Your browser is old and dusty. Try Google Chrome!

Details for sll1224

ORF sll1224
Accession NP_441414.1
Symbol hoxY
Category Hydrogenase
Definition hydrogenase subunit of the bidirectional hydrogenase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -107 -93 4.91614 0.142
NP_440795.1_7 Forward -107 -100 14.6904 0.0123
NP_440795.1_7 Reverse -100 -107 14.6904 0.0123
NP_441418.1_6 Forward -108 -89 -29.0082 0.215
NP_441418.1_6 Reverse -99 -118 -29.0082 0.215
NP_442291.1_5 Reverse -98 -114 13.2349 0.0306
NP_440897.1_6 Forward -108 -89 9.34008 0.0705
NP_441453.1_1 Reverse -92 -110 2.47668 0.291
NP_441453.1_4 Reverse -99 -107 16.539 0.00633
NP_441453.1_4 Forward -108 -100 16.539 0.00633
NP_441623.1_1 Reverse -203 -221 -3.42244 0.258
NP_442151.1_6 Reverse -99 -113 8.45605 0.172
NP_442151.1_6 Forward -108 -94 8.25939 0.178
NP_441818.1_1 Reverse -100 -111 10.1862 0.232
NP_440226.1_1 Reverse -99 -118 10.0292 0.0665
NP_440226.1_1 Forward -108 -89 4.81767 0.178
NP_442623.1_3 Reverse -295 -314 -9.93197 0.163
NP_440150.1_6 Reverse -243 -262 0.884433 0.295
NP_442744.1_9 Forward -114 -100 14.1927 0.266
NP_442173.1_1 Forward -107 -99 15.4574 0.00633
NP_442173.1_1 Reverse -100 -108 15.4574 0.00633
NP_442752.1_4 Forward -108 -101 13.8055 0.0199
NP_442752.1_4 Reverse -99 -106 13.8055 0.0199
NP_443027.1_4 Reverse -97 -107 14.828 0.0437
NP_443027.1_4 Reverse -187 -197 5.87989 0.294
NP_439997.1_3 Reverse -62 -81 13.5691 0.164
NP_441812.1_3 Forward -109 -95 15.0442 0.106
NP_441812.1_3 Forward -292 -278 13.5693 0.163
NP_442975.1_10 Reverse -95 -109 12.782 0.0459
NP_442975.1_10 Forward -112 -98 2.45727 0.274
NP_440784.1_7 Forward -107 -100 15.9687 0.0123
NP_440784.1_7 Reverse -100 -107 15.9687 0.0123
NP_442909.1_7 Reverse -100 -114 8.84875 0.161
NP_441438.1_1 Forward -27 -8 8.45592 0.228
NP_440110.1_8 Forward -110 -91 -0.000545616 0.216
NP_439979.1_7 Reverse -192 -209 14.3952 0.267
NP_442062.1_8 Forward -108 -98 19.4496 0.000558
NP_442062.1_8 Reverse -99 -109 17.3846 0.00193
NP_440304.1_4 Reverse -97 -107 10.8948 0.051
NP_440304.1_4 Forward -110 -100 1.84832 0.299
NP_442242.1_4 Forward -107 -100 14.3954 0.0124
NP_442242.1_4 Reverse -100 -107 14.3954 0.0124
NP_440044.1_8 Reverse -100 -119 15.9291 0.0239
NP_441619.1_8 Forward -114 -100 10.6187 0.185
NP_441208.1_9 Forward -111 -97 11.5043 0.15
NP_441594.1_6 Reverse -70 -89 0.58944 0.282
NP_440370.1_10 Forward -117 -98 7.37428 0.258
NP_442110.1_7 Forward -276 -262 0.196253 0.266
NP_440769.1_8 Forward -126 -107 9.43923 0.214
NP_441083.1_5 Reverse -99 -109 20.3345 0.00053
NP_441083.1_5 Forward -108 -98 11.3864 0.0159
NP_442827.1_8 Reverse -91 -110 0.785326 0.196
NP_441738.1_2 Forward -106 -99 15.28 0.0102
NP_441738.1_2 Reverse -101 -108 15.28 0.0102
NP_441558.1_5 Reverse -97 -116 5.70265 0.242
NP_441645.1_2 Forward -354 -335 15.6341 0.175
NP_440209.1_1 Reverse -99 -107 18.1123 0.00295
NP_440209.1_1 Forward -108 -100 18.1123 0.00295
NP_442889.1_8 Reverse -96 -110 21.4351 0.00292
NP_440178.1_7 Reverse -98 -117 -12.9802 0.129
NP_440178.1_7 Forward -109 -90 -13.3736 0.136
NP_442059.1_8 Forward -348 -329 16.0265 0.244
NP_442570.1_3 Forward -266 -247 -6.39206 0.257
NP_441327.1_4 Forward -115 -101 18.0925 0.282
NP_442111.1_4 Forward -109 -95 9.34103 0.0609
NP_440906.1_5 Forward -107 -100 15.8704 0.0124
NP_440906.1_5 Reverse -100 -107 15.8704 0.0124
NP_440438.2_8 Forward -38 -19 2.45773 0.262
NP_440747.1_10 Forward -111 -99 14.9853 0.00221
NP_440747.1_10 Reverse -96 -108 -2.1243 0.0225
NP_441130.1_10 Reverse -97 -111 10.9143 0.109
NP_441486.1_1 Forward -111 -97 20.0591 0.00312
NP_441486.1_1 Reverse -96 -110 13.7659 0.00763
NP_441194.1_1 Forward -41 -22 13.4162 0.238
NP_442145.1_4 Forward -39 -20 3.00757 0.299
NP_440470.1_5 Forward -44 -25 14.5621 0.158
NP_441014.1_10 Forward -109 -90 11.7 0.118
NP_441014.1_10 Reverse -98 -117 0.490334 0.243
NP_442848.1_1 Forward -114 -100 7.17775 0.0791
NP_442848.1_5 Reverse -153 -171 0.117479 0.276
NP_442848.1_5 Reverse -246 -264 -1.75081 0.276
NP_443018.1_3 Forward -107 -100 14.8871 0.0123
NP_443018.1_3 Reverse -100 -107 14.8871 0.0123
NP_441634.1_8 Forward -110 -96 -3.147 0.295
NP_440376.1_1 Forward -108 -99 19.4693 0.000692
NP_440376.1_1 Reverse -99 -108 19.4693 0.000692
NP_440376.1_1 Reverse -153 -162 -0.786921 0.293
NP_441588.1_4 Reverse -101 -111 18.1713 0.0143
NP_442687.1_7 Reverse -98 -108 15.8113 0.0125
NP_442687.1_7 Forward -109 -99 8.92815 0.0994
NP_442687.1_7 Forward -206 -196 4.79825 0.234
NP_441077.1_2 Forward -40 -21 3.38954 0.251
NP_441763.1_10 Reverse -88 -107 7.4718 0.237
NP_442658.1_1 Reverse -97 -107 15.9091 0.00966
NP_442658.1_1 Forward -110 -100 6.76441 0.214
NP_442544.1_2 Forward -347 -333 -1.67204 0.287
NP_442544.1_2 Forward -272 -258 -1.67204 0.287
NP_441414.1_1 Forward -273 -254 36.6769 0.00000584
NP_441414.1_2 Forward -174 -155 34.2186 0.0000134
NP_441414.1_3 Forward -294 -275 32.7437 0.000107
NP_441414.1_4 Forward -318 -299 29.4004 0.00051
NP_441414.1_5 Forward -339 -320 34.317 0.000011
NP_441414.1_6 Forward -222 -203 29.2038 0.000517
NP_441414.1_7 Forward -194 -175 32.7437 0.0000498
NP_441414.1_8 Forward -150 -131 26.7455 0.00303
NP_441414.1_9 Forward -108 -89 26.1555 0.00163
NP_441414.1_9 Reverse -99 -118 -2.0655 0.11
NP_441414.1_10 Forward -369 -350 29.7937 0.000747
NP_440184.1_1 Forward -37 -18 6.60859 0.181
NP_441487.1_9 Reverse -98 -117 10.2259 0.0919
NP_442937.1_5 Forward -113 -94 15.5357 0.0581
NP_441958.1_5 Forward -109 -99 12.2714 0.00183
NP_441958.1_5 Reverse -98 -108 12.2714 0.00183
NP_440318.1_1 Forward -88 -69 4.71934 0.239
NP_439905.1_1 Forward -107 -94 10.344 0.216
NP_440984.1_7 Reverse -94 -108 13.5693 0.106
NP_440984.1_7 Forward -113 -99 5.30946 0.259
NP_442364.1_2 Forward -87 -68 8.84924 0.279
NP_442690.1_1 Forward -34 -15 -11.5053 0.23
NP_442690.1_1 Reverse -22 -41 -15.7335 0.28
NP_442911.1_2 Reverse -89 -108 5.70265 0.0321
NP_442051.1_5 Reverse -70 -89 15.0441 0.29
NP_443055.1_6 Forward -116 -98 4.63995 0.181
NP_440496.1_5 Reverse -109 -128 13.1297 0.224
NP_442002.1_9 Reverse -98 -105 10.7572 0.185
NP_441294.1_7 Forward -112 -98 9.25063 0.256
NP_442438.1_10 Reverse -94 -108 3.44117 0.162
NP_442431.1_10 Forward -204 -186 1.98577 0.244
NP_441000.1_6 Reverse -98 -112 3.63784 0.108
NP_440147.1_4 Forward -110 -97 10.049 0.0355
NP_440147.1_4 Reverse -97 -110 3.46087 0.187
NP_441550.1_8 Forward -110 -100 14.6309 0.0132
NP_441550.1_8 Reverse -97 -107 6.0761 0.214
NP_441916.1_7 Forward -108 -98 18.4663 0.00144
NP_441916.1_7 Reverse -99 -109 10.3048 0.0261
NP_441041.1_4 Forward -108 -89 2.0644 0.0758
NP_441041.1_4 Reverse -99 -118 1.17943 0.0814
NP_441041.1_4 Reverse -148 -167 -7.08038 0.181
NP_441041.1_4 Forward -183 -164 -8.55534 0.204
NP_441041.1_7 Forward -111 -99 11.8878 0.0689
NP_441041.1_7 Reverse -193 -205 8.87526 0.128
NP_442396.1_5 Reverse -95 -108 16.3422 0.0475
NP_442004.1_6 Forward -168 -154 5.01447 0.199
NP_441725.1_5 Forward -107 -97 11.2881 0.0247
NP_441725.1_5 Reverse -100 -110 2.04498 0.115
NP_439966.1_7 Reverse -97 -107 18.4657 0.00473
NP_439966.1_7 Forward -110 -100 7.25606 0.15
NP_439966.1_9 Reverse -97 -106 0.983037 0.253
NP_440202.1_8 Reverse -91 -110 9.90358 0.297
NP_442941.1_3 Forward -107 -97 11.4848 0.0116
NP_442941.1_3 Reverse -100 -110 11.0914 0.0116
NP_440289.1_2 Reverse -96 -109 11.819 0.0171
NP_440289.1_2 Forward -111 -98 -2.144 0.251
NP_442281.1_1 Forward -113 -99 18.5835 0.00414
NP_442281.1_1 Reverse -94 -108 10.422 0.0589
NP_441079.1_7 Forward -23 -4 -2.65624 0.22
NP_440177.1_1 Reverse -149 -167 4.24738 0.272
NP_442256.1_2 Forward -110 -92 -6.86402 0.214
NP_440437.1_1 Reverse -93 -112 -0.983855 0.192
NP_440437.1_1 Reverse -261 -280 -5.99873 0.3
NP_440647.1_9 Forward -110 -92 7.78729 0.219
NP_440498.1_1 Reverse -90 -108 1.78911 0.202
NP_440375.1_8 Forward -107 -88 7.07928 0.166
NP_441644.1_6 Reverse -99 -109 17.3841 0.00127
NP_441644.1_6 Forward -108 -98 10.1076 0.0628
NP_442215.1_2 Forward -110 -94 5.17175 0.0796
NP_442215.1_2 Reverse -97 -113 -1.90808 0.189
NP_442215.1_2 Forward -84 -68 -7.0213 0.284
NP_442247.1_8 Forward -110 -96 9.63603 0.247
NP_440253.1_2 Reverse -99 -117 5.03403 0.0989
NP_440929.1_8 Forward -108 -99 19.2726 0.000701
NP_440929.1_8 Reverse -99 -108 19.2726 0.000701
NP_442933.1_10 Forward -108 -99 17.601 0.00325
NP_442933.1_10 Reverse -99 -108 17.601 0.00325
NP_441751.2_8 Reverse -100 -114 -3.24533 0.137
NP_442554.1_8 Reverse -100 -110 15.3197 0.00882
NP_442554.1_8 Forward -107 -97 13.8447 0.0145
NP_441586.1_5 Reverse -237 -256 5.30933 0.29
NP_441762.1_7 Reverse -98 -110 9.57708 0.0142
NP_441762.1_7 Forward -109 -97 2.89058 0.0676
NP_442142.1_4 Forward -111 -98 13.49 0.0348
NP_442142.1_4 Reverse -96 -109 7.88518 0.127
NP_442292.1_1 Reverse -100 -109 18.486 0.00229
NP_442292.1_1 Forward -107 -98 9.63616 0.0183
NP_440919.1_1 Reverse -94 -113 -6.68705 0.258
NP_442476.1_6 Forward -107 -93 5.70279 0.131
NP_443009.1_5 Forward -109 -98 18.3477 0.00265
NP_441715.1_4 Forward -107 -97 16.303 0.0117
NP_441715.1_4 Reverse -100 -110 7.94484 0.107
NP_441198.1_5 Reverse -101 -114 12.7034 0.216
NP_440464.1_10 Reverse -100 -110 13.0082 0.169
NP_441468.1_1 Forward -107 -100 15.8704 0.0124
NP_441468.1_1 Reverse -100 -107 15.8704 0.0124
NP_439939.1_3 Forward -368 -349 3.04771 0.214
NP_441020.2_6 Forward -110 -93 14.9851 0.0457
NP_441020.2_6 Reverse -97 -114 6.72535 0.257
NP_441673.1_1 Forward -108 -99 20.8459 0.000698
NP_441673.1_1 Reverse -99 -108 20.8459 0.000698
NP_441876.1_9 Reverse -241 -251 10.796 0.287
NP_441826.1_2 Forward -114 -100 2.2612 0.132
NP_441826.1_2 Reverse -93 -107 -4.32697 0.295
NP_442868.1_6 Forward -110 -100 9.81313 0.038
NP_442868.1_6 Reverse -97 -107 0.963343 0.205
NP_441251.1_8 Reverse -14 -27 15.436 0.254
NP_441612.1_2 Reverse -99 -109 8.54929 0.21
NP_442808.1_1 Reverse -98 -108 18.4657 0.00201
NP_442808.1_1 Forward -109 -99 8.63269 0.0481
NP_442808.1_1 Reverse -246 -256 4.50281 0.197
NP_440145.1_3 Forward -118 -99 16.5191 0.00993
NP_442542.1_2 Reverse -71 -84 4.73917 0.298
NP_442050.1_5 Reverse -97 -107 9.12434 0.193
NP_442050.1_5 Forward -110 -100 7.64939 0.243
NP_441114.1_3 Forward -338 -329 6.39124 0.277
NP_440111.2_8 Reverse -194 -210 25.4279 0.0153
NP_441048.1_1 Forward -120 -101 17.0107 0.287
NP_441048.1_6 Reverse -83 -97 15.5768 0.296
NP_442789.1_4 Forward -110 -91 -6.78538 0.288
NP_441518.1_3 Reverse -335 -354 -12.6852 0.263
NP_441518.1_3 Forward -118 -99 -15.7335 0.299
NP_441878.1_6 Forward -109 -99 10.4031 0.0176
NP_441878.1_6 Reverse -98 -108 10.4031 0.0176
NP_441878.1_6 Reverse -72 -82 -6.60814 0.193
NP_441036.1_8 Reverse -98 -108 17.7779 0.000554
NP_441036.1_8 Forward -109 -99 8.33817 0.174
NP_441557.1_5 Forward -108 -99 19.9609 0.000699
NP_441557.1_5 Reverse -99 -108 19.9609 0.000699
NP_441445.1_1 Forward -117 -98 9.24257 0.108
NP_442066.2_9 Reverse -95 -108 11.524 0.154
NP_441308.1_8 Reverse -97 -107 10.1081 0.22
NP_441458.1_10 Forward -192 -173 1.57275 0.288
NP_442830.1_5 Reverse -247 -261 2.35894 0.271
NP_441564.1_10 Forward -123 -104 4.81767 0.239
NP_442183.1_1 Forward -108 -94 13.9626 0.0376
NP_442183.1_1 Reverse -99 -113 7.76774 0.131
NP_441574.1_1 Forward -94 -75 6.29264 0.115
NP_440276.1_8 Forward -272 -253 8.35759 0.27
NP_442347.1_2 Reverse -100 -109 12.4878 0.056
NP_442347.1_2 Forward -107 -98 11.1111 0.056
NP_442645.1_2 Forward -116 -97 -3.04881 0.0487
NP_442645.1_2 Reverse -195 -214 -16.6185 0.237
NP_441037.1_1 Reverse -114 -133 19.5664 0.112
NP_441037.1_4 Forward -110 -100 7.9999 0.237
NP_441037.1_4 Reverse -97 -107 7.02532 0.237
NP_441633.1_3 Forward -110 -97 8.47575 0.0377
NP_441633.1_3 Reverse -97 -110 -3.71729 0.177
NP_440136.1_2 Forward -107 -100 15.9687 0.0123
NP_440136.1_2 Reverse -100 -107 15.9687 0.0123
NP_441728.2_4 Forward -41 -22 11.9838 0.278
NP_442998.1_5 Reverse -351 -361 12.0747 0.176
NP_442998.1_10 Forward -106 -99 15.5754 0.0102
NP_442998.1_10 Reverse -101 -108 15.5754 0.0102
NP_440299.1_1 Reverse -95 -108 10.8351 0.0529
NP_440299.1_1 Forward -112 -99 4.44361 0.207
NP_441799.1_1 Forward -112 -98 16.1252 0.0153
NP_441799.1_1 Reverse -95 -109 11.012 0.0629
NP_441799.1_9 Forward -109 -90 9.0459 0.108
NP_441007.1_10 Reverse -94 -107 1.69091 0.203
NP_441007.1_10 Forward -113 -100 0.412608 0.23
NP_442334.1_1 Reverse -87 -106 -8.06369 0.296
NP_442201.1_10 Reverse -88 -107 -13.0786 0.27
NP_440256.1_1 Forward -111 -92 7.47261 0.0257
NP_440256.1_1 Forward -374 -355 -9.14533 0.275
NP_441559.1_8 Reverse -244 -258 -5.80194 0.27
NP_442866.1_6 Forward -272 -253 9.43923 0.228
NP_441464.1_8 Reverse -99 -113 4.91614 0.26
NP_440787.1_5 Forward -116 -102 10.521 0.256
NP_439985.1_2 Forward -161 -142 10.1275 0.193
NP_441417.1_5 Forward -132 -113 8.75091 0.297
NP_442993.1_1 Forward -108 -92 -9.28291 0.181
NP_442386.1_9 Reverse -98 -107 15.7322 0.0144
NP_442386.1_9 Forward -109 -100 13.8639 0.0289
NP_441340.1_5 Forward -107 -100 15.6737 0.0124
NP_441340.1_5 Reverse -100 -107 15.6737 0.0124
NP_440194.1_3 Forward -118 -99 1.76941 0.271
NP_441134.1_6 Forward -160 -142 6.50823 0.28
NP_440586.1_8 Forward -107 -100 13.2151 0.026
NP_440586.1_8 Reverse -100 -107 13.2151 0.026
NP_440586.1_8 Forward -290 -283 8.88855 0.205
NP_442874.1_10 Reverse -232 -251 12.4875 0.299
NP_442251.1_6 Forward -107 -100 15.2804 0.0124
NP_442251.1_6 Reverse -100 -107 15.2804 0.0124
NP_440192.1_5 Forward -109 -90 11.9958 0.126
NP_440684.1_9 Forward -114 -100 12.1926 0.168
NP_441262.1_3 Reverse -99 -106 14.7888 0.0223
NP_441262.1_3 Forward -108 -101 14.7888 0.0223
NP_443051.1_1 Reverse -98 -107 10.4228 0.00754
NP_443051.1_1 Forward -109 -100 10.4228 0.00754
NP_442294.1_3 Forward -93 -79 12.6836 0.279
NP_441740.2_6 Forward -222 -203 14.4541 0.139
NP_440439.1_1 Reverse -96 -109 1.10092 0.162
NP_440372.1_2 Forward -107 -100 16.3621 0.0124
NP_440372.1_2 Reverse -100 -107 16.3621 0.0124
NP_440316.1_10 Reverse -72 -82 6.17489 0.265
NP_440316.1_10 Forward -213 -203 5.97822 0.275
NP_440139.1_1 Reverse -93 -112 1.96529 0.242
NP_442384.1_10 Forward -108 -95 14.1789 0.0163
NP_442384.1_10 Reverse -99 -112 1.10092 0.268
NP_441877.1_9 Reverse -20 -37 5.64371 0.284
NP_442235.1_3 Forward -112 -93 3.34271 0.254
NP_442262.1_10 Forward -107 -100 14.1988 0.0123
NP_442262.1_10 Reverse -100 -107 14.1988 0.0123
NP_441689.1_5 Reverse -97 -107 8.53436 0.132
NP_441689.1_5 Forward -110 -100 5.78111 0.197
NP_440163.1_10 Reverse -96 -106 14.238 0.102
NP_440344.1_10 Reverse -92 -109 -7.33598 0.116
NP_440344.1_10 Forward -115 -98 -10.6792 0.187
NP_440531.1_6 Reverse -91 -110 6.09597 0.112
NP_440531.1_6 Reverse -65 -84 -2.75381 0.258
NP_441965.1_10 Reverse -96 -112 5.27008 0.213
NP_440297.1_9 Forward -107 -97 9.32148 0.0917
NP_440297.1_9 Reverse -100 -110 -0.118297 0.282
NP_442280.1_1 Forward -108 -89 5.80098 0.204
NP_443036.1_10 Forward -164 -145 8.65258 0.241
NP_442067.1_4 Reverse -88 -107 4.03102 0.265
NP_440999.1_9 Reverse -95 -109 2.2612 0.152
NP_440888.1_2 Forward -108 -94 16.6169 0.00609
NP_440888.1_2 Reverse -99 -113 7.66879 0.186
NP_440888.1_2 Reverse -197 -211 6.68548 0.223
NP_440491.1_1 Forward -111 -92 10.2306 0.194
NP_440491.1_1 Forward -279 -260 9.64582 0.206
NP_441543.1_2 Forward -107 -98 18.486 0.00236
NP_441543.1_2 Reverse -100 -109 16.9127 0.00359
NP_441918.1_7 Reverse -98 -117 -2.85214 0.297
NP_441469.1_8 Reverse -98 -107 16.126 0.00797
NP_441469.1_8 Reverse -72 -81 7.86621 0.227
NP_441469.1_8 Forward -109 -100 6.48957 0.227
NP_442315.1_3 Forward -120 -101 8.45592 0.204
NP_442315.1_7 Reverse -7 -26 4.32602 0.284
NP_443064.1_6 Reverse -99 -109 12.5669 0.0796
NP_442578.1_7 Forward -107 -100 14.5921 0.026
NP_442578.1_7 Reverse -100 -107 14.5921 0.026
NP_440710.1_1 Reverse -91 -109 7.09898 0.113
NP_440710.1_1 Reverse -245 -263 -5.97904 0.218
NP_441462.1_2 Forward -108 -98 11.5831 0.00406
NP_441462.1_2 Reverse -99 -109 11.5831 0.00406
NP_443062.1_1 Forward -108 -90 15.4689 0.0378
NP_443062.1_1 Reverse -99 -117 13.1288 0.0663
NP_443062.1_6 Forward -116 -97 10.5209 0.113
NP_441601.1_2 Forward -114 -95 -2.16383 0.259
NP_442204.1_5 Reverse -89 -108 3.53937 0.187
NP_441560.1_8 Forward -87 -68 12.6814 0.248
NP_440516.1_8 Forward -108 -99 16.9127 0.00442
NP_440516.1_8 Reverse -99 -108 16.9127 0.00442
NP_442428.1_5 Forward -107 -100 15.8704 0.0124
NP_442428.1_5 Reverse -100 -107 15.8704 0.0124
NP_440673.1_2 Forward -118 -99 8.43855 0.27
NP_440673.1_3 Forward -106 -99 12.4288 0.0426
NP_440673.1_3 Reverse -101 -108 12.4288 0.0426
NP_440673.1_7 Reverse -88 -107 7.7676 0.139
NP_441052.1_2 Reverse -99 -109 19.9412 0.00106
NP_441052.1_2 Forward -108 -98 10.5014 0.0285
NP_442219.1_8 Forward -118 -99 6.23444 0.3
NP_442219.1_9 Reverse -100 -109 17.7976 0.00718
NP_442219.1_9 Forward -107 -98 8.35786 0.0681
NP_440436.1_4 Forward -107 -98 18.1905 0.00233
NP_440436.1_4 Reverse -100 -109 17.2072 0.00233
NP_441884.1_9 Forward -111 -92 -23.9933 0.284
NP_440314.1_9 Reverse -100 -119 -4.22878 0.203
NP_440648.1_1 Forward -108 -89 15.8307 0.0772
NP_441719.1_4 Forward -107 -100 16.3621 0.0124
NP_441719.1_4 Reverse -100 -107 16.3621 0.0124
NP_441733.1_10 Forward -111 -98 9.85238 0.106
NP_441004.1_1 Forward -211 -192 -11.0136 0.231
NP_442366.1_3 Reverse -98 -116 3.65739 0.106
NP_442366.1_5 Forward -111 -101 14.8275 0.0375
NP_442139.1_7 Forward -260 -241 7.57094 0.287
NP_442873.1_3 Reverse -89 -108 17.5015 0.0822
NP_443054.1_2 Reverse -97 -111 11.3077 0.0761
NP_441851.1_10 Reverse -98 -108 16.008 0.00552
NP_441851.1_10 Forward -109 -99 15.8113 0.00552
NP_441851.1_10 Reverse -268 -278 4.40493 0.271
NP_442856.1_7 Reverse -240 -259 -2.75381 0.237
NP_441668.1_4 Forward -118 -99 2.16274 0.205
NP_442515.1_1 Forward -109 -95 13.3726 0.0278
NP_441982.1_6 Forward -121 -112 12.7718 0.274
NP_441982.1_6 Reverse -78 -87 10.671 0.295
NP_441982.1_10 Forward -27 -8 9.53674 0.143
NP_441349.1_10 Forward -118 -99 -2.0655 0.114
NP_441409.1_6 Reverse -93 -112 -14.8485 0.269
NP_440432.1_9 Reverse -100 -115 6.17475 0.0477
NP_440432.1_9 Forward -107 -92 -1.79006 0.167
NP_440432.1_9 Forward -353 -338 -6.31328 0.296
NP_442843.1_1 Forward -61 -42 -5.9004 0.244
NP_440474.1_8 Forward -107 -93 13.8636 0.0685
NP_440431.1_3 Forward -128 -109 10.5209 0.0495
NP_442450.1_5 Reverse -97 -107 9.32148 0.115
NP_442450.1_5 Forward -110 -100 7.55152 0.13
NP_440195.1_4 Forward -120 -101 5.01433 0.29
NP_442006.1_2 Forward -376 -359 -9.3026 0.197
NP_441570.1_1 Reverse -99 -117 -1.35749 0.0562
NP_441570.1_1 Forward -108 -90 -5.88071 0.0761
NP_440078.1_10 Reverse -99 -118 3.04771 0.269
NP_441078.1_4 Forward -108 -99 19.6659 0.0007
NP_441078.1_4 Reverse -99 -108 19.6659 0.0007
NP_442729.1_8 Reverse -95 -108 18.8988 0.0312
NP_442480.1_3 Reverse -16 -35 15.326 0.23
NP_440526.1_3 Reverse -100 -111 10.2846 0.0646
NP_441432.1_8 Forward -109 -100 16.8143 0.00595
NP_441432.1_8 Reverse -98 -107 8.25953 0.0755
NP_442320.1_8 Reverse -93 -107 4.62115 0.0472
NP_442320.1_8 Forward -114 -100 3.73617 0.0578
NP_442344.1_7 Reverse -100 -119 2.75272 0.0638
NP_442344.1_7 Forward -107 -88 2.26107 0.0638
NP_441732.1_2 Reverse -95 -111 -16.7561 0.195
NP_442003.1_4 Forward -107 -88 13.6675 0.234
NP_442003.1_9 Forward -107 -88 8.45592 0.219
NP_440760.1_1 Forward -108 -89 -18.3884 0.213
NP_440760.1_1 Reverse -99 -118 -22.6167 0.263
NP_440199.1_10 Reverse -321 -331 9.32148 0.203
NP_440199.1_10 Forward -111 -101 7.25653 0.231
NP_441057.1_4 Forward -193 -175 1.88744 0.253
NP_442751.1_2 Reverse -320 -339 2.9486 0.274
NP_440713.1_4 Forward -106 -87 4.52268 0.226
NP_440713.1_4 Reverse -255 -274 4.22769 0.231
NP_442489.1_7 Forward -108 -99 20.1576 0.000695
NP_442489.1_7 Reverse -99 -108 20.1576 0.000695
NP_442079.1_7 Forward -107 -88 2.16274 0.234
NP_440559.1_1 Reverse -100 -109 17.4043 0.00658
NP_440559.1_1 Forward -107 -98 8.75118 0.0586
NP_441659.2_8 Reverse -99 -109 18.1713 0.00133
NP_441659.2_8 Forward -108 -98 11.9764 0.0147
NP_441659.2_8 Forward -82 -72 2.24165 0.207
NP_441022.1_1 Forward -14 -5 11.5462 0.274
NP_442913.1_10 Forward -117 -98 -2.85214 0.192
NP_442913.1_10 Reverse -90 -109 -6.09707 0.291
NP_442346.1_5 Forward -109 -99 16.6963 0.00248
NP_442346.1_5 Reverse -98 -108 9.02648 0.118
NP_442346.1_5 Reverse -72 -82 4.50326 0.286
NP_440545.1_3 Forward -112 -95 -0.354483 0.152
NP_440545.1_3 Forward -295 -278 -6.84433 0.289
NP_441856.1_3 Forward -111 -92 -3.83545 0.3
NP_440459.1_2 Reverse -166 -183 9.67528 0.224
NP_440010.1_10 Forward -267 -248 8.84924 0.213
NP_441943.1_8 Forward -214 -195 -13.1769 0.261
NP_442603.1_7 Forward -108 -94 9.73373 0.142
NP_441833.1_4 Forward -107 -100 15.9687 0.0124
NP_441833.1_4 Reverse -100 -107 15.9687 0.0124
NP_441895.1_2 Forward -376 -357 -17.6018 0.234
NP_441112.1_6 Forward -377 -358 -3.44213 0.296
NP_442162.1_9 Forward -107 -100 16.2637 0.0124
NP_442162.1_9 Reverse -100 -107 16.2637 0.0124
NP_440671.1_4 Forward -114 -100 5.21113 0.289
NP_442943.1_1 Forward -233 -218 12.676 0.126
NP_442140.1_3 Reverse -100 -110 12.2714 0.0632
NP_442140.1_3 Forward -107 -97 8.33817 0.119
NP_440875.1_9 Forward -352 -342 6.81464 0.297
NP_441813.1_5 Reverse -97 -107 17.188 0.00979
NP_441813.1_5 Forward -110 -100 8.63316 0.0367
NP_440590.1_4 Reverse -100 -113 2.2809 0.0939
NP_440590.1_4 Forward -107 -94 1.78924 0.111
NP_440567.1_1 Forward -107 -93 12.8809 0.0215
NP_442497.1_10 Forward -107 -98 10.4228 0.0087
NP_442497.1_10 Reverse -100 -109 10.4228 0.0087
NP_440821.1_4 Reverse -97 -107 19.0562 0.00399
NP_440821.1_4 Forward -110 -100 9.41981 0.0286
NP_441239.1_9 Reverse -97 -109 13.3137 0.037
NP_441239.1_9 Forward -110 -98 5.93884 0.202
NP_440604.1_6 Forward -108 -89 6.19431 0.107
NP_441541.1_1 Forward -39 -21 -5.05909 0.291
NP_440354.1_7 Reverse -93 -111 8.7706 0.232
NP_442138.1_10 Reverse -99 -118 -5.80207 0.274
NP_440546.1_4 Forward -108 -98 11.8882 0.0679
NP_440546.1_4 Reverse -99 -109 10.046 0.109
NP_440546.1_4 Forward -212 -202 6.65249 0.288
NP_440462.1_6 Reverse -97 -107 15.418 0.0142
NP_440462.1_6 Forward -110 -100 1.35667 0.294
NP_442340.1_6 Forward -151 -132 15.9291 0.221
NP_440868.1_4 Reverse -95 -107 10.6587 0.0364
NP_440868.1_4 Forward -112 -100 5.93884 0.0879
NP_442812.1_2 Forward -171 -152 7.47261 0.196
NP_442402.1_1 Reverse -162 -181 10.6192 0.254
NP_442402.1_4 Reverse -103 -122 4.81688 0.144
NP_442358.1_1 Reverse -91 -109 18.6037 0.0915
NP_442039.1_4 Forward -107 -100 15.1821 0.0124
NP_442039.1_4 Reverse -100 -107 15.1821 0.0124
NP_442039.1_7 Forward -210 -200 10.5014 0.257
NP_440008.1_9 Forward -211 -192 6.4893 0.287
NP_440825.1_7 Reverse -100 -110 12.9096 0.152
NP_442837.1_3 Forward -107 -100 15.7721 0.0124
NP_442837.1_3 Reverse -100 -107 15.7721 0.0124
NP_442837.1_3 Reverse -270 -277 6.43063 0.212
NP_442053.1_1 Forward -108 -99 18.3876 0.0007
NP_442053.1_1 Reverse -99 -108 18.3876 0.0007
NP_440505.1_3 Reverse -97 -107 13.8447 0.0247
NP_440505.1_3 Forward -110 -100 9.22315 0.122
NP_442360.1_5 Forward -211 -201 15.0247 0.172
NP_441959.1_10 Forward -109 -91 13.1635 0.186
NP_440914.1_1 Reverse -99 -109 17.5935 0.000537
NP_440914.1_1 Forward -108 -98 8.6151 0.186
NP_441011.1_8 Forward -107 -98 16.9127 0.00602
NP_441011.1_8 Reverse -100 -109 8.25953 0.144
NP_442101.1_10 Reverse -91 -110 -7.86702 0.222
NP_440303.1_10 Reverse -193 -211 16.0463 0.273
NP_442533.1_1 Forward -294 -275 -17.8968 0.297
NP_442533.1_6 Forward -108 -99 17.2076 0.00137
NP_442533.1_6 Reverse -99 -108 17.2076 0.00137
NP_442533.1_6 Reverse -73 -82 2.94966 0.232
NP_441482.1_7 Forward -114 -100 -10.5218 0.209
NP_441482.1_7 Reverse -93 -107 -11.1118 0.237
NP_439944.1_9 Reverse -100 -110 10.5014 0.0887
NP_439944.1_9 Forward -107 -97 10.3048 0.0887
NP_441697.1_5 Reverse -16 -35 -1.19407 0.204
NP_440816.1_2 Reverse -11 -30 10.8883 0.202
NP_440116.1_8 Reverse -100 -119 -8.16202 0.247
NP_439965.1_1 Forward -267 -248 1.76941 0.122
NP_442492.1_2 Reverse -99 -118 6.78429 0.173
NP_441972.1_5 Forward -218 -199 -8.65367 0.27
NP_441106.1_1 Reverse -98 -107 18.191 0.0028
NP_441106.1_1 Forward -109 -100 9.63616 0.0311
NP_441286.1_1 Forward -109 -97 14.4936 0.00418
NP_441286.1_1 Reverse -98 -110 3.38223 0.0467
NP_442674.1_3 Reverse -247 -266 3.73524 0.294
NP_440670.1_8 Forward -108 -99 18.3876 0.000699
NP_440670.1_8 Reverse -99 -108 18.3876 0.000699
NP_440886.1_7 Reverse -98 -108 17.7774 0.0011
NP_440886.1_7 Forward -109 -99 7.94438 0.0805
NP_439995.1_5 Reverse -89 -108 21.8289 0.0262
NP_442072.1_9 Reverse -98 -116 -12.7639 0.091
NP_442072.1_9 Forward -109 -91 -21.5153 0.209
NP_441753.1_10 Reverse -90 -109 4.22769 0.2
NP_440907.2_8 Forward -107 -97 7.84605 0.117
NP_440907.2_8 Reverse -100 -110 7.64939 0.117
NP_441021.1_8 Forward -113 -95 6.41066 0.206
NP_441463.1_3 Reverse -89 -108 0.294447 0.132
NP_441463.1_3 Forward -118 -99 -0.295539 0.132
NP_441626.1_2 Forward -107 -100 15.7721 0.0124
NP_441626.1_2 Reverse -100 -107 15.7721 0.0124
NP_442794.1_1 Forward -112 -100 2.69391 0.286
NP_442615.1_1 Forward -117 -99 5.91901 0.0371
NP_440387.1_1 Forward -108 -92 13.7265 0.00818
NP_440387.1_1 Reverse -99 -115 4.58176 0.0407
NP_441836.1_10 Reverse -298 -317 6.98095 0.257
NP_440814.1_4 Forward -117 -98 -12.6852 0.244
NP_440467.1_8 Reverse -177 -196 10.2259 0.288
NP_440114.1_10 Forward -108 -94 11.701 0.106
NP_440114.1_10 Reverse -99 -113 9.5377 0.169
NP_442324.1_1 Reverse -55 -74 13.9625 0.251
NP_441237.1_9 Reverse -100 -110 14.828 0.0242
NP_441067.1_2 Reverse -72 -86 21.0424 0.103
NP_441133.1_1 Forward -270 -251 13.5691 0.243
NP_439910.1_2 Forward -116 -99 -4.18939 0.0692
NP_439910.1_2 Reverse -91 -108 -21.4956 0.183
NP_442867.1_8 Reverse -359 -378 7.7676 0.242
NP_440457.1_1 Reverse -95 -107 -0.0593532 0.25
NP_440142.1_7 Forward -61 -42 5.89931 0.278
NP_441436.1_8 Forward -109 -90 11.3075 0.261
NP_442509.1_9 Forward -108 -98 16.2041 0.00739
NP_442509.1_9 Reverse -99 -109 8.14104 0.192
NP_441253.1_8 Forward -113 -99 15.113 0.122
NP_440524.1_2 Forward -80 -61 5.40766 0.198
NP_442514.1_5 Forward -383 -364 -7.86776 0.28
NP_440554.1_4 Forward -107 -97 14.6313 0.02
NP_440554.1_4 Forward -353 -343 3.51995 0.227
NP_442862.1_3 Forward -296 -279 8.98696 0.236
NP_441885.1_5 Reverse -99 -109 20.9245 0.000538
NP_441885.1_5 Forward -108 -98 11.4848 0.00668
NP_442341.1_7 Forward -109 -95 15.3392 0.0229
NP_442341.1_7 Reverse -98 -112 8.35772 0.0881
NP_442341.1_9 Reverse -97 -111 14.4536 0.068
NP_443000.1_7 Forward -110 -100 10.3048 0.0345
NP_443000.1_7 Reverse -97 -107 8.73149 0.0437
NP_441842.1_10 Reverse -92 -106 6.58777 0.283
NP_441842.1_10 Reverse -367 -381 6.09611 0.299
NP_440275.1_3 Reverse -97 -107 8.4365 0.0602
NP_440275.1_3 Forward -110 -100 8.04317 0.0602
NP_440091.1_1 Forward -112 -100 8.88877 0.0567
NP_440091.1_1 Reverse -95 -107 1.41561 0.197
NP_442451.1_2 Reverse -74 -93 -7.67036 0.237
NP_439962.1_4 Reverse -269 -288 -9.047 0.298
NP_440175.1_6 Reverse -58 -77 9.0459 0.286
NP_440149.1_8 Forward -108 -89 1.37609 0.126
NP_440216.1_1 Forward -108 -94 7.27608 0.00942
NP_440216.1_1 Reverse -99 -113 -1.77037 0.0383
NP_440172.1_1 Reverse -99 -109 15.0247 0.00945
NP_440172.1_1 Forward -108 -98 8.73149 0.0586
NP_440172.1_1 Reverse -73 -83 1.84832 0.294
NP_442371.1_1 Forward -119 -109 13.2542 0.206
NP_442015.1_10 Forward -112 -99 1.59258 0.204
NP_442015.1_10 Reverse -95 -108 0.707601 0.221
NP_441226.1_7 Forward -107 -100 14.4934 0.0123
NP_441226.1_7 Reverse -100 -107 14.4934 0.0123
NP_441226.1_7 Forward -353 -346 8.29857 0.205
NP_441111.1_7 Forward -107 -99 18.7023 0.00294
NP_441111.1_7 Reverse -100 -108 18.7023 0.00294
NP_441766.1_2 Forward -108 -99 17.5026 0.00297
NP_441766.1_2 Reverse -99 -108 17.5026 0.00297
NP_441766.1_9 Reverse -360 -379 1.27776 0.246
NP_442417.1_5 Forward -108 -94 10.816 0.11
NP_443052.1_8 Forward -118 -99 1.57275 0.0601
NP_443052.1_8 Reverse -89 -108 0.392778 0.0664
NP_443052.1_9 Forward -194 -175 -2.45882 0.238
NP_442403.1_9 Forward -339 -320 6.39097 0.193
NP_440261.1_5 Forward -107 -94 -0.964025 0.0655
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TCACAGCCGATTTAAATATCAATTTCCCAAGCGAGAAGTGGATTTATCCCATCCCATGTTTGGCATTGATCATAACCGTTGTATTCTCTGTACCCGTTGTGTGCGAGTTTGCGATGAAATTGAGGGAGCCCACGTTTGGGATGTGGCTTACCGGGGCGCAGAATGCAAAATTGTTTCTGGTTTAAATCAGCCCTGGGGAACCGTTGATGCCTGTACTTCCTGTGGCAAATGTGTGGATGCCTGTCCCACGGGTTCTATCTTCCATAAAGGAGAAACTACTGCTGAAAAAATTGGCGATCGCCGTAAGGTGGAGTTTTTAGCCACTGCCCGTAAAGAAAAGGAATGGGTCAGGTAGGTTGAACTTTTAAGAACTTTTAACATCATTTCTAAACTTTTAATC

CDS

ATGGCTAAAATTCGTTTTGCTACCGTTTGGCTCGCTGGTTGTTCCGGCTGTCATATGTCCTTCCTTGATATGGACGAATGGCTCATTGATCTCGCTCAAAAAGTTGATGTGGTTTTCAGTCCCGTTGGTTCTGATCTCAAGGAATACCCGGACAATGTGGATGTTTGCCTAGTGGAAGGGGCGATCGCCAACGAAGAAAATTTAGAGTTAGCTTTGGAGTTGAGACAGAAAACGAAGGTAGTAATTTCCTTTGGGGACTGTGCTGTAACCGCCAATGTCCCCGGTATGCGTAATATGCTCAAAGGTAGCGATCCGGTTCTGCGCCGAGCCTATATTGAACTGGGAGATGGGACGCCTCAACTGCCCGATGAACCTGGTATTGTGCCGCCTCTATTAGACAAGGTTATTCCCCTACATGAGGTTATTCCGGTGGATATTTTTATGCCCGGTTGTCCTCCCGATGCCCACCGTATTCGAGCAACGCTAGAACCATTATTAAATGGGGAACATCCCCTCATGGAAGGGCGAGCAATGATCAAATTTGGTTAA

Protein

MAKIRFATVWLAGCSGCHMSFLDMDEWLIDLAQKVDVVFSPVGSDLKEYPDNVDVCLVEGAIANEENLELALELRQKTKVVISFGDCAVTANVPGMRNMLKGSDPVLRRAYIELGDGTPQLPDEPGIVPPLLDKVIPLHEVIPVDIFMPGCPPDAHRIRATLEPLLNGEHPLMEGRAMIKFG