826.1_2 Forward -354 -340 10.816 0.044
NP_441826.1_2 Reverse -139 -153 -0.492064 0.213
NP_442811.1_2 Reverse -181 -200 11.7992 0.113
NP_441764.1_6 Reverse -314 -325 17.3649 0.253
NP_442868.1_6 Reverse -337 -347 16.7946 0.0131
NP_442868.1_6 Forward -350 -340 9.91146 0.038
NP_442719.1_2 Reverse -82 -100 -5.78308 0.222
NP_441056.1_1 Reverse -339 -358 7.17762 0.102
NP_441056.1_1 Forward -120 -101 -7.76869 0.276
NP_441612.1_2 Forward -154 -144 16.1975 0.209
NP_441612.1_2 Reverse -339 -349 8.54929 0.21
NP_441612.1_2 Forward -216 -206 7.19391 0.26
NP_442427.1_8 Forward -357 -338 10.5209 0.164
NP_442808.1_1 Reverse -98 -108 16.5975 0.01
NP_442808.1_1 Reverse -338 -348 8.73102 0.0481
NP_442808.1_1 Forward -349 -339 8.63269 0.0481
NP_442808.1_1 Forward -193 -183 3.91283 0.218
NP_442808.1_1 Reverse -273 -283 2.33954 0.27
NP_441101.1_10 Forward -287 -268 -2.85214 0.242
NP_440145.1_3 Forward -279 -260 -5.21209 0.261
NP_442542.1_2 Reverse -337 -350 22.6354 0.00161
NP_442050.1_1 Forward -276 -257 8.94757 0.25
NP_442050.1_5 Forward -350 -340 16.4991 0.00812
NP_442050.1_5 Reverse -337 -347 14.9258 0.0175
NP_441493.2_10 Forward -359 -340 7.7676 0.249
NP_440558.1_2 Forward -207 -188 -4.42544 0.245
NP_440558.1_2 Reverse -191 -210 -6.58872 0.277
NP_442576.1_9 Forward -220 -206 17.0092 0.191
NP_442789.1_4 Reverse -143 -162 -7.86702 0.299
NP_441518.1_3 Forward -358 -339 -3.73712 0.114
NP_442792.1_5 Reverse -106 -123 10.0686 0.285
NP_441878.1_6 Reverse -338 -348 20.2362 0.0046
NP_441878.1_6 Forward -349 -339 10.4031 0.0176
NP_441878.1_6 Reverse -273 -283 -0.314959 0.174
NP_441036.1_3 Forward -217 -198 2.94938 0.168
NP_441036.1_3 Forward -260 -241 -4.72043 0.279
NP_441036.1_8 Reverse -334 -344 8.82982 0.174
NP_441036.1_8 Reverse -338 -348 8.4365 0.174
NP_441036.1_8 Forward -349 -339 8.33817 0.174
NP_441557.1_5 Forward -348 -339 19.9609 0.000699
NP_441557.1_5 Reverse -339 -348 19.9609 0.000699
NP_441445.1_1 Forward -357 -338 5.01433 0.181
NP_441445.1_1 Reverse -330 -349 0.58944 0.272
NP_442066.2_4 Forward -348 -329 -8.65367 0.294
NP_441433.1_8 Reverse -274 -293 -1.27885 0.258
NP_440101.1_3 Reverse -334 -353 6.68596 0.181
NP_441458.1_10 Forward -189 -170 2.55606 0.269
NP_442183.1_1 Reverse -339 -353 16.6175 0.0139
NP_440979.1_2 Reverse -109 -123 20.4518 0.0307
NP_441549.1_9 Forward -352 -334 8.47561 0.0666
NP_442347.1_2 Reverse -340 -349 12.4878 0.056
NP_442347.1_2 Forward -323 -314 8.65285 0.0792
NP_442347.1_2 Forward -347 -338 3.34298 0.284
NP_442645.1_2 Forward -356 -337 -14.2585 0.172
NP_442645.1_2 Forward -116 -97 -20.945 0.289
NP_442888.1_6 Forward -214 -195 6.78429 0.216
NP_441037.1_4 Reverse -337 -347 18.9151 0.00351
NP_442594.1_8 Reverse -286 -305 15.9291 0.146
NP_441633.1_3 Forward -350 -337 13.1956 0.018
NP_440136.1_2 Forward -347 -340 15.9687 0.0123
NP_440136.1_2 Reverse -340 -347 15.9687 0.0123
NP_440136.1_2 Forward -259 -252 4.26735 0.218
NP_442998.1_5 Forward -217 -207 10.8948 0.201
NP_442998.1_5 Reverse -13 -23 9.81313 0.233
NP_442998.1_10 Forward -346 -339 15.5754 0.0102
NP_442998.1_10 Reverse -341 -348 15.5754 0.0102
NP_440731.1_2 Forward -215 -196 3.34271 0.295
NP_440299.1_1 Reverse -335 -348 12.5067 0.0369
NP_440299.1_1 Forward -190 -177 5.23026 0.184
NP_440299.1_1 Forward -352 -339 4.44361 0.207
NP_440299.1_1 Reverse -112 -125 2.772 0.274
NP_441799.1_1 Reverse -335 -349 16.3219 0.0152
NP_441799.1_1 Reverse -247 -261 5.60385 0.201
NP_441799.1_1 Forward -352 -338 3.44058 0.298
NP_441007.1_10 Reverse -334 -347 9.55739 0.0928
NP_441007.1_10 Forward -353 -340 0.510939 0.226
NP_442201.1_10 Reverse -328 -347 -10.4236 0.259
NP_442333.2_5 Reverse -100 -119 -13.7669 0.265
NP_440256.1_1 Forward -351 -332 -1.86883 0.109
NP_442961.1_4 Forward -327 -308 4.62101 0.269
NP_441559.1_8 Reverse -87 -101 4.52282 0.117
NP_441559.1_8 Forward -264 -250 -0.393733 0.175
NP_441559.1_8 Reverse -86 -100 -5.50694 0.264
NP_440915.1_6 Reverse -335 -349 4.71948 0.0953
NP_440915.1_6 Forward -352 -338 2.75286 0.112
NP_440915.1_6 Forward -171 -157 0.0979218 0.176
NP_440915.1_6 Forward -287 -273 -3.54032 0.298
NP_442158.1_4 Reverse -198 -208 10.5998 0.285
NP_442069.1_7 Forward -197 -178 11.7983 0.228
NP_442866.1_1 Reverse -334 -353 -3.04881 0.216
NP_442866.1_1 Forward -125 -106 -6.98204 0.263
NP_441464.1_4 Reverse -182 -201 15.2408 0.266
NP_441464.1_8 Forward -348 -334 10.816 0.178
NP_441464.1_10 Reverse -47 -61 9.5377 0.262
NP_440026.1_7 Reverse -331 -346 14.4346 0.251
NP_440695.1_6 Reverse -346 -360 11.9627 0.265
NP_441939.1_3 Forward -347 -328 21.1406 0.00632
NP_441494.1_6 Reverse -334 -347 8.9674 0.227
NP_442993.1_1 Reverse -339 -355 -7.70961 0.146
NP_442993.1_1 Reverse -200 -216 -12.0362 0.265
NP_442386.1_9 Forward -349 -340 13.8639 0.0289
NP_442386.1_9 Forward -261 -252 13.0773 0.0437
NP_442386.1_9 Forward -270 -261 10.914 0.111
NP_442386.1_9 Reverse -338 -347 6.39082 0.219
NP_440570.1_5 Forward -118 -99 -2.85214 0.282
NP_441340.1_5 Forward -347 -340 15.6737 0.0124
NP_441340.1_5 Reverse -340 -347 15.6737 0.0124
NP_441340.1_5 Forward -185 -178 11.0522 0.0749
NP_441340.1_5 Reverse -261 -268 3.97235 0.274
NP_442484.1_2 Reverse -160 -179 2.55606 0.224
NP_441676.1_4 Forward -77 -59 5.32902 0.282
NP_442240.1_2 Reverse -261 -280 -11.0136 0.137
NP_442240.1_2 Forward -347 -328 -15.2418 0.205
NP_440586.1_8 Forward -347 -340 13.2151 0.026
NP_440586.1_8 Reverse -340 -347 13.2151 0.026
NP_440586.1_8 Forward -306 -299 10.7568 0.128
NP_442251.1_6 Forward -347 -340 15.2804 0.0124
NP_442251.1_6 Reverse -340 -347 15.2804 0.0124
NP_440192.1_4 Forward -103 -84 11.241 0.217
NP_440684.1_9 Forward -354 -340 9.04604 0.221
NP_441262.1_3 Reverse -339 -346 14.7888 0.0223
NP_441262.1_3 Forward -348 -341 14.7888 0.0223
NP_440027.1_3 Forward -270 -252 6.90155 0.22
NP_440027.1_3 Forward -210 -192 4.14829 0.262
NP_443051.1_1 Reverse -338 -347 18.0926 0.00402
NP_443051.1_1 Forward -349 -340 10.4228 0.00754
NP_439996.1_9 Forward -338 -319 8.75009 0.284
NP_439937.1_9 Forward -349 -332 -4.87838 0.157
NP_439937.1_9 Forward -284 -267 -16.0881 0.287
NP_441657.1_5 Reverse -190 -209 -0.983855 0.255
NP_441595.1_5 Reverse -244 -262 3.85406 0.295
NP_440408.1_7 Forward -222 -203 7.86593 0.284
NP_440439.1_1 Forward -263 -250 4.14919 0.105
NP_440439.1_1 Reverse -336 -349 3.75586 0.11
NP_440439.1_1 Forward -351 -338 2.08423 0.138
NP_440439.1_1 Forward -286 -273 1.78924 0.143
NP_439943.1_7 Reverse -33 -52 6.88262 0.208
NP_440372.1_2 Forward -347 -340 16.3621 0.0124
NP_440372.1_2 Reverse -340 -347 16.3621 0.0124
NP_441789.1_7 Forward -274 -255 -3.93454 0.28
NP_440819.1_5 Forward -217 -209 7.68924 0.266
NP_441803.1_2 Forward -353 -334 1.76941 0.226
NP_439977.1_5 Forward -198 -179 3.93269 0.157
NP_440139.1_1 Reverse -333 -352 5.70185 0.154
NP_441572.1_7 Forward -275 -256 3.24438 0.119
NP_440267.1_2 Forward -353 -339 9.43874 0.156
NP_442384.1_10 Forward -348 -335 12.5073 0.0274
NP_442384.1_10 Reverse -145 -158 2.57589 0.22
NP_442384.1_10 Reverse -274 -287 1.78924 0.247
NP_442384.1_10 Reverse -339 -352 1.10092 0.268
NP_442384.1_10 Forward -280 -267 1.10092 0.268
NP_441877.1_5 Forward -90 -71 1.57275 0.276
NP_442235.1_3 Forward -352 -333 7.96426 0.172
NP_441018.1_7 Reverse -256 -275 7.27595 0.273
NP_441018.1_7 Reverse -190 -209 6.09597 0.299
NP_442262.1_10 Forward -347 -340 14.1988 0.0123
NP_442262.1_10 Reverse -340 -347 14.1988 0.0123
NP_442262.1_10 Reverse -261 -268 9.87221 0.164
NP_442262.1_10 Forward -185 -178 7.90559 0.266
NP_441689.1_5 Forward -350 -340 15.3192 0.0403
NP_440163.1_10 Forward -351 -341 11.3864 0.169
NP_440344.1_10 Forward -355 -338 -7.43431 0.117
NP_440344.1_10 Reverse -332 -349 -10.5809 0.185
NP_440282.1_3 Reverse -100 -119 1.47442 0.281
NP_440282.1_10 Forward -196 -177 -9.44032 0.28
NP_440531.1_6 Reverse -252 -271 -3.73712 0.27
NP_442910.1_1 Forward -355 -336 -7.17871 0.254
NP_440826.1_9 Forward -320 -301 15.0432 0.25
NP_442832.1_3 Forward -307 -288 14.7491 0.248
NP_441965.1_3 Reverse -329 -348 0.392778 0.238
NP_441965.1_10 Reverse -271 -287 7.04003 0.157
NP_441640.1_8 Forward -185 -166 -5.11376 0.274
NP_440297.1_9 Forward -347 -337 9.51814 0.0917
NP_440297.1_9 Reverse -340 -350 9.32148 0.0917
NP_440350.1_2 Reverse -338 -357 4.62101 0.289
NP_440350.1_5 Reverse -199 -218 -4.6221 0.281
NP_440999.1_9 Reverse -335 -349 2.45787 0.149
NP_440888.1_2 Reverse -339 -353 15.4369 0.0107
NP_440888.1_2 Forward -348 -334 11.9953 0.0539
NP_440888.1_2 Reverse -194 -208 5.50552 0.276
NP_440888.1_2 Reverse -251 -265 5.21053 0.288
NP_440888.1_4 Reverse -304 -318 17.6935 0.15
NP_442277.1_4 Reverse -330 -349 9.04509 0.117
NP_442033.1_10 Forward -272 -253 -13.1769 0.283
NP_442033.1_10 Reverse -258 -277 -13.5702 0.287
NP_441543.1_2 Reverse -340 -349 16.9127 0.00359
NP_441543.1_2 Forward -347 -338 9.34117 0.0818
NP_441543.1_2 Forward -185 -176 8.55452 0.0988
NP_441543.1_2 Forward -306 -297 5.70292 0.181
NP_441543.1_2 Forward -179 -170 3.93297 0.3
NP_442845.1_2 Reverse -171 -185 6.09611 0.217
NP_442845.1_2 Forward -354 -340 3.34284 0.294
NP_441551.1_5 Reverse -335 -351 10.5792 0.193
NP_441469.1_8 Reverse -338 -347 13.3727 0.073
NP_441469.1_8 Forward -349 -340 6.48957 0.227
NP_441469.1_8 Reverse -259 -268 5.89959 0.246
NP_443064.1_6 Forward -348 -338 13.8273 0.0796
NP_443064.1_6 Reverse -339 -349 12.5669 0.0796
NP_443064.1_6 Reverse -158 -168 8.30077 0.3
NP_442337.1_8 Forward -97 -78 -2.0655 0.293
NP_442578.1_7 Forward -347 -340 14.5921 0.026
NP_442578.1_7 Reverse -340 -347 14.5921 0.026
NP_441462.1_2 Forward -348 -338 20.1379 0.000967
NP_441462.1_2 Reverse -339 -349 11.5831 0.00406
NP_441621.1_7 Reverse -337 -351 -4.91696 0.248
NP_443062.1_1 Reverse -339 -357 17.6141 0.0251
NP_443062.1_1 Reverse -298 -316 11.5686 0.0962
NP_443062.1_1 Forward -324 -306 5.71821 0.22
NP_443062.1_6 Forward -356 -337 5.99764 0.191
NP_440519.1_8 Forward -166 -150 3.50012 0.244
NP_442204.1_1 Forward -287 -276 3.10693 0.266
NP_442204.1_1 Reverse -230 -241 -0.334653 0.295
NP_440516.1_2 Reverse -254 -272 -2.0458 0.297
NP_440516.1_8 Forward -348 -339 16.9127 0.00442
NP_440516.1_8 Reverse -339 -348 16.9127 0.00442
NP_440516.1_8 Forward -108 -99 -0.393597 0.255
NP_441785.1_1 Reverse -339 -353 14.9684 0.148
NP_442428.1_5 Forward -347 -340 15.8704 0.0124
NP_442428.1_5 Reverse -340 -347 15.8704 0.0124
NP_442428.1_5 Forward -268 -261 4.46401 0.267
NP_442428.1_5 Reverse -178 -185 4.36568 0.271
NP_442428.1_8 Reverse -256 -275 6.29264 0.224
NP_442120.1_10 Reverse -339 -358 -9.63698 0.244
NP_442120.1_10 Reverse -189 -208 -16.1268 0.296
NP_440673.1_3 Forward -346 -339 12.4288 0.0426
NP_440673.1_3 Reverse -341 -348 12.4288 0.0426
NP_440673.1_3 Reverse -262 -269 10.5605 0.123
NP_440865.1_9 Forward -169 -150 -0.0988766 0.152
NP_440865.1_9 Forward -354 -335 -8.752 0.269
NP_441052.1_2 Reverse -339 -349 19.9412 0.00106
NP_441052.1_2 Forward -348 -338 10.4031 0.0285
NP_441052.1_2 Reverse -145 -155 3.02829 0.185
NP_441052.1_2 Forward -180 -170 1.74999 0.229
NP_442219.1_8 Reverse -190 -209 9.80987 0.219
NP_442219.1_9 Reverse -340 -349 17.7976 0.00718
NP_442219.1_9 Forward -347 -338 8.25953 0.0681
NP_442219.1_9 Reverse -252 -261 3.14632 0.201
NP_440436.1_4 Reverse -340 -349 17.2072 0.00233
NP_440436.1_4 Forward -347 -338 15.9289 0.00508
NP_440436.1_4 Reverse -261 -270 10.7174 0.0743
NP_440436.1_4 Reverse -82 -91 5.11253 0.222
NP_440436.1_4 Reverse -252 -261 4.62087 0.248
NP_441884.1_9 Forward -351 -332 -12.3902 0.138
NP_441884.1_9 Reverse -336 -355 -24.9766 0.29
NP_441719.1_4 Forward -347 -340 16.3621 0.0124
NP_441719.1_4 Reverse -340 -347 16.3621 0.0124
NP_441733.1_10 Forward -351 -338 8.18076 0.14
NP_441733.1_10 Forward -382 -369 5.42749 0.217
NP_441004.1_1 Reverse -177 -196 -10.6203 0.224
NP_441004.1_5 Forward -234 -220 7.66941 0.284
NP_442813.1_4 Reverse -255 -274 -3.54046 0.292
NP_442366.1_3 Reverse -338 -356 1.49411 0.149
NP_442366.1_3 Forward -187 -169 0.510803 0.169
NP_442873.1_9 Forward -358 -339 4.03023 0.287
NP_442854.1_4 Forward -318 -299 11.8967 0.253
NP_440094.1_9 Reverse -170 -189 -4.52377 0.262
NP_443054.1_2 Forward -350 -336 9.93102 0.0832
NP_443054.1_2 Forward -265 -251 -0.393733 0.294
NP_440864.1_9 Reverse -256 -275 -6.49039 0.258
NP_441851.1_10 Reverse -338 -348 17.4829 0.0027
NP_441851.1_10 Forward -349 -339 15.8113 0.00552
NP_441851.1_10 Forward -261 -251 4.10993 0.287
NP_441851.1_10 Reverse -259 -269 4.10993 0.287
NP_442208.1_5 Forward -168 -149 -3.54046 0.258
NP_442700.1_4 Forward -56 -37 2.45773 0.266
NP_441542.1_4 Forward -360 -346 4.03116 0.264
NP_441668.1_3 Reverse -184 -203 8.75091 0.234
NP_442515.1_1 Forward -349 -335 14.1593 0.0278
NP_442515.1_1 Reverse -338 -352 9.34103 0.063
NP_442515.1_1 Reverse -270 -284 1.47456 0.158
NP_441396.1_5 Reverse -265 -274 9.4395 0.205
NP_442689.1_8 Reverse -20 -37 2.59545 0.18
NP_442689.1_8 Reverse -62 -79 -8.41762 0.294
NP_441349.1_10 Forward -358 -339 7.7676 0.0292
NP_441349.1_10 Reverse -135 -154 -3.73712 0.15
NP_441409.1_6 Reverse -333 -352 -9.24366 0.18
NP_440432.1_9 Forward -347 -332 8.2397 0.0427
NP_440432.1_9 Reverse -340 -355 -1.79006 0.167
NP_442843.1_1 Reverse -178 -197 -0.885524 0.192
NP_442843.1_1 Forward -268 -249 -3.73712 0.228
NP_439960.1_4 Reverse -176 -195 16.8132 0.151
NP_440474.1_8 Forward -347 -333 6.29216 0.228
NP_441477.1_5 Forward -287 -268 8.55425 0.272
NP_442450.1_5 Reverse -337 -347 10.1081 0.115
NP_442450.1_5 Forward -350 -340 9.32148 0.115
NP_440588.1_2 Reverse -330 -349 -5.99873 0.266
NP_440588.1_5 Reverse -31 -45 15.1923 0.215
NP_441031.1_1 Reverse -20 -39 4.8946 0.288
NP_439950.1_1 Reverse -15 -24 13.2744 0.277
NP_440943.1_1 Reverse -187 -206 13.3725 0.23
NP_441570.1_1 Reverse -339 -357 9.75391 0.0103
NP_441570.1_1 Reverse -177 -195 -8.83064 0.122
NP_441570.1_1 Forward -348 -330 -17.0904 0.264
NP_440078.1_8 Reverse -81 -100 1.0811 0.279
NP_441078.1_4 Forward -348 -339 19.6659 0.0007
NP_441078.1_4 Reverse -339 -348 19.6659 0.0007
NP_441078.1_4 Reverse -145 -154 5.70292 0.111
NP_441078.1_4 Reverse -274 -283 -1.96689 0.282
NP_440539.1_9 Reverse -79 -98 -0.39387 0.286
NP_441663.1_8 Forward -289 -270 -3.14714 0.276
NP_442348.1_2 Reverse -194 -203 12.2911 0.218
NP_440793.1_1 Reverse -209 -223 11.012 0.279
NP_440526.1_3 Forward -347 -336 11.3662 0.0646
NP_440526.1_3 Reverse -340 -351 10.1862 0.0646
NP_441432.1_8 Forward -349 -340 16.8143 0.00595
NP_441432.1_8 Forward -109 -100 10.0295 0.0681
NP_441432.1_8 Reverse -338 -347 8.35786 0.0755
NP_441432.1_8 Reverse -176 -185 3.04799 0.268
NP_442320.1_8 Forward -354 -340 11.701 0.0178
NP_442344.1_7 Reverse -340 -359 -9.24366 0.245
NP_441732.1_2 Forward -352 -336 -6.52964 0.0495
NP_441732.1_2 Forward -158 -142 -7.31629 0.0807
NP_441732.1_2 Reverse -335 -351 -16.2644 0.165
NP_441732.1_2 Forward -208 -192 -16.7561 0.195
NP_440497.1_6 Forward -288 -269 -6.58872 0.264
NP_440629.1_4 Reverse -88 -107 12.8808 0.217
NP_442815.1_3 Reverse -198 -217 12.4875 0.195
NP_440760.1_1 Forward -348 -329 -12.9802 0.0969
NP_440760.1_1 Reverse -339 -358 -20.65 0.224
NP_442797.1_7 Reverse -332 -350 0.805796 0.271
NP_440199.1_10 Forward -351 -341 16.7946 0.0381
NP_441945.1_10 Reverse -176 -195 7.27595 0.284
NP_439900.1_4 Forward -323 -309 19.8618 0.131
NP_442400.1_3 Forward -124 -105 10.8159 0.158
NP_440713.1_4 Reverse -167 -186 3.6377 0.24
NP_442489.1_2 Forward -359 -340 4.32602 0.22
NP_442489.1_7 Forward -348 -339 20.1576 0.000695
NP_442489.1_7 Reverse -339 -348 20.1576 0.000695
NP_442489.1_7 Forward -283 -274 -1.6719 0.235
NP_441830.1_2 Forward -99 -80 -4.32711 0.275
NP_440757.1_8 Reverse -22 -34 18.7092 0.0961
NP_442079.1_7 Reverse -178 -197 15.6341 0.0744
NP_442079.1_7 Reverse -340 -359 1.37609 0.253
NP_440559.1_1 Reverse -340 -349 17.4043 0.00658
NP_440559.1_1 Forward -347 -338 17.306 0.00658
NP_441659.2_8 Forward -348 -338 19.3512 0.000966
NP_441659.2_8 Reverse -339 -349 18.1713 0.00133
NP_442913.1_10 Reverse -330 -349 17.8957 0.0136
NP_442913.1_10 Forward -357 -338 -0.295539 0.158
NP_442913.1_10 Forward -175 -156 -4.81876 0.248
NP_441040.1_2 Forward -292 -273 7.37428 0.119
NP_442849.1_1 Forward -233 -219 10.7177 0.203
NP_440779.1_5 Forward -348 -331 -4.48438 0.115
NP_442346.1_5 Reverse -338 -348 17.9746 0.00128
NP_442346.1_5 Forward -349 -339 16.6963 0.00248
NP_442346.1_5 Reverse -176 -186 9.51814 0.118
NP_442346.1_5 Forward -284 -274 4.50326 0.286
NP_440545.1_3 Forward -352 -335 5.34871 0.0623
NP_440545.1_3 Reverse -270 -287 3.57876 0.0817
NP_440545.1_3 Reverse -335 -352 0.727158 0.133
NP_440250.1_4 Reverse -59 -78 2.16195 0.291
NP_442311.1_5 Forward -93 -74 8.25926 0.23
NP_442603.1_7 Forward -348 -334 10.717 0.125
NP_442828.1_5 Forward -375 -356 15.4366 0.201
NP_441888.1_7 Forward -274 -260 2.2612 0.225
NP_441888.1_7 Reverse -255 -269 1.57289 0.245
NP_440449.1_6 Reverse -331 -349 7.18594 0.229
NP_441948.1_4 Forward -355 -337 -3.32411 0.19
NP_441948.1_5 Forward -36 -17 20.8646 0.115
NP_441047.1_2 Forward -274 -255 -1.08219 0.267
NP_441502.1_3 Forward -168 -149 6.29264 0.272
NP_441833.1_4 Forward -347 -340 15.9687 0.0124
NP_441833.1_4 Reverse -340 -347 15.9687 0.0124
NP_442162.1_9 Forward -347 -340 16.2637 0.0124
NP_442162.1_9 Reverse -340 -347 16.2637 0.0124
NP_440671.1_4 Forward -354 -340 14.7492 0.0565
NP_440671.1_4 Reverse -171 -185 7.47274 0.217
NP_440671.1_4 Reverse -105 -119 5.30946 0.286
NP_441044.1_4 Forward -206 -188 8.47561 0.223
NP_440772.1_8 Forward -354 -335 10.7175 0.253
NP_442140.1_3 Forward -347 -337 14.828 0.0433
NP_442140.1_3 Forward -268 -258 4.60159 0.242
NP_442140.1_3 Reverse -340 -350 4.40493 0.243
NP_441671.1_10 Reverse -268 -287 -0.295539 0.292
NP_440875.1_2 Reverse -269 -288 7.07928 0.227
NP_440875.1_9 Forward -267 -257 11.5841 0.162
NP_440875.1_9 Reverse -300 -310 10.7081 0.201
NP_440875.1_9 Reverse -276 -286 9.05339 0.233
NP_441813.1_5 Forward -350 -340 15.9097 0.01
NP_441813.1_5 Reverse -337 -347 8.92815 0.0347
NP_441813.1_5 Forward -271 -261 -0.806614 0.285
NP_440594.1_8 Forward -347 -334 10.1468 0.17
NP_440590.1_4 Forward -347 -334 3.16588 0.0756
NP_440590.1_4 Reverse -340 -353 -4.50394 0.262
NP_440567.1_1 Forward -347 -333 20.8458 0.012
NP_442497.1_1 Reverse -89 -108 7.37347 0.291
NP_442497.1_10 Forward -347 -338 19.8626 0.00532
NP_442497.1_10 Reverse -340 -349 10.4228 0.0087
NP_442497.1_10 Forward -259 -250 -1.18024 0.256
NP_440821.1_4 Reverse -337 -347 19.5479 0.00399
NP_440821.1_4 Forward -350 -340 18.2696 0.00448
NP_441239.1_9 Reverse -337 -349 14.4936 0.0272
NP_441239.1_9 Forward -271 -259 8.6921 0.125
NP_441239.1_9 Forward -350 -338 7.90546 0.147
NP_441239.1_9 Reverse -258 -270 4.16888 0.26
NP_441892.1_1 Forward -195 -178 -4.09106 0.255
NP_441892.1_1 Forward -357 -340 -5.1727 0.275
NP_440604.1_6 Forward -348 -329 -1.7705 0.206
NP_442044.1_1 Forward -159 -140 -6.1954 0.201
NP_442193.1_8 Reverse -142 -161 10.0284 0.286
NP_441017.1_6 Forward -352 -338 14.6503 0.138
NP_442629.1_3 Reverse -256 -275 2.85105 0.275
NP_440949.1_7 Forward -356 -337 9.14342 0.264
NP_440546.1_4 Forward -348 -338 12.8578 0.0572
NP_440546.1_4 Reverse -339 -349 10.046 0.109
NP_440546.1_4 Reverse -177 -187 8.6886 0.176
NP_440546.1_4 Reverse -49 -59 8.20381 0.199
NP_440546.1_4 Forward -186 -176 8.00989 0.209
NP_440546.1_4 Forward -283 -273 6.94336 0.269
NP_441537.1_7 Reverse -27 -45 21.4877 0.0517
NP_440462.1_6 Reverse -337 -347 10.4031 0.0396
NP_440462.1_6 Forward -350 -340 7.74818 0.0699
NP_440462.1_6 Forward -262 -252 6.07655 0.129
NP_440462.1_6 Reverse -313 -323 4.69992 0.187
NP_442144.1_3 Reverse -142 -161 11.5042 0.162
NP_440868.1_4 Reverse -335 -347 10.3637 0.0388
NP_440868.1_4 Forward -352 -340 5.93884 0.0879
NP_441497.1_2 Reverse -198 -217 7.66927 0.233
NP_441879.1_3 Reverse -340 -359 7.7676 0.184
NP_442479.1_9 Forward -78 -59 -13.5702 0.288
NP_441582.1_5 Forward -350 -331 15.7316 0.113
NP_441582.1_5 Forward -262 -243 3.34192 0.266
NP_440270.1_6 Reverse -56 -75 12.3892 0.187
NP_442402.1_4 Reverse -137 -156 15.2399 0.0585
NP_442402.1_4 Forward -150 -131 -2.36125 0.198
NP_441848.1_4 Forward -77 -61 8.02812 0.288
NP_441084.1_6 Forward -212 -198 10.8954 0.226
NP_440653.1_10 Reverse -304 -323 12.3892 0.125
NP_440696.1_3 Reverse -335 -353 -3.6191 0.287
NP_442923.1_4 Reverse -177 -196 0.491109 0.196
NP_442039.1_4 Forward -347 -340 15.1821 0.0124
NP_442039.1_4 Reverse -340 -347 15.1821 0.0124
NP_441811.1_8 Forward -330 -316 9.04604 0.227
NP_441811.1_8 Reverse -333 -347 8.06273 0.238
NP_441811.1_8 Reverse -268 -282 5.60446 0.294
NP_442837.1_3 Forward -347 -340 15.7721 0.0124
NP_442837.1_3 Reverse -340 -347 15.7721 0.0124
NP_442837.1_3 Forward -323 -316 6.52896 0.2
NP_439994.1_3 Forward -349 -330 8.1459 0.292
NP_442053.1_1 Forward -348 -339 18.3876 0.0007
NP_442053.1_1 Reverse -339 -348 18.3876 0.0007
NP_440505.1_3 Forward -350 -340 16.303 0.00696
NP_440505.1_3 Reverse -337 -347 7.84651 0.147
NP_440505.1_3 Forward -285 -275 6.07655 0.197
NP_440505.1_7 Forward -287 -268 0.58944 0.259
NP_441701.1_3 Reverse -185 -202 8.29864 0.247
NP_441408.2_7 Forward -78 -59 -3.54046 0.274
NP_440914.1_1 Reverse -339 -349 17.5935 0.000537
NP_440914.1_1 Forward -348 -338 8.51751 0.186
NP_440914.1_1 Forward -209 -199 7.15123 0.249
NP_441011.1_8 Forward -347 -338 14.356 0.0249
NP_441011.1_8 Reverse -340 -349 8.25953 0.144
NP_441011.1_8 Reverse -146 -155 7.57121 0.17
NP_441011.1_8 Reverse -252 -261 5.11294 0.283
NP_442533.1_1 Forward -170 -151 -0.39387 0.14
NP_442533.1_6 Forward -348 -339 17.2076 0.00137
NP_442533.1_6 Reverse -339 -348 17.2076 0.00137
NP_442533.1_6 Reverse -274 -283 7.27622 0.0928
NP_442533.1_6 Forward -58 -49 2.65466 0.246
NP_442533.1_6 Reverse -158 -167 2.16301 0.27
NP_442232.1_3 Reverse -331 -350 -12.6852 0.282
NP_442232.1_5 Reverse -192 -211 15.1424 0.133
NP_442322.1_4 Reverse -150 -167 -4.48506 0.259
NP_442322.1_4 Forward -122 -105 -8.90993 0.286
NP_441482.1_7 Forward -354 -340 -1.37704 0.0683
NP_441482.1_7 Reverse -105 -119 -1.5737 0.0755
NP_441482.1_7 Reverse -139 -153 -11.8001 0.284
NP_439944.1_9 Reverse -340 -350 19.0562 0.00329
NP_439944.1_9 Forward -347 -337 17.4829 0.00423
NP_439944.1_9 Reverse -178 -188 12.1731 0.0887
NP_441697.1_5 Reverse -30 -49 -9.59736 0.271
NP_441028.1_6 Forward -293 -283 12.6642 0.183
NP_441028.1_6 Forward -278 -268 5.78111 0.243
NP_441028.1_6 Reverse -147 -157 5.48612 0.255
NP_440116.1_8 Reverse -340 -359 1.17943 0.0926
NP_441527.1_4 Forward -227 -208 -6.7326 0.224
NP_441527.1_4 Forward -228 -209 -7.01908 0.229
NP_441527.1_4 Reverse -313 -332 -8.64244 0.248
NP_441527.1_4 Reverse -310 -329 -11.6982 0.284
NP_441527.1_8 Reverse -310 -329 1.27776 0.283
NP_440115.1_6 Reverse -336 -346 18.2696 0.0139
NP_440007.1_9 Reverse -107 -121 9.5377 0.171
NP_440007.1_9 Reverse -381 -395 0.491246 0.297
NP_441680.1_4 Forward -274 -255 6.39097 0.176
NP_441106.1_1 Reverse -338 -347 9.73449 0.0311
NP_441106.1_1 Forward -349 -340 9.63616 0.0311
NP_441106.1_1 Forward -270 -261 4.42462 0.226
NP_441420.1_8 Forward -117 -98 11.3075 0.284
NP_440429.1_4 Reverse -332 -351 10.0292 0.299
NP_441216.1_6 Reverse -231 -250 13.7658 0.262
NP_439903.1_6 Reverse -142 -161 -1.18128 0.293
NP_442588.1_6 Forward -93 -74 -2.0655 0.282
NP_442588.1_8 Reverse -257 -276 8.06259 0.238
NP_442928.1_3 Reverse -272 -291 12.7098 0.256
NP_440797.1_2 Forward -359 -340 20.167 0.0373
NP_441286.1_1 Forward -349 -337 24.2284 0.000758
NP_441286.1_1 Reverse -338 -350 11.937 0.0108
NP_440670.1_8 Forward -348 -339 18.3876 0.000699
NP_440670.1_8 Reverse -339 -348 18.3876 0.000699
NP_440886.1_7 Reverse -338 -348 8.04271 0.0805
NP_440886.1_7 Forward -349 -339 7.94438 0.0805
NP_442614.1_2 Forward -348 -334 14.8476 0.089
NP_442614.1_2 Forward -283 -269 7.76774 0.265
NP_442072.1_9 Forward -349 -331 -10.8956 0.0789
NP_442072.1_9 Reverse -338 -356 -22.007 0.216
NP_442072.1_9 Reverse -193 -211 -22.9903 0.271
NP_441753.1_10 Reverse -330 -349 7.66927 0.186
NP_440907.2_8 Forward -347 -337 19.449 0.00351
NP_440907.2_8 Reverse -252 -262 4.10949 0.278
NP_441021.1_1 Reverse -100 -119 -11.3086 0.259
NP_441021.1_1 Forward -347 -328 -12.8819 0.299
NP_441021.1_8 Reverse -334 -352 2.87075 0.238
NP_441463.1_3 Forward -358 -339 9.24257 0.0481
NP_441463.1_3 Forward -196 -177 -4.72043 0.211
NP_441463.1_3 Reverse -202 -221 -7.37537 0.257
NP_441463.1_6 Forward -350 -336 16.5625 0.114
NP_441463.1_6 Forward -205 -191 6.99573 0.265
NP_441463.1_6 Forward -285 -271 6.6092 0.267
NP_442842.1_4 Reverse -195 -214 0.884433 0.299
NP_442893.1_3 Reverse -220 -239 17.9932 0.12
NP_441626.1_2 Forward -347 -340 15.7721 0.0124
NP_441626.1_2 Reverse -340 -347 15.7721 0.0124
NP_442211.1_3 Reverse -298 -317 7.95832 0.275
NP_442365.1_7 Forward -352 -333 -5.99873 0.284
NP_442794.1_1 Reverse -173 -185 6.62715 0.169
NP_442794.1_1 Reverse -141 -153 5.05386 0.236
NP_442615.1_1 Reverse -330 -348 6.11567 0.0364
NP_441962.1_4 Reverse -334 -353 -4.6221 0.158
NP_440387.1_1 Forward -348 -332 7.72835 0.0282
NP_440387.1_1 Reverse -339 -355 -3.67804 0.164
NP_441431.1_2 Forward -263 -249 10.5204 0.159
NP_441431.1_2 Reverse -336 -350 8.65209 0.209
NP_441836.1_2 Reverse -268 -287 -4.03212 0.251
NP_442084.1_6 Forward -230 -212 7.88563 0.221
NP_440114.1_10 Forward -348 -334 14.1593 0.0429
NP_440114.1_10 Reverse -339 -353 10.1277 0.153
NP_440114.1_10 Reverse -49 -63 8.75105 0.195
NP_442357.1_8 Forward -382 -363 5.89931 0.241
NP_441510.2_7 Forward -354 -340 11.7987 0.28
NP_441720.1_2 Reverse -335 -354 7.86512 0.213
NP_440293.1_9 Reverse -207 -221 13.0837 0.216
NP_440766.1_4 Forward -352 -338 5.50613 0.11
NP_439988.1_7 Forward -346 -332 15.0436 0.292
NP_441237.1_9 Forward -347 -337 17.2863 0.00348
NP_442743.1_1 Forward -322 -303 5.2102 0.281
NP_442743.1_4 Forward -347 -328 -2.75381 0.211
NP_442930.1_1 Reverse -324 -334 13.0576 0.239
NP_439910.1_2 Forward -356 -339 -13.6292 0.162
NP_440457.1_1 Reverse -335 -347 19.6068 0.0344
NP_440457.1_1 Forward -352 -340 0.0389777 0.25
NP_440213.1_5 Reverse -201 -220 8.45592 0.279
NP_440798.1_6 Forward -347 -334 21.5538 0.0108
NP_442509.1_9 Forward -348 -338 17.3841 0.00128
NP_442509.1_9 Reverse -339 -349 8.14104 0.192
NP_442509.1_9 Forward -280 -270 7.0594 0.24
NP_442936.1_10 Reverse -15 -29 8.01971 0.27
NP_440554.1_4 Reverse -340 -350 7.05986 0.106
NP_440554.1_4 Forward -347 -337 6.27322 0.123
NP_440554.1_4 Reverse -261 -271 5.78156 0.132
NP_441885.1_1 Forward -222 -208 16.0598 0.282
NP_441885.1_5 Reverse -339 -349 20.9245 0.000538
NP_441885.1_5 Forward -348 -338 11.3864 0.00668
NP_441885.1_5 Reverse -177 -187 -1.10161 0.25
NP_442703.1_9 Forward -368 -350 5.91901 0.244
NP_442341.1_7 Forward -349 -335 8.94771 0.0801
NP_442341.1_7 Reverse -338 -352 6.09611 0.135
NP_442341.1_7 Reverse -170 -184 3.93283 0.208
NP_442341.1_7 Forward -395 -381 1.47456 0.288
NP_442341.1_7 Forward -155 -141 1.47456 0.288
NP_442341.1_9 Forward -122 -108 6.88214 0.21
NP_442341.1_9 Forward -156 -142 5.1122 0.279
NP_443000.1_7 Forward -350 -340 17.0896 0.00865
NP_443000.1_7 Reverse -337 -347 2.14332 0.226
NP_440507.2_3 Forward -357 -338 12.3883 0.155
NP_441842.1_1 Forward -346 -333 17.6199 0.0273
NP_441842.1_10 Reverse -332 -346 11.7993 0.119
NP_440275.1_3 Reverse -337 -347 19.5479 0.00756
NP_440275.1_3 Forward -350 -340 8.1415 0.0602
NP_440091.1_1 Forward -352 -340 16.4603 0.0153
NP_440091.1_1 Reverse -335 -347 10.2654 0.0498
NP_442354.1_7 Forward -145 -126 10.7175 0.202
NP_440679.1_10 Reverse -179 -198 -14.6519 0.242
NP_443010.1_10 Reverse -336 -353 8.66545 0.16
NP_443010.1_10 Forward -351 -334 5.3799 0.205
NP_442451.1_2 Forward -356 -337 -0.4922 0.158
NP_442451.1_2 Forward -268 -249 -7.57203 0.237
NP_439962.1_4 Forward -277 -258 14.6508 0.106
NP_439962.1_8 Reverse -190 -209 10.0292 0.21
NP_442495.1_4 Reverse -278 -288 11.5831 0.271
NP_440149.1_8 Reverse -339 -358 0.491109 0.136
NP_440149.1_8 Reverse -177 -196 -2.16383 0.166
NP_441105.1_3 Reverse -166 -185 -0.197208 0.132
NP_441105.1_3 Forward -191 -172 -8.06369 0.265
NP_440216.1_1 Forward -348 -334 17.6992 0.00155
NP_440216.1_1 Reverse -339 -353 -1.8687 0.0412
NP_440216.1_1 Reverse -274 -288 -11.9968 0.236
NP_440216.1_9 Forward -220 -211 11.3078 0.269
NP_440172.1_1 Forward -348 -338 16.303 0.00854
NP_440172.1_1 Reverse -339 -349 15.0247 0.00945
NP_440046.1_4 Forward -91 -72 11.5042 0.287
NP_442662.1_7 Reverse -296 -315 14.1591 0.242
NP_442015.1_10 Reverse -335 -348 3.75586 0.178
NP_442015.1_10 Forward -352 -339 0.60927 0.221
NP_441226.1_7 Forward -347 -340 14.4934 0.0123
NP_441226.1_7 Reverse -340 -347 14.4934 0.0123
NP_441226.1_7 Forward -119 -112 9.47853 0.147
NP_440198.1_3 Reverse -141 -160 16.5182 0.231
NP_441111.1_7 Forward -347 -339 18.7023 0.00294
NP_441111.1_7 Reverse -340 -348 18.7023 0.00294
NP_442379.1_10 Reverse -332 -349 9.38028 0.0936
NP_442379.1_10 Forward -355 -338 -3.40274 0.259
NP_440244.1_1 Forward -224 -205 -6.98204 0.287
NP_441766.1_2 Forward -348 -339 17.5026 0.00297
NP_441766.1_2 Reverse -339 -348 17.5026 0.00297
NP_440416.1_1 Reverse -339 -358 -12.4886 0.272
NP_440416.1_9 Forward -355 -336 -14.6519 0.179
NP_440416.1_9 Reverse -253 -272 -18.7818 0.264
NP_443052.1_8 Reverse -329 -348 1.37609 0.061
NP_442116.1_6 Reverse -31 -48 11.1292 0.21
NP_442116.1_6 Forward -35 -18 6.35461 0.28
NP_440261.1_5 Forward -347 -334 16.4406 0.0106
NP_440261.1_5 Forward -282 -269 -6.56889 0.201
NP_440261.1_5 Forward -268 -255 -6.66722 0.201
NP_440988.1_10 Forward -350 -336 10.1267 0.187
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TAAAATAGGCATCAGCATAGCTAGGATCTAGCAGAATTAATTCCGTAAAAATGGCGATCGCCCCCCGGTAATTTTTTTTGATCCCCTCATCCATGCCATCAATTAACCTTTCCTCCAGGGGATGGTCCCCCAGCAATGGCAGGGAACGCTCACTGTCAACCATGTCTTGGGTTAACAGAGGCAAGGGAAAAACCAATGACAATGCCCCCAACATAGCCATAGCTATGGACAAGAGGGAGCGGCCTAGGGGATAACCATGGTTAACCATAGGATTTATCTATGCCAACGGTCTGGCTTTCGGGGACTTCCTGGCAAGGGTGTGCTAGCTTTAGCTAAAGTTGAGCCCATACCTAATCAATTCCTAGATTTTTTAACATAAATCTTCCCTTAGCGAGAAGCC

CDS

ATGCGCGCCCTATTAATCTATCCGTTGTTTCCCCCTACTTTCTGGTCCTACGAAAAAATTCTGGAGCTAGTGGGTCGGAAGGTTTTATTGCCTCCCCTAGGGTTGATCACCGTGGCGGGCATTCTCCCTCAAGAATGGGAGTTTAAGCTGGTGGACCGCAATGTCCGCAATGTGACCGAAGCGGAATGGGATTGGGCGGAAGTAGTAATCATTTCCGGCATGATTGTCCAGCGGGATGACATGGTGGAAAACATCAAGGAAGCTAAGGCCCACGGTAAGTTGGTCGCAGTGGGAGGCCCCTTTGCCACGTCAGTACCGGATGAAGTGCAGAATGCCGGAGCAGACTTTTTGATTTTGGACGAAGGGGAAATTACCCTACCCCTGTTTGTGGAAGCGTTGGAGCGGGGGGAAACAGCAGGTATTATCCGGGCCCAAGAAAAACCCGACGTTACCACTACCCCCATTCCCCGCTATGACCTGCTGGAATTGGATGCCTACGATTCCATGTCGGTGCAGTTTTCCCGGGGTTGTCCTTTCCAGTGTGAATTTTGCGACATTATTGTCCTCTACGGCCGTAAGCCTCGCACCAAGGAACCAGCCCAGTTACTCAGGGAATTGGATTATCTTTACGAGTTGGGTTGGCGGCGATCGGTGTTTATGGTGGATGACAATTTCATCGGCAATAAGCGCAACGTTAAATTACTGCTCAAGGAACTGAAAGTTTGGCAGGAAGAGCACCAATATCCCTTTAGATTCAACACTGAAGCCTCGGTGGATTTGGCCGATGACCAGGAATTAATGGATTTGATGGTGGAGTGCTATTTTGATGCGGTCTTTTTGGGCATTGAAACCCCCGATGAAGAGAGTTTAGAATTCACCAAAAAATTCCAAAATACCCGTAATTCCCTCGCGGACTCCGTTGATAAAATCATCAAAGCTGGTCTGCGACCCATGGCGGGCTTCATCATCGGTTTTGATGGGGAAAAACAGGGGGCTGGCGATCGCATTGTCCGTTTTGCGGAACAGACGGCCATTCCCACCACCACCTTTGCCATGCTCCAGGCTTTACCCAACACAGCCCTGTGGCATCGACTAAAACGGGAAAATCGCCTGCTGGATGAGAGCAAAGGCAACATCAACCAAACCACGTTGATGAACTTTATTCCCACTCGCCCCTTGGAAGACATTGCCAACGAGTATGTGGAGGCTTTCTGGGAGTTATACGATCCCCATGGCTATTTAGACCGCAATTACCGTTGTTTTCTCAAGCTGGGGGCACCGAAATGCAAGACCGCTTTCAAACTCCCCAATTTAGTGGATTTAAAGGCTTTGGCGATTGTAATTTGGCGGCAGGGCGTTAAACGGGACACTAGGTTCCGCTTCTGGCACCATGCTTTCGGTATTTTGCGCCATAATCCCGCCGTGTTTGAGCACTACATCACCCTTTGCGCCCATAACGAACATTTCCTCCAATACCGGGAAATTGTCCGCCAGGAAATTGGTGAACAATTGCGAGATTATCTCAGCCGCCAACAACAGGACAAAGTAGAAGAAACAGTTCTCAGTCCAACGGCGATCGCCGCAGAAACAGAAAAAGTTCTAGCTAGTTAA

Protein

MRALLIYPLFPPTFWSYEKILELVGRKVLLPPLGLITVAGILPQEWEFKLVDRNVRNVTEAEWDWAEVVIISGMIVQRDDMVENIKEAKAHGKLVAVGGPFATSVPDEVQNAGADFLILDEGEITLPLFVEALERGETAGIIRAQEKPDVTTTPIPRYDLLELDAYDSMSVQFSRGCPFQCEFCDIIVLYGRKPRTKEPAQLLRELDYLYELGWRRSVFMVDDNFIGNKRNVKLLLKELKVWQEEHQYPFRFNTEASVDLADDQELMDLMVECYFDAVFLGIETPDEESLEFTKKFQNTRNSLADSVDKIIKAGLRPMAGFIIGFDGEKQGAGDRIVRFAEQTAIPTTTFAMLQALPNTALWHRLKRENRLLDESKGNINQTTLMNFIPTRPLEDIANEYVEAFWELYDPHGYLDRNYRCFLKLGAPKCKTAFKLPNLVDLKALAIVIWRQGVKRDTRFRFWHHAFGILRHNPAVFEHYITLCAHNEHFLQYREIVRQEIGEQLRDYLSRQQQDKVEETVLSPTAIAAETEKVLAS