Your browser is old and dusty. Try Google Chrome!

Details for sll1204

ORF sll1204
Accession NP_439916.1
Symbol
Category similar to macrolide efflux protein
Definition Transport and binding proteins
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441418.1_3 Forward -340 -321 14.2756 0.173
NP_442291.1_5 Reverse -240 -256 -3.97304 0.261
NP_441098.1_3 Forward -30 -11 0.101718 0.25
NP_443027.1_4 Reverse -183 -193 8.33817 0.207
NP_440784.1_7 Reverse -94 -101 5.84064 0.248
NP_442118.1_3 Forward -25 -6 14.9441 0.231
NP_440764.1_5 Reverse -78 -97 10.4225 0.279
NP_441082.1_10 Forward -321 -308 8.67241 0.264
NP_439957.1_7 Forward -271 -252 15.3391 0.193
NP_441141.1_1 Reverse -62 -81 19.9598 0.191
NP_441716.1_1 Reverse -194 -208 6.88276 0.186
NP_441215.1_8 Forward -180 -161 19.469 0.162
NP_441486.1_1 Forward -253 -239 -4.32697 0.194
NP_441014.1_10 Reverse -246 -265 4.91521 0.194
NP_443018.1_3 Reverse -105 -112 5.34899 0.212
NP_441634.1_9 Forward -393 -374 14.9449 0.165
NP_441077.1_2 Forward -40 -21 13.0342 0.108
NP_442653.1_8 Reverse -231 -248 13.3135 0.271
NP_441317.1_4 Forward -160 -146 11.1828 0.259
NP_440203.1_5 Reverse -244 -254 9.71433 0.245
NP_440203.1_5 Reverse -107 -117 8.53436 0.294
NP_443055.1_6 Reverse -233 -251 -2.63651 0.298
NP_440138.1_1 Reverse -241 -259 5.81991 0.275
NP_442002.1_9 Reverse -287 -294 11.1505 0.185
NP_440377.1_1 Reverse -279 -296 10.5973 0.293
NP_440377.1_1 Forward -297 -280 10.2107 0.298
NP_441000.1_5 Forward -304 -285 3.53858 0.286
NP_442996.1_7 Forward -340 -321 12.4153 0.296
NP_441725.1_4 Reverse -380 -394 6.98048 0.252
NP_442941.1_2 Forward -25 -6 12.7478 0.292
NP_442281.1_1 Reverse -99 -113 3.8339 0.217
NP_441079.1_7 Forward -338 -319 -0.00131823 0.195
NP_441079.1_7 Reverse -128 -147 -6.3928 0.276
NP_442172.1_1 Reverse -317 -336 13.3448 0.237
NP_440723.1_4 Forward -260 -241 -3.54046 0.272
NP_441860.1_2 Forward -257 -238 13.9625 0.262
NP_442982.1_5 Reverse -61 -80 5.99764 0.156
NP_441071.1_2 Forward -300 -281 12.5568 0.291
NP_441095.1_4 Reverse -20 -34 13.5686 0.182
NP_440382.1_2 Reverse -155 -174 2.85027 0.278
NP_442970.1_3 Reverse -214 -232 15.3133 0.168
NP_442999.1_3 Reverse -266 -280 21.3615 0.105
NP_441298.1_3 Forward -22 -12 15.8729 0.277
NP_440158.1_1 Forward -341 -322 17.0449 0.0682
NP_440183.1_9 Reverse -243 -262 -21.1417 0.296
NP_440464.1_10 Reverse -375 -385 11.7668 0.282
NP_441015.1_8 Forward -353 -334 6.29264 0.258
NP_441426.1_8 Forward -127 -109 13.1955 0.204
NP_442745.1_6 Reverse -90 -109 13.3725 0.258
NP_442719.1_2 Forward -306 -288 -8.04469 0.241
NP_442227.1_2 Reverse -243 -262 -0.4922 0.253
NP_440385.1_8 Forward -22 -3 8.83258 0.282
NP_441114.1_3 Reverse -243 -252 7.37455 0.239
NP_440558.1_2 Reverse -238 -257 0.294447 0.193
NP_442721.1_4 Forward -298 -279 15.0441 0.291
NP_440084.1_8 Reverse -323 -337 14.5264 0.203
NP_440101.1_3 Forward -107 -88 4.71934 0.212
NP_441458.1_8 Forward -20 -1 7.19373 0.229
NP_441458.1_8 Reverse -15 -34 5.17542 0.265
NP_441819.1_4 Forward -247 -228 16.5191 0.103
NP_442347.1_2 Forward -193 -184 7.07956 0.134
NP_442998.1_5 Reverse -286 -296 15.2213 0.149
NP_440899.1_8 Reverse -20 -39 -10.6203 0.281
NP_443042.1_5 Reverse -321 -340 18.6683 0.154
NP_443042.1_5 Forward -334 -315 10.6291 0.296
NP_442866.1_1 Forward -119 -100 -9.24366 0.292
NP_442150.1_8 Reverse -226 -245 16.0415 0.265
NP_442791.1_5 Forward -110 -91 -9.73531 0.279
NP_441595.1_2 Reverse -283 -296 8.94252 0.278
NP_441595.1_2 Reverse -217 -230 8.84703 0.28
NP_441138.1_5 Reverse -217 -230 3.02202 0.297
NP_440819.1_5 Reverse -149 -157 7.98423 0.228
NP_441572.1_7 Reverse -87 -106 -6.29373 0.288
NP_441877.1_9 Reverse -324 -341 4.56207 0.284
NP_442262.1_10 Reverse -105 -112 7.6106 0.274
NP_440894.1_7 Reverse -281 -300 10.815 0.234
NP_442454.1_2 Forward -30 -11 8.25963 0.291
NP_440491.1_1 Forward -197 -178 12.1797 0.157
NP_441748.1_3 Reverse -85 -104 16.5752 0.205
NP_440575.1_1 Forward -169 -150 3.53858 0.256
NP_442710.1_7 Reverse -319 -338 10.1731 0.0963
NP_442337.1_8 Forward -261 -242 -1.27885 0.28
NP_440255.1_3 Reverse -291 -301 14.4405 0.298
NP_440104.1_8 Reverse -167 -181 18.1901 0.28
NP_440673.1_3 Reverse -243 -250 8.98723 0.203
NP_440436.1_4 Reverse -242 -251 7.76745 0.124
NP_440296.1_6 Forward -31 -13 13.4663 0.295
NP_441668.1_4 Forward -369 -350 0.786102 0.231
NP_442709.1_4 Forward -338 -319 8.94367 0.161
NP_441124.1_5 Forward -301 -291 13.6766 0.215
NP_442450.1_5 Forward -196 -186 6.27322 0.19
NP_442237.1_2 Reverse -196 -215 18.8574 0.193
NP_439950.1_1 Reverse -150 -159 14.8477 0.189
NP_440943.1_4 Reverse -280 -292 15.8703 0.154
NP_441432.1_8 Forward -251 -242 5.40793 0.158
NP_442400.1_10 Forward -296 -283 8.75154 0.278
NP_440386.1_3 Reverse -82 -101 -4.72043 0.221
NP_442749.1_5 Reverse -280 -297 19.5997 0.159
NP_442346.1_5 Forward -251 -241 11.2881 0.0706
NP_440486.1_6 Forward -257 -238 5.40766 0.297
NP_440250.1_4 Reverse -358 -377 2.75194 0.28
NP_441888.1_9 Reverse -241 -260 14.3605 0.278
NP_441329.1_3 Reverse -57 -67 14.3283 0.256
NP_442943.1_1 Forward -31 -16 5.2111 0.211
NP_442028.1_1 Reverse -12 -25 7.70113 0.289
NP_440542.1_8 Forward -301 -288 18.8988 0.215
NP_442627.1_4 Forward -36 -18 16.3311 0.262
NP_440219.1_1 Reverse -2 -21 17.5205 0.158
NP_441541.1_1 Forward -24 -6 -1.3349 0.237
NP_442479.1_9 Forward -299 -280 -1.47551 0.21
NP_442479.1_9 Forward -134 -115 -7.27704 0.266
NP_442479.1_9 Forward -328 -309 -13.2752 0.288
NP_441672.1_10 Forward -314 -295 14.5524 0.244
NP_441848.1_4 Forward -307 -291 12.1343 0.211
NP_440351.1_6 Forward -248 -234 22.1234 0.182
NP_442844.1_2 Forward -241 -226 13.1394 0.289
NP_442541.1_10 Reverse -241 -255 0.687325 0.3
NP_441697.1_5 Forward -338 -319 -2.91293 0.217
NP_441697.1_5 Forward -35 -16 -7.01908 0.239
NP_441697.1_5 Forward -337 -318 -10.6478 0.28
NP_441697.1_5 Reverse -318 -337 -11.3162 0.295
NP_441697.1_5 Forward -34 -15 -11.6982 0.298
NP_441028.1_6 Forward -157 -147 5.48612 0.255
NP_441527.1_4 Forward -352 -333 -6.15965 0.215
NP_441186.1_4 Forward -13 -3 15.6142 0.232
NP_441286.1_1 Reverse -184 -196 -0.354346 0.13
NP_442674.1_1 Forward -35 -16 12.6001 0.218
NP_441930.1_3 Reverse -319 -338 2.67657 0.295
NP_440404.1_9 Reverse -152 -171 7.68668 0.275
NP_441403.1_4 Forward -397 -379 7.29564 0.282
NP_442698.1_10 Reverse -149 -168 -0.4922 0.297
NP_441421.1_6 Forward -340 -323 12.9436 0.224
NP_442930.1_1 Forward -327 -317 10.5993 0.276
NP_442680.1_5 Reverse -150 -169 4.56599 0.227
NP_441496.1_1 Reverse -13 -27 12.9985 0.296
NP_441635.1_2 Forward -39 -20 9.88299 0.285
NP_441122.1_1 Forward -254 -239 11.0913 0.217
NP_441207.1_7 Reverse -152 -166 17.0004 0.179
NP_441207.1_7 Reverse -317 -331 8.28727 0.29
NP_440216.1_9 Reverse -243 -252 5.50626 0.292
NP_442371.1_1 Reverse -314 -324 13.5492 0.206
NP_442116.1_6 Reverse -2 -19 5.59067 0.293
NP_442154.1_3 Forward -177 -158 15.708 0.273
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAGTTTGGGGACATCTTGAGTCTGAAGTTTTAGATAATCTGGTAAGGCAAGAAGGTCAAGTTAAACAACTTTATAAATTTTATCGAGGTTGGGTAGGCGTAACAAAATTTGCCCAGATTGTTGAGCGTGAAATTTGGACTCAACGAGGTTGGCAATGGTTAAATTATCAAAAATCAGCTCAAATATTGAACATGGATGATAATCAGCATGATCCCAATTGGGTAGAGGTTCAATTTGATTTTATTTCTCCCGATAAAGTTAAAGGAGCTTATTTTGCAAGAGTTGAAGTCAATGGGTCAGTGATGACTGCTAGAAATTCAGGAGATGAACTTATTTCTGTCAAGCAGTATAGTGTCAGCTACTTAAAAGAAATTGATAAATAATTAATTTACAAAAATAA

CDS

ATGAAGACCTTTGTCACTCTTTGCTTGGGACAGGCTCTGTCGTCTATTGGTAGCGGTATGACTTATTTTTCTCTGACTATATGGATATGGCAAAAGACAAATTCTGCTATGTCAGTGGCTTTGATTTTAGTTTTTTATCAGCTCCCGCAAATTATCATTACACCTTTATCTGGTATCCTTACTGATTATTTTTCTCACAAAAAATTGCTAATTGTTAGCGATATCGGCTCTGCTGTATGTACATTTTCTGTGGGAATCCTAGCTTTTTTACAGATTCTTAATGTTAAGTATATATATCTGATTGCATCTATTATTGGTTGTTTTGGTAACATTCAAACCCTTAGTTATATTACCCTGGTCCCTTTAATTGTTCCTTATCAACACCATGCTCGTGCTAGTAGTATGGGAGCCATTACTGCATATAGCGCCGGAATTGTTGCCCCCGCTTTGGCTGGAATCTTATTTCCTGTGATGGGGCTAACTGGCATCACAATAATTGACATGACAACGTTCATGATCGCCGCTATAACGATCTTGATTCTACCAATAGCATTCGGAATTAAATCTCCTAAAATCACCAACCAAACTTTATTTGTTGTACGATTGAAAGAAAATTTTGTTGACGATATATTTTTTGGACTTAAATATATCTATAACCATCCAAATTTATCAAAGATATTGATCATTTTTTCATTGTTTAGCTTTGTAGAAGGAATCACTGAAGTAATTTACCAGCCTATGATTCTAGCAAAAACTGGAGGAAACACTGAGATTTTAGGGATTATTGTGGCCATCGGAGGAGTGGGGGGTATTGTTGGAGGAACTATTTGTAGTATTTGGGGAGGCTTCAAAAGAAGAACAACTGGTATTTTTATTGGCTTTATAATCAATGGATTCAGTCGATTGGCCATGGGACTGATTGCCCAACCAAAATTTTGGCTACTAGCTAACGTTGGTGCATCACTACCAAGTCCCTTAATCACCAGTTCATATACAGCAATTTGGTATGAGAAAGTTGCACGGGAAATACAAGGCCGAGTATTGGCTGCAGATTATTTGATCGGCACTGTTATCAGTAGTTTATCTGGATTGGCCGCAGGAATTTTAGCTAATCAGATATCGGTAATGCTGACTCACTTGAGTAACTTTTTAATCCTACCTATCAATGAAATTTTTGGACCTCCCCCAGGCAGCGGCATGGCATTCTTAATGGTGAACTGTGGAGTGCTCGCATTTCTATTGGGGCTATGGGGTCTATTGATTTATCAACGTGGGGATGATTAG

Protein

MKTFVTLCLGQALSSIGSGMTYFSLTIWIWQKTNSAMSVALILVFYQLPQIIITPLSGILTDYFSHKKLLIVSDIGSAVCTFSVGILAFLQILNVKYIYLIASIIGCFGNIQTLSYITLVPLIVPYQHHARASSMGAITAYSAGIVAPALAGILFPVMGLTGITIIDMTTFMIAAITILILPIAFGIKSPKITNQTLFVVRLKENFVDDIFFGLKYIYNHPNLSKILIIFSLFSFVEGITEVIYQPMILAKTGGNTEILGIIVAIGGVGGIVGGTICSIWGGFKRRTTGIFIGFIINGFSRLAMGLIAQPKFWLLANVGASLPSPLITSSYTAIWYEKVAREIQGRVLAADYLIGTVISSLSGLAAGILANQISVMLTHLSNFLILPINEIFGPPPGSGMAFLMVNCGVLAFLLGLWGLLIYQRGDD