Your browser is old and dusty. Try Google Chrome!

Details for sll1233

ORF sll1233
Accession NP_441402.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440815.1_5 Forward -320 -301 3.34271 0.286
NP_441453.1_7 Reverse -388 -395 14.1988 0.175
NP_439979.1_9 Forward -182 -164 7.78729 0.279
NP_442062.1_3 Forward -66 -47 8.94757 0.152
NP_442062.1_8 Forward -342 -332 9.22315 0.0658
NP_441802.1_1 Reverse -354 -373 9.3409 0.216
NP_440916.1_1 Forward -175 -161 9.73436 0.226
NP_441200.1_4 Reverse -352 -371 6.68596 0.272
NP_442889.1_10 Reverse -44 -63 12.9255 0.193
NP_442920.1_1 Forward -64 -45 18.3454 0.269
NP_442570.1_3 Reverse -303 -322 -7.08038 0.265
NP_441327.1_1 Reverse -287 -306 4.5017 0.267
NP_442111.1_3 Reverse -113 -126 13.4306 0.261
NP_440438.2_8 Forward -66 -47 8.55425 0.118
NP_442145.1_4 Reverse -47 -66 9.11906 0.175
NP_442145.1_4 Forward -67 -48 8.06865 0.199
NP_440470.1_5 Reverse -43 -62 11.5064 0.173
NP_440842.1_10 Reverse -348 -362 2.45787 0.274
NP_443018.1_3 Forward -341 -334 8.49558 0.141
NP_441077.1_2 Forward -67 -48 1.86167 0.282
NP_441077.1_6 Reverse -43 -59 5.30845 0.251
NP_442958.1_3 Reverse -139 -158 -2.36049 0.293
NP_442530.1_2 Forward -235 -225 12.2714 0.278
NP_440642.1_10 Forward -362 -348 6.58715 0.225
NP_440656.1_2 Forward -236 -217 3.04771 0.221
NP_440184.1_1 Reverse -50 -69 0.866391 0.291
NP_442937.1_5 Reverse -228 -247 6.68596 0.272
NP_441317.1_4 Forward -229 -215 11.7557 0.248
NP_441317.1_4 Forward -135 -121 10.1324 0.29
NP_442690.1_1 Forward -137 -118 2.26107 0.096
NP_442690.1_1 Forward -65 -46 -7.57203 0.175
NP_442690.1_1 Forward -231 -212 -10.6203 0.217
NP_442690.1_1 Forward -230 -211 -16.8151 0.291
NP_442064.1_10 Reverse -43 -62 16.0274 0.127
NP_441099.1_10 Forward -57 -47 16.8925 0.254
NP_442002.1_1 Forward -273 -255 -10.3056 0.292
NP_440377.1_1 Forward -378 -361 14.5592 0.195
NP_442231.1_8 Reverse -322 -341 20.944 0.098
NP_440345.1_3 Reverse -212 -226 14.0489 0.216
NP_442996.1_1 Reverse -82 -101 11.1244 0.21
NP_442281.1_1 Forward -347 -333 3.73557 0.221
NP_441079.1_7 Reverse -43 -62 3.44025 0.168
NP_441079.1_7 Reverse -44 -63 0.785326 0.184
NP_441079.1_7 Forward -63 -44 -6.3928 0.276
NP_440780.1_1 Reverse -358 -377 10.5514 0.259
NP_442933.1_6 Reverse -47 -66 12.5568 0.287
NP_440382.1_2 Reverse -120 -139 2.55527 0.284
NP_442970.1_3 Forward -146 -128 12.1132 0.251
NP_440919.1_1 Forward -308 -289 -9.14533 0.297
NP_441711.1_3 Reverse -173 -191 16.3421 0.251
NP_441717.1_3 Forward -229 -210 18.5831 0.138
NP_441637.1_9 Reverse -373 -391 -3.22577 0.296
NP_441637.1_9 Reverse -192 -210 -4.01242 0.296
NP_441764.1_8 Forward -180 -170 11.3107 0.284
NP_441911.1_10 Reverse -114 -133 19.935 0.0263
NP_442739.1_2 Forward -133 -114 11.6148 0.246
NP_441498.1_3 Forward -178 -160 7.19654 0.268
NP_441549.1_9 Forward -387 -369 -10.3056 0.274
NP_441467.1_10 Reverse -193 -207 6.58777 0.281
NP_442965.1_2 Reverse -352 -371 -5.9004 0.255
NP_442998.1_5 Reverse -357 -367 8.82982 0.261
NP_441362.1_2 Reverse -116 -135 4.5041 0.269
NP_440717.1_3 Reverse -383 -397 7.66879 0.28
NP_440164.1_1 Forward -281 -262 4.32602 0.26
NP_441866.1_4 Forward -134 -121 13.8285 0.273
NP_441464.1_10 Forward -121 -107 8.16106 0.287
NP_442240.1_1 Forward -170 -151 3.24359 0.293
NP_442959.1_5 Forward -379 -360 9.0459 0.224
NP_442959.1_5 Reverse -358 -377 6.68596 0.251
NP_440027.1_4 Forward -65 -46 14.6326 0.0519
NP_439937.1_9 Reverse -29 -46 -10.2866 0.227
NP_441657.1_5 Forward -274 -255 -0.590531 0.24
NP_440439.1_6 Forward -375 -356 1.37609 0.286
NP_440819.1_5 Reverse -164 -172 7.8859 0.266
NP_440819.1_5 Reverse -356 -364 7.68924 0.266
NP_441877.1_5 Reverse -166 -185 5.211 0.2
NP_441877.1_9 Reverse -48 -65 3.77542 0.284
NP_441877.1_9 Forward -67 -50 2.39878 0.29
NP_441018.1_3 Forward -130 -111 9.83173 0.291
NP_442262.1_10 Forward -341 -334 8.59391 0.22
NP_440531.1_8 Forward -180 -161 9.3409 0.216
NP_442917.1_1 Reverse -46 -65 7.07848 0.254
NP_442750.1_3 Reverse -321 -340 -12.7836 0.288
NP_442556.1_10 Forward -47 -28 9.49925 0.277
NP_441103.1_9 Forward -363 -353 12.4895 0.291
NP_440894.1_10 Forward -170 -151 3.53937 0.271
NP_442710.1_7 Forward -62 -43 -8.08773 0.299
NP_442337.1_8 Reverse -299 -318 3.6377 0.216
NP_440255.1_7 Reverse -277 -294 13.8052 0.244
NP_442780.1_1 Forward -64 -45 9.43923 0.217
NP_441068.1_2 Forward -179 -160 9.63589 0.237
NP_440296.1_6 Forward -61 -43 10.6971 0.295
NP_441982.1_6 Reverse -184 -193 15.2546 0.274
NP_441982.1_6 Reverse -217 -226 11.3395 0.288
NP_442689.1_8 Forward -227 -210 -2.91109 0.238
NP_442689.1_8 Forward -61 -44 -6.451 0.285
NP_441349.1_10 Forward -122 -103 -6.88371 0.238
NP_442843.1_1 Reverse -334 -353 6.78429 0.139
NP_442843.1_1 Reverse -161 -180 -9.53865 0.266
NP_442843.1_6 Reverse -365 -384 5.60432 0.279
NP_441477.1_5 Forward -249 -230 9.24257 0.268
NP_441031.1_1 Reverse -45 -64 12.3179 0.161
NP_441031.1_1 Reverse -214 -233 4.21976 0.292
NP_440943.1_1 Forward -49 -30 15.5357 0.166
NP_440526.1_3 Reverse -381 -392 0.353199 0.287
NP_441432.1_9 Forward -375 -362 11.2162 0.235
NP_442815.1_2 Reverse -30 -48 4.83737 0.237
NP_441057.1_4 Forward -178 -160 -3.71743 0.297
NP_441022.1_1 Reverse -43 -52 15.9587 0.163
NP_440708.1_6 Forward -357 -338 -9.14533 0.261
NP_440335.1_9 Reverse -115 -133 10.3439 0.28
NP_440352.1_4 Forward -61 -47 17.7731 0.173
NP_440352.1_5 Forward -189 -170 14.4078 0.149
NP_441923.1_6 Forward -274 -260 8.45605 0.278
NP_441126.1_6 Forward -59 -45 14.231 0.267
NP_440459.1_3 Reverse -156 -175 12.0942 0.119
NP_442603.1_7 Reverse -233 -247 5.40719 0.296
NP_441585.1_5 Forward -185 -166 10.9134 0.211
NP_441329.1_1 Forward -68 -49 6.54077 0.256
NP_442943.1_1 Forward -71 -56 6.07244 0.206
NP_441609.1_1 Forward -134 -115 0.491109 0.21
NP_441490.1_1 Forward -328 -309 16.6174 0.105
NP_441892.1_1 Forward -351 -334 3.87375 0.119
NP_442325.1_8 Forward -148 -129 14.1136 0.29
NP_442105.1_9 Forward -244 -230 13.7693 0.294
NP_441769.1_3 Reverse -54 -73 -5.70449 0.249
NP_441541.1_1 Forward -67 -49 11.461 0.0858
NP_441541.1_1 Reverse -48 -66 6.20896 0.156
NP_441617.1_6 Forward -135 -116 -4.03212 0.265
NP_442465.1_9 Reverse -120 -134 9.2427 0.298
NP_442565.1_6 Reverse -353 -367 16.6175 0.28
NP_442479.1_9 Forward -389 -370 -11.7019 0.275
NP_442402.1_4 Forward -374 -355 1.76863 0.173
NP_442402.1_4 Forward -290 -271 -4.72118 0.229
NP_441848.1_4 Forward -60 -44 10.1289 0.265
NP_441848.1_4 Reverse -159 -175 9.65149 0.275
NP_441848.1_4 Reverse -212 -228 6.97771 0.3
NP_441848.1_7 Forward -370 -351 23.1063 0.0365
NP_442039.1_10 Forward -329 -311 13.7847 0.227
NP_442456.1_5 Reverse -346 -364 7.00065 0.26
NP_442532.1_4 Reverse -360 -378 7.38318 0.3
NP_441576.1_10 Forward -379 -360 13.6675 0.234
NP_442533.1_3 Forward -193 -175 16.2278 0.249
NP_442541.1_4 Reverse -99 -117 19.5862 0.101
NP_442541.1_10 Forward -169 -155 9.43874 0.204
NP_441482.1_9 Forward -177 -164 14.965 0.278
NP_441697.1_5 Reverse -44 -63 9.69201 0.135
NP_441697.1_5 Forward -61 -42 0.238307 0.195
NP_441697.1_5 Forward -71 -52 -0.907597 0.204
NP_441697.1_5 Reverse -213 -232 -9.02441 0.268
NP_441697.1_5 Forward -62 -43 -10.6478 0.28
NP_441697.1_5 Forward -149 -130 -10.8388 0.286
NP_441028.1_6 Forward -364 -354 7.35439 0.229
NP_441028.1_6 Forward -363 -353 5.38779 0.255
NP_441028.1_6 Forward -226 -216 4.30615 0.278
NP_441527.1_4 Forward -309 -290 -2.14899 0.154
NP_441527.1_8 Reverse -238 -257 5.40766 0.279
NP_441059.1_10 Reverse -348 -361 12.409 0.226
NP_441972.1_5 Reverse -334 -353 -10.0303 0.296
NP_441869.1_8 Forward -335 -316 17.7965 0.2
NP_439903.1_6 Forward -101 -82 3.83357 0.206
NP_440886.1_7 Reverse -379 -389 3.12618 0.296
NP_440492.1_4 Forward -59 -40 12.8246 0.28
NP_440766.1_5 Reverse -183 -195 8.22874 0.285
NP_440422.1_10 Forward -231 -212 4.78914 0.281
NP_442867.1_8 Forward -356 -337 5.01433 0.277
NP_440987.1_6 Reverse -51 -70 15.0315 0.199
NP_442582.1_6 Reverse -47 -66 19.2781 0.0923
NP_441275.1_2 Forward -247 -228 12.5858 0.1
NP_442451.1_2 Reverse -161 -180 -9.34199 0.259
NP_441207.1_7 Reverse -43 -57 15.4514 0.179
NP_442371.1_1 Forward -106 -96 11.8776 0.273
NP_441852.1_7 Reverse -308 -327 23.4022 0.023
NP_442015.1_3 Forward -330 -311 12.0933 0.27
NP_442417.1_3 Reverse -145 -159 17.2953 0.273
NP_442116.1_6 Forward -230 -213 10.7472 0.215
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATATTCCCAGGGATGATGACGGTAAAATTGCCAACTTTTTTCCCCTTGCACCTAACTGGGCCATTGAAATTCTTTCTCCAGATCAAAGCCAAACTAGGGTAATTAGAAATATTCTCCACTGTTTAAACCATGGTAGCGAAATGGGTTGGTTAATTGATCCTGCTGAGCAAATTATTTTTACCTATATTTCAGGAAAACAGCCGAATATTTTTGACCAAGCGGAGCAAATTTTACCCGTGCCAACCTTTGCTTCCAGTCTACAAATTAATTTTGGCTTAGTTTTTGATTGGCTCTCAGAATAAAATCATCGTCATAGTCTAAACAGCCTGAAAGTATTTAAGAATTCTTAAAATTTTTGTCGGCATATCCTCCAATAATCAACTCTAGATTTTCTGATTTT

CDS

ATGGCAACCTATCGCATTGAACATCACACTGAATATCGCTTTAATCAGCCCGTTTATTTACGTCCTCACCGTTTACGATTGCGACCCCGCAGTAATGGTTGGCAAAATCTGCTGACCTATAATCTAACCATTGATCCCCTCCCTGCCGGTTTAGCGGAAATCACCACCCTCGATGGCAATGGCGAACAAAAAGTATGGTTCACTGACCCCACAGAAAAGCTGGCGATCGCCGTGGAATCCTTTGTGCAAACCACCATGGAAAATCCCTTCAACTTTTTGCTAGAACCGTGGGCATTAAAACTACCATTTGACTATCCCCAATCCCTGGCTCAACAATTGAGGGGTTACTTGGTGCCCTACGAAGGTCGTCTTGATCCGGTGGCCGTGGAACTAGCCCAGGACATTGCCCATGATTGCCAGCGACAACCGATCGCCTTTTTACAAAATTTGACCCAAAAACTCTACGAACATTGTACCTATACAGTGCGGGCTATCGGGGAGCCCTGGGAAGCGGGGGTGACTTGGCGCAGTCGAGAAGGCTCCTGTCGAGATCTAACAGTGCTATTTATGGAAGTCTGTCGCGCCATGGGTTTAGCCGCCCGGTTTGTCAGTGGTTACGAAGTGGGAGATCCGGAGATTAGTCAATGGGAACTCCATGCCTGGGCGGAAGTGTACTTGCCTGGAGCTGGTTGGCGGGGCTATGACCCTACCCATGGTTTGGCGGTTGGCGATCGCCATATTGCGTTGGTGGCCAGTGCCATTCCCGCCTATTGCAGTCCGGTGGGGGGAGAAGTGGCACCGGTGAAAACTTTCCTGGAAACAGGTTTGACGGTGCAATCGGAACTAGAAACGGAGGTAAAAATCACCGCTGTGAATGATATTTAA

Protein

MATYRIEHHTEYRFNQPVYLRPHRLRLRPRSNGWQNLLTYNLTIDPLPAGLAEITTLDGNGEQKVWFTDPTEKLAIAVESFVQTTMENPFNFLLEPWALKLPFDYPQSLAQQLRGYLVPYEGRLDPVAVELAQDIAHDCQRQPIAFLQNLTQKLYEHCTYTVRAIGEPWEAGVTWRSREGSCRDLTVLFMEVCRAMGLAARFVSGYEVGDPEISQWELHAWAEVYLPGAGWRGYDPTHGLAVGDRHIALVASAIPAYCSPVGGEVAPVKTFLETGLTVQSELETEVKITAVNDI