Your browser is old and dusty. Try Google Chrome!

Details for sll1217

ORF sll1217
Accession NP_441423.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440557.1_1 Forward -290 -271 5.40766 0.162
NP_440795.1_7 Forward -374 -367 8.39725 0.213
NP_442100.1_4 Reverse -340 -359 11.995 0.272
NP_441418.1_6 Forward -370 -351 -23.2067 0.192
NP_440815.1_2 Reverse -64 -78 10.8154 0.265
NP_442291.1_5 Reverse -49 -65 -4.75968 0.283
NP_440897.1_6 Reverse -59 -78 -0.39464 0.182
NP_441453.1_7 Forward -74 -67 12.9205 0.23
NP_442151.1_6 Reverse -366 -380 9.63603 0.142
NP_441818.1_9 Forward -358 -339 7.7676 0.116
NP_441818.1_9 Forward -357 -338 -3.83545 0.232
NP_441818.1_9 Forward -364 -345 -9.63698 0.291
NP_440226.1_1 Forward -284 -265 6.88262 0.118
NP_442287.1_3 Reverse -267 -284 17.6393 0.131
NP_441721.1_6 Reverse -321 -340 8.16093 0.281
NP_442752.1_4 Forward -68 -61 5.25066 0.256
NP_443027.1_4 Reverse -139 -149 5.87989 0.294
NP_442975.1_10 Forward -23 -9 1.47397 0.297
NP_441675.1_4 Reverse -29 -48 4.71934 0.254
NP_442000.2_6 Forward -395 -376 13.9625 0.279
NP_441054.1_6 Reverse -291 -310 11.1109 0.298
NP_440304.1_4 Reverse -359 -369 5.48657 0.206
NP_440044.1_8 Forward -283 -264 -2.65548 0.265
NP_439918.1_2 Forward -357 -338 15.4374 0.0732
NP_439918.1_2 Forward -363 -344 5.80098 0.154
NP_439918.1_2 Forward -339 -320 -1.37718 0.24
NP_439918.1_2 Forward -356 -337 -3.63879 0.258
NP_441208.1_9 Forward -237 -223 5.50613 0.267
NP_441594.1_5 Reverse -262 -281 23.598 0.0301
NP_441082.1_10 Forward -275 -262 18.8988 0.125
NP_441082.1_10 Forward -362 -349 8.77074 0.262
NP_441925.1_4 Reverse -338 -357 -17.5041 0.296
NP_440273.1_3 Forward -270 -251 4.81767 0.279
NP_441083.1_5 Forward -303 -293 0.865012 0.218
NP_441645.1_8 Forward -71 -52 14.3558 0.237
NP_440447.1_6 Forward -34 -16 0.314141 0.293
NP_441770.1_4 Reverse -142 -161 -11.5053 0.29
NP_441770.1_7 Reverse -49 -68 13.0766 0.295
NP_442570.1_3 Forward -360 -341 13.2741 0.078
NP_442570.1_3 Forward -378 -359 -8.55534 0.288
NP_441327.1_5 Reverse -70 -79 15.0444 0.191
NP_441598.1_3 Reverse -349 -368 14.4242 0.161
NP_440438.2_8 Forward -121 -102 4.32602 0.227
NP_441486.1_1 Forward -194 -180 -6.19526 0.283
NP_441194.1_1 Reverse -101 -120 13.2252 0.238
NP_442634.1_4 Forward -377 -363 -5.31028 0.246
NP_442634.1_4 Reverse -364 -378 -5.80194 0.279
NP_441014.1_5 Forward -74 -56 10.2456 0.263
NP_441014.1_10 Reverse -125 -144 6.29183 0.172
NP_441014.1_10 Forward -45 -26 -1.47628 0.262
NP_442848.1_5 Reverse -294 -312 1.00246 0.276
NP_441012.1_4 Forward -399 -386 7.78743 0.272
NP_441012.1_4 Reverse -56 -69 7.49244 0.272
NP_441012.1_4 Reverse -357 -370 6.60746 0.278
NP_443018.1_3 Forward -62 -55 10.2655 0.107
NP_441316.1_7 Forward -70 -55 -3.85501 0.296
NP_441634.1_8 Reverse -312 -326 -1.47537 0.291
NP_441077.1_6 Reverse -98 -114 9.55035 0.171
NP_441846.1_10 Forward -351 -332 -19.5684 0.256
NP_441846.1_10 Forward -357 -338 -21.83 0.256
NP_441846.1_10 Forward -358 -339 -23.01 0.275
NP_440642.1_10 Forward -77 -63 5.01387 0.243
NP_442782.1_2 Forward -375 -361 0.491246 0.289
NP_442496.1_5 Forward -346 -328 12.4089 0.204
NP_442836.1_5 Forward -316 -297 0.982764 0.289
NP_440203.1_5 Forward -367 -357 8.43603 0.299
NP_441097.1_2 Forward -361 -344 5.05372 0.272
NP_440153.1_5 Reverse -124 -138 0.88457 0.288
NP_440993.1_3 Forward -301 -282 3.34192 0.183
NP_440934.1_9 Forward -74 -55 15.1424 0.3
NP_442995.1_5 Reverse -45 -64 11.6025 0.211
NP_442002.1_1 Forward -336 -318 -6.86402 0.249
NP_441294.1_7 Reverse -377 -391 8.48272 0.298
NP_441424.1_2 Reverse -104 -123 17.9043 0.0578
NP_441424.1_7 Reverse -53 -72 26.1555 0.00421
NP_441916.1_7 Reverse -54 -64 3.81494 0.202
NP_440465.1_10 Forward -174 -155 1.67108 0.275
NP_441725.1_5 Forward -369 -359 -0.511621 0.26
NP_439966.1_7 Reverse -317 -327 4.10949 0.289
NP_442281.1_1 Reverse -356 -370 11.5037 0.0462
NP_001035871.2_7 Reverse -357 -367 12.0747 0.272
NP_441087.1_6 Reverse -323 -341 0.706727 0.258
NP_441644.1_6 Reverse -54 -64 4.30615 0.242
NP_441644.1_6 Reverse -361 -371 3.51951 0.277
NP_442215.1_2 Forward -372 -356 3.20513 0.1
NP_441751.2_8 Reverse -55 -69 2.5562 0.0804
NP_442926.1_3 Reverse -350 -369 8.16093 0.173
NP_442554.1_8 Forward -369 -359 10.0098 0.0509
NP_442554.1_8 Reverse -55 -65 7.15819 0.0975
NP_442554.1_8 Forward -400 -390 5.38824 0.15
NP_442554.1_8 Forward -149 -139 1.74999 0.298
NP_442313.1_4 Forward -357 -338 7.66927 0.286
NP_442142.1_4 Reverse -352 -365 5.0336 0.204
NP_441371.1_3 Reverse -142 -160 7.98396 0.277
NP_441371.1_3 Reverse -247 -265 4.34571 0.295
NP_442076.1_5 Forward -204 -185 9.14423 0.21
NP_441198.1_4 Reverse -282 -301 9.3409 0.276
NP_441618.1_5 Forward -310 -291 15.2408 0.063
NP_441020.2_7 Reverse -349 -368 14.4533 0.146
NP_441015.1_10 Forward -369 -350 -10.7186 0.287
NP_442253.1_7 Forward -235 -221 12.9793 0.298
NP_441826.1_2 Reverse -355 -369 -4.81863 0.3
NP_442490.1_9 Forward -356 -337 -8.752 0.293
NP_441251.1_8 Reverse -218 -231 16.8684 0.254
NP_440558.1_2 Reverse -51 -70 -7.37537 0.293
NP_441878.1_6 Reverse -360 -370 0.668351 0.139
NP_441878.1_6 Reverse -53 -63 0.668351 0.139
NP_441878.1_6 Forward -69 -59 -7.78811 0.266
NP_441590.1_4 Reverse -337 -356 7.86512 0.249
NP_440101.1_3 Forward -296 -277 8.65258 0.155
NP_440101.1_10 Forward -69 -50 12.7825 0.135
NP_440058.1_6 Reverse -57 -76 5.99764 0.286
NP_440861.1_2 Reverse -26 -45 13.7728 0.187
NP_442347.1_2 Reverse -333 -342 6.39124 0.17
NP_442888.1_6 Forward -202 -183 2.55606 0.252
NP_442594.1_8 Forward -359 -340 13.8641 0.146
NP_440151.1_5 Forward -363 -344 5.11266 0.262
NP_442764.1_3 Forward -69 -59 16.008 0.295
NP_441728.2_4 Reverse -101 -120 18.5728 0.0812
NP_440899.1_8 Forward -55 -36 -9.83364 0.269
NP_440087.1_1 Reverse -50 -69 -1.96717 0.197
NP_441559.1_8 Reverse -131 -145 -7.17857 0.287
NP_440915.1_6 Forward -362 -348 -3.34366 0.293
NP_442158.1_4 Forward -78 -68 15.9097 0.129
NP_442158.1_4 Reverse -153 -163 11.9764 0.26
NP_441179.1_9 Forward -152 -142 9.81266 0.28
NP_442069.1_7 Reverse -336 -355 15.3382 0.201
NP_440749.1_1 Forward -370 -351 10.6192 0.107
NP_442866.1_1 Forward -375 -356 -8.85033 0.285
NP_441464.1_8 Reverse -162 -176 5.70279 0.253
NP_441464.1_10 Forward -279 -265 7.76774 0.292
NP_440702.1_2 Reverse -145 -164 -1.18052 0.257
NP_440787.1_5 Reverse -42 -56 18.4858 0.0934
NP_440677.1_2 Forward -311 -292 15.4374 0.18
NP_441340.1_9 Reverse -70 -80 8.25522 0.256
NP_441340.1_9 Reverse -38 -48 8.15881 0.256
NP_440327.1_6 Forward -357 -338 2.75272 0.29
NP_440327.1_8 Forward -375 -356 17.8957 0.151
NP_440327.1_8 Forward -364 -345 15.0441 0.264
NP_440586.1_8 Forward -62 -55 9.08521 0.178
NP_440586.1_8 Reverse -393 -400 5.8403 0.283
NP_440586.1_8 Reverse -142 -149 5.8403 0.283
NP_441912.1_2 Forward -369 -350 16.3704 0.232
NP_440027.1_3 Reverse -338 -356 1.88669 0.295
NP_439943.1_1 Forward -290 -271 -9.93197 0.29
NP_442783.1_3 Forward -44 -25 15.1424 0.214
NP_441789.1_7 Reverse -340 -359 4.22689 0.193
NP_440316.1_10 Forward -365 -355 9.32148 0.235
NP_439977.1_5 Forward -376 -357 0.491109 0.208
NP_441572.1_7 Forward -381 -362 -4.6221 0.24
NP_441572.1_7 Reverse -355 -374 -4.81876 0.244
NP_442339.1_9 Reverse -96 -115 12.6841 0.162
NP_440364.1_2 Forward -375 -356 14.3239 0.278
NP_442262.1_6 Forward -320 -302 20.5703 0.0423
NP_442262.1_10 Forward -62 -55 9.18389 0.211
NP_440282.1_3 Reverse -350 -369 -2.65548 0.298
NP_441060.1_3 Forward -72 -53 8.35759 0.242
NP_440297.1_9 Forward -369 -359 9.32148 0.0917
NP_440297.1_9 Forward -62 -52 0.766681 0.282
NP_440297.1_9 Forward -149 -139 -0.216628 0.282
NP_440297.1_9 Reverse -142 -152 -0.216628 0.282
NP_440052.1_5 Forward -79 -60 -5.80207 0.298
NP_441543.1_3 Reverse -340 -354 5.50552 0.293
NP_442845.1_2 Forward -370 -356 10.521 0.148
NP_442845.1_2 Forward -69 -55 6.88276 0.201
NP_441551.1_5 Reverse -50 -66 10.4809 0.193
NP_440220.1_4 Reverse -187 -206 -2.8529 0.282
NP_443062.1_1 Reverse -54 -72 7.96088 0.163
NP_443062.1_1 Forward -68 -50 4.93815 0.244
NP_442204.1_1 Reverse -388 -399 2.51695 0.266
NP_441884.1_8 Forward -358 -339 -8.752 0.262
NP_441719.1_2 Forward -45 -31 14.5017 0.278
NP_441004.1_1 Forward -356 -337 -1.47551 0.133
NP_442206.1_10 Forward -68 -53 8.92802 0.167
NP_441851.1_10 Forward -69 -59 4.69992 0.254
NP_441668.1_4 Reverse -40 -59 -2.36049 0.288
NP_441982.1_6 Reverse -22 -31 12.6763 0.274
NP_442314.1_5 Forward -336 -317 9.43923 0.288
NP_440432.1_9 Forward -283 -268 -5.32998 0.245
NP_440474.1_8 Forward -309 -295 5.40719 0.25
NP_440431.1_3 Reverse -16 -35 -1.96717 0.164
NP_440793.1_1 Forward -237 -223 9.6354 0.293
NP_441432.1_8 Forward -376 -367 9.73449 0.0754
NP_441432.1_9 Forward -55 -42 9.37402 0.28
NP_442003.1_9 Forward -358 -339 6.68596 0.235
NP_442797.1_6 Forward -130 -111 8.90373 0.254
NP_440713.1_4 Forward -368 -349 3.04771 0.251
NP_442008.1_2 Reverse -291 -310 7.47261 0.209
NP_441800.1_3 Forward -275 -257 7.88563 0.286
NP_442346.1_5 Forward -376 -366 7.15819 0.178
NP_442346.1_5 Reverse -360 -370 5.09324 0.262
NP_442346.1_5 Forward -64 -54 4.69992 0.276
NP_440545.1_3 Forward -374 -357 6.03703 0.0578
NP_440545.1_3 Forward -67 -50 1.12048 0.125
NP_440545.1_3 Forward -379 -362 -0.256152 0.151
NP_440545.1_3 Reverse -50 -67 -6.451 0.28
NP_440545.1_5 Forward -356 -339 6.33202 0.219
NP_441653.1_2 Forward -369 -350 6.71853 0.225
NP_440449.1_6 Forward -76 -58 7.96405 0.206
NP_441329.1_6 Reverse -26 -45 4.15348 0.206
NP_440890.1_7 Reverse -289 -308 19.469 0.282
NP_442943.1_1 Reverse -110 -125 4.73258 0.221
NP_440875.1_9 Reverse -56 -66 13.6282 0.0646
NP_440875.1_9 Forward -399 -389 12.6548 0.106
NP_440875.1_9 Forward -66 -56 9.73475 0.233
NP_440875.1_9 Forward -282 -272 8.95605 0.233
NP_442547.1_7 Reverse -56 -75 13.8238 0.177
NP_441239.1_9 Reverse -57 -69 12.3303 0.0477
NP_441239.1_9 Forward -372 -360 10.6587 0.0742
NP_441239.1_9 Forward -65 -53 4.66053 0.248
NP_441239.1_9 Forward -398 -386 4.16888 0.26
NP_440400.1_1 Reverse -340 -359 -2.8529 0.288
NP_441892.1_1 Reverse -266 -283 -0.452814 0.185
NP_441892.1_1 Forward -72 -55 -3.30441 0.237
NP_442669.1_1 Reverse -106 -125 2.0644 0.201
NP_441698.1_2 Forward -31 -12 16.0962 0.232
NP_440833.1_6 Reverse -72 -86 9.53707 0.261
NP_440949.1_10 Reverse -345 -364 18.4848 0.15
NP_440546.1_4 Forward -364 -354 9.3673 0.142
NP_440546.1_6 Reverse -19 -38 7.66927 0.268
NP_440462.1_4 Forward -277 -263 7.17775 0.278
NP_442465.1_1 Forward -233 -214 0.884433 0.245
NP_442340.1_3 Reverse -134 -153 -3.24547 0.205
NP_441249.1_8 Forward -357 -338 5.30933 0.247
NP_441249.1_8 Forward -333 -314 1.27776 0.284
NP_441084.1_6 Reverse -273 -287 11.0893 0.218
NP_440008.1_9 Forward -364 -345 5.99764 0.296
NP_440825.1_3 Reverse -130 -149 5.01433 0.169
NP_440160.1_2 Reverse -54 -73 0.982764 0.217
NP_440505.1_3 Forward -266 -256 5.19158 0.241
NP_442456.1_2 Forward -205 -186 16.3215 0.197
NP_440520.1_1 Forward -359 -340 -2.45882 0.208
NP_440914.1_1 Reverse -349 -359 7.44401 0.237
NP_442533.1_1 Forward -356 -337 -9.73531 0.229
NP_442533.1_1 Forward -344 -325 -17.6018 0.291
NP_442533.1_6 Forward -63 -54 4.71961 0.177
NP_442533.1_6 Forward -68 -59 3.53964 0.21
NP_442533.1_6 Reverse -261 -270 1.37636 0.3
NP_442322.1_4 Reverse -341 -358 -1.43681 0.226
NP_442322.1_4 Reverse -347 -364 -4.09173 0.253
NP_442322.1_4 Reverse -346 -363 -6.35334 0.275
NP_442269.1_10 Forward -363 -344 1.37609 0.295
NP_441697.1_5 Forward -116 -97 -6.63711 0.232
NP_441028.1_6 Forward -230 -220 7.35439 0.229
NP_442202.1_6 Reverse -18 -37 3.04771 0.265
NP_441527.1_4 Reverse -30 -49 7.01823 0.0961
NP_441527.1_4 Reverse -27 -46 -0.143661 0.145
NP_440007.1_9 Reverse -357 -371 5.30946 0.26
NP_441479.1_1 Reverse -279 -298 15.0441 0.125
NP_440404.1_9 Reverse -39 -58 10.9334 0.209
NP_442401.1_2 Reverse -326 -345 9.93006 0.195
NP_441463.1_3 Reverse -172 -191 -9.93197 0.287
NP_442842.1_4 Forward -369 -350 5.50599 0.238
NP_440855.1_2 Reverse -259 -278 12.3883 0.299
NP_441193.1_1 Reverse -335 -354 11.7 0.229
NP_441993.1_1 Forward -370 -351 1.4594 0.276
NP_442805.1_5 Reverse -339 -358 -3.14789 0.262
NP_440287.1_6 Reverse -273 -292 1.0811 0.283
NP_440293.1_3 Forward -358 -339 -1.96717 0.239
NP_440293.1_3 Forward -277 -258 -2.65548 0.241
NP_442743.1_1 Reverse -338 -357 15.1416 0.209
NP_442743.1_4 Reverse -283 -302 -4.32711 0.249
NP_441801.1_4 Reverse -242 -252 2.7333 0.262
NP_442680.1_5 Reverse -220 -239 0.756062 0.258
NP_440054.1_4 Reverse -267 -286 13.6675 0.148
NP_440054.1_4 Reverse -174 -193 10.4225 0.261
NP_441489.1_3 Reverse -21 -35 13.667 0.198
NP_441489.1_3 Forward -209 -195 8.12843 0.244
NP_442514.1_5 Reverse -58 -77 -5.90115 0.263
NP_440478.1_9 Reverse -21 -40 7.7676 0.28
NP_442703.1_9 Reverse -28 -46 4.34571 0.259
NP_442341.1_7 Reverse -125 -139 4.52282 0.188
NP_442341.1_9 Reverse -57 -71 7.47213 0.198
NP_441173.1_9 Forward -30 -22 13.2937 0.17
NP_440175.1_7 Forward -362 -344 10.6318 0.25
NP_441105.1_3 Forward -369 -350 -8.752 0.278
NP_440216.1_9 Reverse -68 -77 15.536 0.128
NP_442329.1_9 Reverse -254 -273 17.2065 0.272
NP_442252.1_4 Forward -369 -350 12.8808 0.278
NP_442154.1_1 Forward -358 -340 -18.3687 0.281
NP_442154.1_1 Forward -278 -260 -18.9587 0.288
NP_440261.1_5 Forward -369 -356 -12.4687 0.297
NP_440261.1_7 Forward -226 -207 -3.24547 0.19
NP_440988.1_10 Reverse -336 -350 6.44783 0.232
NP_440988.1_10 Reverse -58 -72 3.9307 0.276
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACCATGGCCTGGCTTTCATGCACGAGGCTATGACATGGCCCTGGGGTTTGGGTTAGGGTGGGGACCAGGTTACGGGCTTGGAGCGTCATGTGCAGTTGCAGTTCCGCCACGTAATCACTGATGGCTTCTTGGGGCTGGGAAACGTCTACCTGGGTAGCTGACACTGTCCTTTTTCCTCCTTGAGCAATACTGTTGACTGAAAAATAATCGGCAAGTGCTGAATTGAGGGACTTGTGGCCCCTATAAAAACTACCATGGCATTAACGGAGACGCACACTTCTGCAACAGTCTTTAACATTTATCTGTCTGTGACCCTAGGATATTTTTCCTTGGGCGAGGCCATGGATCTCCTAGTTTTTCCTACCGATTTTTTTGCCAATCAGTTATCTCAGTTTCTTCC

CDS

ATGTCAGAGCTTCAAACCCTGATCCGCACTATTCGCCAAGAAGCAGAACGGGAACCATTTCCCCTAGACTCTCCCATTTATGAGCAGGCCGGCAAAGATGCCCTAGATCCAATTTTATTTGGGGGTAACCTCGGTAGTCAGCTCTGTTTTTTTGGCAGGGATTTAGGGGCGGATGAGGTGCGCCAAGGACAACCCTTAATCGGAGCGGCAGGGCGGCTAGTGAGGAAGGGGTTTTTTGAAGCTTGGCAGGGTCGGGTTCCCAGGGGACAAGATGATTTACAAACGGTCTGTCAAAGGATTTTGCTTACTAATACGGTGCCCTATAAACCCCCGGAAAATAAGGCTTATTCTGTCAAAGTTAAGGAAAGGTTTCGCCCTTTTGTGGAGCAATTGTTAGTGTTCCATTGGCAAGGGAAACAAATTATCACCCTGGGAACGGAAGCTTTTAAATGGTTTGCTCCCTATGCCCCCAAGGGCCAGTTGGATGAATTCTTCCAAGGGGGGGATAGGTACGAATGCTCATTAGATGTTTTGATCAAAGCGAAAACGGCGGCAGGCAAAGGTAGTCAAAAAATTGTTAGATTAATGCCTTTACCTCACCCTTCACCGTTGAATAAGCGTTACTACGGACAGTTTCCGACAATGTTGCAACGGCGCTTAACGGAAATTGCTTTCTAG

Protein

MSELQTLIRTIRQEAEREPFPLDSPIYEQAGKDALDPILFGGNLGSQLCFFGRDLGADEVRQGQPLIGAAGRLVRKGFFEAWQGRVPRGQDDLQTVCQRILLTNTVPYKPPENKAYSVKVKERFRPFVEQLLVFHWQGKQIITLGTEAFKWFAPYAPKGQLDEFFQGGDRYECSLDVLIKAKTAAGKGSQKIVRLMPLPHPSPLNKRYYGQFPTMLQRRLTEIAF