Your browser is old and dusty. Try Google Chrome!

Details for sll1214

ORF sll1214
Accession NP_439903.1
Symbol ycf59
Category hypothetical protein YCF59
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -304 -290 -0.393733 0.228
NP_440557.1_1 Forward -304 -285 -1.96717 0.28
NP_441418.1_6 Reverse -290 -309 -21.9284 0.163
NP_441418.1_6 Forward -305 -286 -23.1083 0.191
NP_440897.1_6 Reverse -296 -315 -0.492971 0.183
NP_441453.1_8 Reverse -64 -81 12.4285 0.205
NP_441098.1_3 Forward -30 -11 -6.11904 0.28
NP_442655.1_10 Forward -246 -227 -10.6203 0.22
NP_001035873.1_1 Forward -107 -88 16.3548 0.252
NP_441812.1_3 Reverse -55 -69 8.35772 0.254
NP_441859.1_3 Forward -321 -302 6.48849 0.176
NP_440856.1_4 Forward -327 -308 -2.85214 0.222
NP_442827.1_8 Reverse -303 -322 -1.08295 0.241
NP_442827.1_8 Reverse -337 -356 -1.67294 0.253
NP_441434.1_7 Forward -318 -304 8.75105 0.225
NP_441713.1_1 Reverse -305 -324 -14.7502 0.259
NP_442706.1_5 Forward -186 -167 12.2866 0.291
NP_442570.1_3 Reverse -300 -319 -7.27704 0.269
NP_442461.1_2 Forward -258 -239 12.4875 0.285
NP_441792.1_5 Forward -316 -300 8.02334 0.29
NP_441598.1_3 Forward -130 -111 11.9948 0.279
NP_442111.1_4 Forward -321 -307 2.2612 0.283
NP_440851.1_3 Forward -29 -10 3.53937 0.245
NP_441486.1_1 Forward -308 -294 -3.147 0.176
NP_441194.1_1 Reverse -131 -150 26.8806 0.000327
NP_441014.1_8 Forward -310 -291 -8.55534 0.284
NP_442848.1_5 Forward -280 -262 -2.43913 0.286
NP_441012.1_4 Forward -303 -290 11.229 0.252
NP_441012.1_4 Forward -309 -296 10.4424 0.262
NP_440376.1_1 Reverse -296 -305 4.42462 0.159
NP_442687.1_7 Reverse -71 -81 9.81313 0.0994
NP_442687.1_7 Reverse -310 -320 4.50326 0.245
NP_442687.1_7 Reverse -127 -137 4.20827 0.262
NP_442485.1_3 Forward -310 -291 1.96607 0.216
NP_442485.1_3 Forward -201 -182 -0.295539 0.252
NP_441846.1_10 Reverse -291 -310 -23.1083 0.277
NP_442530.1_2 Forward -178 -168 11.9764 0.282
NP_440141.1_3 Forward -205 -186 1.37609 0.274
NP_440141.1_8 Forward -74 -55 7.96426 0.232
NP_442937.1_5 Reverse -271 -290 9.63589 0.185
NP_441958.1_5 Reverse -310 -320 -2.6749 0.28
NP_440651.1_1 Reverse -287 -306 4.71934 0.294
NP_439905.1_1 Forward -240 -227 9.85238 0.216
NP_442690.1_1 Forward -187 -168 -13.8652 0.267
NP_441591.1_10 Reverse -54 -73 4.22769 0.297
NP_442536.1_8 Reverse -293 -312 15.8307 0.164
NP_441099.1_5 Reverse -224 -243 -11.0136 0.27
NP_441424.1_2 Reverse -134 -153 9.40553 0.273
NP_442431.1_10 Reverse -185 -203 4.44404 0.206
NP_442884.1_6 Forward -130 -111 16.2232 0.233
NP_441550.1_8 Reverse -48 -58 8.63269 0.119
NP_441550.1_8 Reverse -309 -319 6.76441 0.192
NP_441041.1_4 Reverse -296 -315 8.84924 0.0331
NP_441041.1_4 Forward -354 -335 -7.76869 0.192
NP_441041.1_7 Forward -244 -232 5.08534 0.278
NP_439966.1_7 Forward -307 -297 8.82935 0.13
NP_440202.1_8 Forward -214 -195 12.5297 0.272
NP_440983.1_5 Reverse -53 -72 15.5357 0.0965
NP_440983.1_5 Forward -317 -298 6.39097 0.178
NP_442281.1_1 Forward -310 -296 4.12889 0.206
NP_441556.1_4 Reverse -56 -75 15.5967 0.152
NP_440375.1_6 Forward -321 -302 10.9142 0.239
NP_440253.1_2 Forward -299 -281 9.26226 0.0507
NP_440929.1_8 Reverse -50 -59 3.53964 0.225
NP_442142.1_4 Forward -308 -295 7.2952 0.143
NP_440357.1_3 Forward -208 -189 -0.000545616 0.285
NP_442076.1_5 Forward -48 -29 8.45592 0.234
NP_440183.1_9 Forward -309 -290 -20.2567 0.282
NP_440379.1_5 Reverse -287 -306 0.58944 0.168
NP_441468.1_1 Reverse -297 -304 6.72562 0.126
NP_441020.2_6 Reverse -294 -311 8.88863 0.185
NP_441015.1_8 Reverse -59 -78 4.62101 0.258
NP_442719.1_2 Reverse -169 -187 -7.15971 0.232
NP_442719.1_2 Forward -144 -126 -9.7163 0.267
NP_442808.1_1 Forward -306 -296 4.40448 0.199
NP_442808.1_1 Forward -280 -270 2.33954 0.27
NP_440558.1_2 Forward -140 -121 -2.26216 0.225
NP_442789.1_4 Reverse -54 -73 -6.78538 0.288
NP_441878.1_6 Reverse -295 -305 0.963343 0.128
NP_441458.1_10 Reverse -267 -286 9.3409 0.161
NP_442397.1_9 Forward -312 -293 1.76941 0.283
NP_441819.1_5 Forward -21 -2 9.31004 0.27
NP_441574.1_1 Reverse -299 -318 -6.78538 0.28
NP_442347.1_2 Forward -253 -244 3.83464 0.284
NP_442347.1_2 Reverse -51 -60 3.04799 0.289
NP_442590.1_10 Reverse -290 -309 13.5691 0.135
NP_442334.1_1 Reverse -299 -318 3.93269 0.152
NP_440256.1_1 Forward -308 -289 -3.73712 0.138
NP_441512.1_4 Forward -324 -305 12.4875 0.228
NP_441559.1_8 Reverse -291 -305 -7.57189 0.295
NP_441179.1_9 Forward -281 -271 9.41933 0.28
NP_441261.1_1 Forward -313 -294 -4.72043 0.277
NP_441494.1_6 Forward -234 -221 6.90245 0.272
NP_442993.1_1 Forward -87 -71 -9.47957 0.186
NP_442484.1_2 Reverse -221 -240 0.0977854 0.252
NP_440327.1_6 Reverse -264 -283 2.45773 0.296
NP_440146.1_4 Forward -32 -13 4.52268 0.232
NP_440586.1_1 Forward -78 -59 -4.13045 0.278
NP_440586.1_8 Reverse -57 -64 10.7568 0.128
NP_440586.1_8 Forward -319 -312 8.88855 0.205
NP_440192.1_4 Reverse -106 -125 8.71846 0.29
NP_440027.1_3 Forward -311 -293 12.1131 0.159
NP_441167.1_1 Reverse -131 -150 6.39097 0.237
NP_440408.1_7 Reverse -290 -309 8.06259 0.282
NP_440439.1_1 Reverse -293 -306 -0.472371 0.221
NP_439943.1_4 Forward -81 -62 3.34271 0.298
NP_440372.1_3 Reverse -378 -392 15.9588 0.165
NP_441789.1_7 Forward -128 -109 -4.22953 0.28
NP_440819.1_5 Reverse -70 -78 7.8859 0.266
NP_441604.1_4 Forward -82 -63 2.75272 0.211
NP_441018.1_7 Reverse -266 -285 6.4893 0.286
NP_440163.1_10 Reverse -287 -297 12.4681 0.159
NP_440344.1_10 Forward -312 -295 -11.0726 0.2
NP_440344.1_10 Reverse -289 -306 -11.9575 0.235
NP_440282.1_3 Forward -310 -291 0.196116 0.281
NP_441103.1_2 Forward -117 -99 12.4081 0.156
NP_440999.1_9 Reverse -335 -349 -2.95034 0.281
NP_440888.1_2 Forward -305 -291 11.897 0.0562
NP_440600.1_4 Reverse -256 -274 -7.94566 0.294
NP_440491.1_1 Forward -244 -225 9.93819 0.205
NP_441469.1_8 Forward -306 -297 5.21127 0.283
NP_441601.1_2 Reverse -191 -210 0.196116 0.219
NP_440349.1_3 Reverse -188 -207 10.4217 0.283
NP_442204.1_1 Forward -247 -236 6.74518 0.152
NP_442204.1_1 Reverse -203 -214 0.550326 0.281
NP_442428.1_4 Reverse -295 -314 6.88262 0.194
NP_440818.1_3 Reverse -299 -318 11.2092 0.088
NP_442120.1_10 Reverse -72 -91 -8.65367 0.237
NP_440673.1_3 Forward -297 -290 10.4622 0.139
NP_440673.1_3 Forward -72 -65 7.80726 0.244
NP_441884.1_9 Reverse -47 -66 -23.9933 0.284
NP_441893.1_8 Reverse -287 -306 13.5691 0.287
NP_441719.1_2 Reverse -261 -275 13.2523 0.286
NP_442813.1_4 Reverse -366 -385 -6.29373 0.299
NP_442813.1_4 Reverse -261 -280 -8.85033 0.299
NP_443054.1_2 Reverse -294 -308 1.27789 0.25
NP_441555.1_2 Forward -397 -378 10.5514 0.299
NP_442622.1_1 Reverse -178 -197 -6.49039 0.257
NP_441668.1_4 Forward -334 -315 0.884433 0.229
NP_442515.1_1 Reverse -245 -259 -5.01529 0.298
NP_441396.1_5 Forward -344 -335 7.37455 0.279
NP_441683.1_7 Forward -348 -329 -6.49039 0.27
NP_441409.1_6 Forward -65 -46 -11.7019 0.222
NP_441394.1_10 Forward -315 -297 14.3747 0.238
NP_441107.1_10 Reverse -55 -69 15.4376 0.235
NP_441031.1_1 Forward -155 -136 7.69039 0.259
NP_440023.1_7 Forward -335 -316 5.70265 0.286
NP_442335.1_2 Reverse -306 -325 15.7324 0.28
NP_441078.1_4 Forward -305 -296 -1.6719 0.266
NP_441078.1_4 Reverse -296 -305 -1.86856 0.272
NP_440539.1_9 Forward -129 -110 -5.99873 0.286
NP_441030.1_3 Forward -247 -228 17.0099 0.262
NP_442797.1_6 Forward -86 -67 10.649 0.238
NP_441945.1_10 Forward -75 -56 23.5989 0.00877
NP_441945.1_10 Forward -364 -345 9.93088 0.258
NP_442510.1_5 Forward -308 -289 13.3725 0.229
NP_441072.1_2 Reverse -292 -311 8.25926 0.24
NP_440713.1_4 Reverse -292 -311 1.27776 0.289
NP_442489.1_2 Forward -290 -271 3.34271 0.238
NP_442489.1_7 Reverse -296 -305 -1.37691 0.195
NP_440565.1_7 Forward -239 -220 -1.67217 0.284
NP_442913.1_1 Forward -311 -292 3.93269 0.292
NP_442913.1_10 Reverse -41 -60 -4.6221 0.242
NP_441629.1_3 Forward -319 -300 2.6536 0.218
NP_441710.1_9 Forward -114 -95 14.6499 0.137
NP_440010.1_10 Reverse -299 -318 7.47261 0.226
NP_440671.1_4 Forward -305 -291 5.80112 0.271
NP_440772.1_8 Forward -323 -304 10.0292 0.253
NP_440590.1_4 Forward -205 -192 0.215946 0.165
NP_441239.1_9 Reverse -294 -306 10.5604 0.076
NP_441951.1_4 Forward -305 -286 0.58944 0.297
NP_440706.1_3 Reverse -243 -262 20.8016 0.118
NP_441892.1_1 Forward -308 -291 -5.86102 0.29
NP_442193.1_1 Forward -74 -56 12.2122 0.223
NP_440546.1_6 Reverse -286 -305 6.4893 0.3
NP_441230.1_5 Forward -317 -298 5.70265 0.182
NP_441230.1_5 Forward -310 -291 1.76941 0.234
NP_441848.1_4 Forward -185 -169 12.9937 0.195
NP_441848.1_7 Reverse -324 -343 6.78348 0.196
NP_442039.1_4 Forward -240 -233 8.39725 0.202
NP_441811.1_8 Reverse -305 -319 5.99778 0.289
NP_440753.1_5 Reverse -213 -232 9.14423 0.253
NP_440825.1_7 Forward -41 -31 11.3482 0.247
NP_442456.1_5 Reverse -61 -79 10.6389 0.26
NP_442533.1_1 Reverse -293 -312 -14.7502 0.247
NP_442533.1_6 Forward -305 -296 14.1594 0.0149
NP_441089.1_8 Reverse -222 -241 12.0933 0.278
NP_441187.1_1 Reverse -210 -229 21.8985 0.0556
NP_442322.1_4 Forward -314 -297 -1.7318 0.228
NP_441482.1_7 Forward -305 -291 -11.1118 0.237
NP_441028.1_6 Forward -132 -122 6.27276 0.23
NP_441527.1_3 Forward -236 -217 8.16093 0.296
NP_439965.1_1 Forward -209 -190 -9.14533 0.284
NP_440608.1_6 Reverse -51 -70 4.62021 0.258
NP_441602.1_3 Reverse -291 -310 -5.21209 0.28
NP_441602.1_4 Reverse -285 -304 8.84924 0.282
NP_441106.1_3 Reverse -141 -160 10.7175 0.245
NP_440429.1_9 Forward -249 -230 0.687771 0.297
NP_441216.1_5 Forward -316 -297 17.1082 0.177
NP_440886.1_7 Forward -306 -296 5.87944 0.158
NP_442382.1_7 Forward -318 -299 3.93269 0.262
NP_442072.1_9 Reverse -295 -313 -22.892 0.266
NP_440907.2_8 Forward -319 -309 5.28945 0.209
NP_442365.1_7 Forward -315 -296 -5.9004 0.282
NP_442615.1_1 Forward -96 -78 1.29745 0.0877
NP_441962.1_4 Reverse -123 -142 -6.58872 0.18
NP_442020.1_1 Forward -184 -165 -1.47628 0.291
NP_441993.1_5 Forward -264 -246 21.062 0.203
NP_440467.1_3 Reverse -221 -240 10.8656 0.296
NP_440766.1_4 Forward -245 -231 0.589577 0.276
NP_441237.1_9 Forward -205 -195 9.41981 0.294
NP_442743.1_1 Reverse -221 -240 7.4718 0.264
NP_440942.1_3 Forward -273 -254 2.75272 0.298
NP_441332.1_4 Forward -159 -140 5.50599 0.261
NP_442509.1_9 Forward -118 -108 6.37109 0.274
NP_440478.1_10 Forward -67 -53 7.27608 0.264
NP_442341.1_9 Forward -314 -300 6.48882 0.225
NP_441173.1_9 Reverse -320 -328 10.2454 0.261
NP_442395.2_2 Forward -310 -291 12.1917 0.245
NP_442395.2_9 Forward -264 -248 20.1181 0.16
NP_442534.1_7 Reverse -232 -251 5.80098 0.29
NP_441105.1_3 Reverse -67 -86 -4.42544 0.2
NP_440216.1_6 Forward -312 -296 8.12167 0.166
NP_442015.1_10 Reverse -292 -305 5.23083 0.148
NP_441226.1_7 Forward -298 -291 8.59356 0.197
NP_441226.1_7 Forward -311 -304 6.52862 0.253
NP_441766.1_2 Forward -299 -290 2.06468 0.265
NP_440416.1_9 Forward -312 -293 -9.53865 0.133
NP_442116.1_6 Reverse -16 -33 7.69149 0.254
NP_442116.1_6 Forward -18 -1 7.596 0.254
NP_442154.1_6 Reverse -289 -308 2.26107 0.234
NP_441430.1_2 Forward -141 -122 -3.83545 0.262
NP_440988.1_10 Forward -313 -299 4.99564 0.247
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCAATTTTGAAATTTCCATCAAAGACTTAACGGAATTAATCTGTGAACTGATGGAGTTTGAGGGGGACATTATTTGGGAAACCGATCAACCCAACGGCCAGCCCCGTCGCTGTTTAGACACCACCAAAGCTAAAGCAGAATTTGGGTTTGAAGCCCAGGTGAGCTTGCGGGAAGGATTGAAAAATACCATTGACTGGTATCGGCAACAACGGAGCTAACTACTGCAAAAAGTTCCGTTTGCAACAAAACACGTAACAGTTTGTAACAGTTGCCCCCCCTGACTAGAAACCCCGTTTCAACCCTTGTTACACTAGGCAATACCTTTTGCCCGTTGCTTTGATGGCGAGCAGACCTTGTTATTGATTGGAAACTTGTTAAGGAAACTATTTTAAACAACTCT

CDS

ATGGTTAATACCCTCGAAAAGCCCGGATTTGATGAAATCCGTCCCGGTGTCAAGACTCCGGCCAAGGAAACCATCCTCACTCCCCGTTTTTACACCACCGACTTCGATGAGATGGCCAAAATGGACATTTCCCCCAACGAAGACGAGTTGCGGGCCATCCTGGAAGAGTTTCGGGTGGATTACAATCGCCATCACTTTGTTCGTAATGAGTCCTTTAACAAATCCTGGGACCACATTGACGGGGAAAAACGCCAATTGTTCGTGGAATTTCTGGAGCGTTCCTGCACCGCTGAATTTTCCGGCTTCCTACTTTATAAAGAGTTGGGCCGTCGCCTCAAAAATAAAAACCCCTTGTTGGCCGAATGCTTTAACCTCATGTCCCGGGATGAAGCCCGCCATGCTGGTTTCCTCAACAAAGCCATGTCCGACTTTAACCTGTCTTTGGATTTGGGCTTTTTGACTAAGAGTCGTAAATATACCTTCTTTAAACCCAAGTTTATTTTCTACGCCACCTACCTTTCCGAGAAAATTGGCTACTGGCGTTACATCACCATTTATCGCCATTTGGAGAAAAATCCCAACGATTGCATTTATCCCATTTTTGAATTCTTTGAAAACTGGTGCCAAGACGAAAATCGCCACGGAGATTTCTTTGATGCGATTATGCGGGCCCAACCCCACACCCTCAACGATTGGAAAGCGAAGCTGTGGTGTCGTTTCTTCCTGCTCTCAGTCTTTGCCACCATGTATCTCAACGATACCCAACGGGCCGACTTCTATGCCTGCTTAGGTTTGGAGGCTCGGAGCTATGACAAGGAAGTCATTGAGAAAACCAACGAAACCGCTGGCCGGGTGTTTCCCATTATTCTCGATGTCAATAATCCTGAATTTTATAACCGCCTAGAAACCTGTGTTAGCAATAACGAACAACTACGGGCGATCGATGCTTCTGGTGCCCCTGGGGTAATTAAAGCCCTGCGTAAGTTACCCATTTTTGCTTCCAACGGCTGGCAATTTATCAAACTGTATTTGATGAAGCCCATTGCAGTGGATCAGTTGGCTGGAGCTGTGCGCTAA

Protein

MVNTLEKPGFDEIRPGVKTPAKETILTPRFYTTDFDEMAKMDISPNEDELRAILEEFRVDYNRHHFVRNESFNKSWDHIDGEKRQLFVEFLERSCTAEFSGFLLYKELGRRLKNKNPLLAECFNLMSRDEARHAGFLNKAMSDFNLSLDLGFLTKSRKYTFFKPKFIFYATYLSEKIGYWRYITIYRHLEKNPNDCIYPIFEFFENWCQDENRHGDFFDAIMRAQPHTLNDWKAKLWCRFFLLSVFATMYLNDTQRADFYACLGLEARSYDKEVIEKTNETAGRVFPIILDVNNPEFYNRLETCVSNNEQLRAIDASGAPGVIKALRKLPIFASNGWQFIKLYLMKPIAVDQLAGAVR