Your browser is old and dusty. Try Google Chrome!

Details for sll1202

ORF sll1202
Accession NP_439918.1
Symbol
Category iron(III) dicitrate-binding protein of ABC transporter, FecB homolog
Definition Transport and binding proteins
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441418.1_6 Forward -337 -318 -10.7186 0.0382
NP_441453.1_4 Reverse -328 -336 7.29591 0.0589
NP_441453.1_4 Forward -337 -329 6.70593 0.121
NP_440226.1_1 Forward -337 -318 7.96426 0.0959
NP_440996.1_3 Forward -338 -320 13.1955 0.221
NP_442173.1_1 Forward -336 -328 7.59091 0.163
NP_442173.1_1 Reverse -329 -337 5.82095 0.2
NP_442752.1_4 Forward -337 -330 13.8055 0.0199
NP_443027.1_4 Reverse -326 -336 7.94484 0.223
NP_442975.1_10 Reverse -324 -338 10.3237 0.056
NP_440784.1_7 Reverse -329 -336 6.23397 0.241
NP_440784.1_7 Forward -336 -329 6.13563 0.241
NP_442062.1_8 Reverse -328 -338 5.19158 0.181
NP_441859.1_3 Forward -338 -319 4.81688 0.213
NP_441802.1_1 Reverse -49 -68 7.57094 0.248
NP_442242.1_4 Forward -336 -329 12.4288 0.0393
NP_440044.1_8 Reverse -329 -348 1.86774 0.161
NP_439918.1_1 Forward -400 -381 30.777 0.0000437
NP_439918.1_2 Forward -370 -351 27.0405 0.00415
NP_439918.1_2 Forward -364 -345 -3.93378 0.263
NP_439918.1_3 Forward -340 -321 30.4821 0.0000611
NP_439918.1_4 Forward -175 -156 28.5154 0.000468
NP_439918.1_5 Forward -277 -258 28.2204 0.000592
NP_439918.1_6 Forward -206 -187 16.6572 0.18
NP_439918.1_7 Forward -34 -15 18.0924 0.274
NP_439918.1_8 Forward -154 -135 22.7139 0.0851
NP_439918.1_9 Forward -316 -297 21.6323 0.146
NP_439918.1_10 Forward -253 -234 20.4569 0.173
NP_442110.1_7 Forward -365 -351 4.62115 0.197
NP_440769.1_8 Reverse -12 -31 9.0459 0.218
NP_441083.1_5 Reverse -328 -338 1.84832 0.198
NP_441434.1_1 Reverse -221 -235 7.17351 0.288
NP_441738.1_2 Reverse -330 -337 15.28 0.0102
NP_441738.1_2 Reverse -268 -275 8.1019 0.204
NP_440209.1_1 Forward -337 -329 14.8674 0.012
NP_442889.1_1 Reverse -366 -385 -12.2919 0.226
NP_442570.1_3 Forward -367 -348 8.65258 0.129
NP_441792.1_5 Reverse -323 -339 10.1866 0.234
NP_442111.1_4 Forward -338 -324 1.67122 0.296
NP_440906.1_5 Forward -336 -329 12.0355 0.0724
NP_440906.1_5 Reverse -329 -336 12.0355 0.0724
NP_440747.1_10 Forward -340 -328 -4.68091 0.115
NP_440747.1_10 Reverse -325 -337 -11.6624 0.131
NP_441486.1_1 Forward -340 -326 4.03116 0.0508
NP_441486.1_1 Reverse -325 -339 -5.21195 0.226
NP_441880.2_10 Reverse -267 -285 8.27895 0.279
NP_442145.1_4 Forward -280 -261 2.7211 0.299
NP_442145.1_4 Reverse -206 -225 2.53011 0.299
NP_442634.1_4 Forward -339 -325 -1.37704 0.149
NP_441014.1_10 Forward -112 -93 -1.08295 0.257
NP_442848.1_1 Forward -343 -329 -1.5737 0.263
NP_442848.1_1 Forward -42 -28 -4.22864 0.282
NP_442848.1_1 Reverse -328 -342 -4.4253 0.291
NP_443018.1_3 Reverse -382 -389 6.62729 0.168
NP_443018.1_3 Forward -336 -329 5.34899 0.212
NP_443018.1_3 Reverse -329 -336 5.34899 0.212
NP_440376.1_1 Reverse -328 -337 -0.000272808 0.285
NP_440376.1_1 Forward -337 -328 -0.0986038 0.285
NP_441588.1_4 Reverse -330 -340 8.92815 0.14
NP_442687.1_1 Forward -75 -62 20.5698 0.147
NP_442687.1_7 Forward -338 -328 6.37155 0.171
NP_442658.1_1 Reverse -326 -336 8.82935 0.177
NP_442782.1_2 Forward -337 -323 9.63603 0.198
NP_442937.1_5 Forward -342 -323 9.0459 0.204
NP_441958.1_5 Reverse -327 -337 1.74999 0.0765
NP_441958.1_5 Forward -338 -328 1.455 0.0956
NP_440203.1_5 Reverse -331 -341 13.3526 0.116
NP_442260.1_1 Reverse -270 -289 17.6007 0.112
NP_442911.1_2 Reverse -318 -337 -1.67217 0.0886
NP_440993.1_2 Reverse -323 -339 1.33684 0.284
NP_440993.1_3 Reverse -195 -214 -0.39464 0.266
NP_442210.1_7 Forward -342 -323 13.3725 0.258
NP_441654.1_6 Forward -76 -58 16.4266 0.186
NP_440809.1_9 Reverse -319 -337 -7.06068 0.225
NP_441712.1_1 Forward -188 -169 13.4829 0.251
NP_441712.1_1 Reverse -93 -112 11.6469 0.251
NP_440411.1_2 Forward -77 -58 20.8591 0.0172
NP_440377.1_1 Reverse -289 -306 10.6939 0.293
NP_440147.1_4 Forward -339 -326 -0.767364 0.299
NP_441550.1_8 Forward -339 -329 5.28945 0.255
NP_441916.1_7 Forward -337 -327 7.05986 0.0779
NP_441916.1_7 Reverse -328 -338 1.455 0.285
NP_441916.1_10 Reverse -320 -339 3.6377 0.227
NP_441041.1_4 Forward -364 -345 -13.7669 0.295
NP_442004.1_6 Forward -337 -323 2.35953 0.266
NP_442004.1_6 Reverse -328 -342 1.17956 0.296
NP_441725.1_4 Reverse -323 -337 4.22722 0.278
NP_442941.1_3 Forward -336 -326 7.55152 0.0711
NP_442941.1_3 Reverse -329 -339 1.35667 0.15
NP_440983.1_5 Forward -290 -271 -6.78538 0.28
NP_440802.1_8 Forward -379 -360 14.9458 0.278
NP_441678.1_9 Forward -370 -351 2.0644 0.223
NP_442281.1_1 Reverse -323 -337 8.84875 0.075
NP_441079.1_7 Forward -239 -220 -6.09781 0.271
NP_001035871.2_2 Reverse -92 -111 15.8228 0.296
NP_001035871.2_7 Forward -367 -357 16.1063 0.14
NP_442012.1_1 Forward -343 -324 1.0811 0.224
NP_441860.1_1 Reverse -316 -330 14.2889 0.281
NP_441644.1_6 Reverse -328 -338 6.17443 0.165
NP_441644.1_6 Forward -337 -327 5.28945 0.199
NP_442933.1_10 Forward -337 -328 13.9627 0.0192
NP_442933.1_10 Reverse -328 -337 8.1612 0.0885
NP_442554.1_8 Reverse -329 -339 5.5849 0.145
NP_441762.1_7 Reverse -327 -339 -7.43418 0.29
NP_442142.1_4 Reverse -325 -338 8.2785 0.118
NP_442292.1_1 Reverse -329 -338 8.75118 0.0306
NP_443009.1_5 Forward -338 -327 3.5981 0.286
NP_442076.1_5 Forward -296 -277 5.01433 0.293
NP_441198.1_4 Forward -372 -353 11.6025 0.241
NP_441468.1_1 Reverse -329 -336 6.13563 0.209
NP_441468.1_1 Forward -336 -329 6.0373 0.223
NP_441673.1_1 Reverse -328 -337 1.37636 0.114
NP_441673.1_1 Forward -337 -328 1.1797 0.163
NP_441826.1_2 Reverse -328 -342 -2.36035 0.271
NP_442868.1_6 Forward -339 -329 -0.0199663 0.255
NP_442719.1_2 Reverse -307 -325 -9.81463 0.267
NP_442719.1_2 Reverse -212 -230 -11.5846 0.292
NP_441251.1_8 Reverse -85 -98 14.4811 0.254
NP_443058.1_7 Forward -338 -319 4.81767 0.254
NP_442542.1_9 Forward -203 -189 7.27547 0.202
NP_442050.1_5 Reverse -326 -336 7.84605 0.243
NP_441036.1_8 Reverse -327 -337 13.8447 0.0353
NP_441557.1_5 Forward -337 -328 8.84951 0.0343
NP_441557.1_5 Reverse -328 -337 0.786375 0.106
NP_441739.1_2 Forward -248 -232 8.21931 0.193
NP_441819.1_4 Reverse -311 -330 14.4541 0.103
NP_441574.1_1 Forward -337 -318 10.2259 0.11
NP_441574.1_1 Forward -302 -283 -7.27704 0.286
NP_441638.1_10 Forward -157 -143 19.7641 0.0845
NP_442347.1_2 Reverse -329 -338 3.93297 0.284
NP_441037.1_4 Forward -339 -329 6.92787 0.237
NP_441633.1_3 Reverse -370 -383 1.9859 0.109
NP_440136.1_2 Reverse -329 -336 6.23397 0.171
NP_440136.1_2 Forward -336 -329 6.13563 0.193
NP_442998.1_5 Reverse -262 -272 8.33817 0.264
NP_442998.1_10 Reverse -330 -337 15.5754 0.0102
NP_440299.1_1 Forward -341 -328 16.2433 0.0109
NP_440299.1_1 Reverse -324 -337 6.90188 0.127
NP_441799.1_1 Reverse -262 -276 7.3738 0.144
NP_440256.1_1 Reverse -325 -344 -6.68705 0.217
NP_440256.1_1 Forward -340 -321 -6.88371 0.223
NP_441270.1_5 Reverse -41 -60 13.9702 0.211
NP_440733.1_2 Forward -94 -76 11.079 0.293
NP_442069.1_10 Reverse -317 -335 11.7205 0.188
NP_440026.1_4 Forward -340 -321 9.93088 0.24
NP_440695.1_5 Forward -337 -318 -1.27885 0.284
NP_442386.1_9 Forward -285 -276 8.45576 0.197
NP_441340.1_5 Forward -336 -329 6.13563 0.175
NP_441340.1_5 Reverse -329 -336 5.93897 0.198
NP_440168.1_9 Forward -360 -341 -4.52377 0.296
NP_440327.1_6 Forward -370 -351 5.40766 0.26
NP_440251.1_1 Reverse -101 -120 6.19431 0.276
NP_440586.1_1 Forward -341 -322 5.70265 0.182
NP_440586.1_8 Forward -336 -329 11.4451 0.0645
NP_440586.1_8 Reverse -335 -342 5.93863 0.283
NP_442251.1_6 Reverse -329 -336 12.0355 0.0627
NP_440684.1_9 Forward -343 -329 8.94771 0.221
NP_441262.1_3 Forward -337 -330 14.7888 0.0223
NP_443051.1_1 Forward -338 -329 0.786375 0.125
NP_443051.1_1 Reverse -327 -336 0.491382 0.151
NP_439937.1_9 Reverse -327 -344 -17.1697 0.294
NP_441522.1_3 Forward -253 -234 14.1591 0.192
NP_440372.1_2 Forward -336 -329 6.72562 0.0929
NP_440372.1_2 Reverse -329 -336 6.62729 0.151
NP_441138.1_5 Forward -99 -86 10.9479 0.227
NP_442384.1_10 Reverse -328 -341 15.0639 0.0117
NP_441018.1_7 Forward -341 -322 12.0942 0.17
NP_442262.1_10 Reverse -382 -389 10.1672 0.162
NP_441689.1_5 Reverse -326 -336 10.8943 0.132
NP_440344.1_10 Reverse -321 -338 -8.71262 0.132
NP_442556.1_10 Forward -340 -321 11.982 0.217
NP_442078.1_3 Reverse -83 -102 0.883656 0.236
NP_441543.1_2 Reverse -329 -338 7.17789 0.131
NP_442710.1_7 Reverse -94 -113 -5.30055 0.288
NP_443064.1_6 Reverse -157 -167 9.65817 0.205
NP_443064.1_6 Reverse -328 -338 8.6886 0.276
NP_442578.1_7 Forward -336 -329 5.93897 0.183
NP_440148.1_6 Reverse -64 -78 17.0324 0.255
NP_441462.1_2 Forward -337 -327 9.81313 0.0143
NP_443062.1_1 Forward -337 -319 3.67056 0.289
NP_443062.1_6 Forward -345 -326 4.62101 0.216
NP_440519.1_8 Forward -337 -321 8.90832 0.199
NP_442204.1_1 Forward -341 -330 6.94184 0.144
NP_442204.1_1 Reverse -324 -335 0.157002 0.283
NP_440516.1_8 Forward -337 -328 8.1612 0.0417
NP_442428.1_5 Reverse -329 -336 6.13563 0.209
NP_442428.1_5 Forward -336 -329 6.0373 0.212
NP_441867.1_2 Reverse -230 -249 -11.7019 0.231
NP_440673.1_3 Reverse -330 -337 12.4288 0.0426
NP_441052.1_2 Reverse -328 -338 1.74999 0.229
NP_442219.1_9 Reverse -329 -338 8.06287 0.0696
NP_442219.1_9 Reverse -276 -285 2.65466 0.241
NP_440436.1_4 Reverse -329 -338 13.9623 0.0193
NP_440436.1_4 Forward -336 -327 4.7192 0.244
NP_441719.1_4 Forward -336 -329 6.72562 0.093
NP_441719.1_4 Reverse -329 -336 6.62729 0.151
NP_442366.1_3 Forward -338 -320 3.06741 0.117
NP_442366.1_5 Forward -340 -330 17.2858 0.0141
NP_440129.1_10 Reverse -321 -335 4.52282 0.185
NP_442206.1_10 Forward -337 -322 14.7295 0.0799
NP_441851.1_10 Forward -338 -328 7.25653 0.144
NP_441982.1_6 Reverse -260 -269 10.7665 0.292
NP_440338.1_4 Forward -122 -103 4.22689 0.298
NP_442689.1_8 Forward -140 -123 -5.95935 0.279
NP_440431.1_3 Reverse -327 -346 10.6192 0.0495
NP_441031.1_1 Forward -229 -210 3.93054 0.293
NP_441031.1_1 Reverse -106 -125 3.64132 0.299
NP_440040.1_8 Reverse -121 -140 5.29938 0.236
NP_441078.1_4 Reverse -328 -337 0.196389 0.205
NP_441078.1_4 Forward -337 -328 -0.000272808 0.205
NP_442443.1_1 Reverse -364 -383 -4.32711 0.271
NP_441432.1_8 Forward -338 -329 7.17789 0.102
NP_441432.1_8 Forward -359 -350 2.55633 0.298
NP_442320.1_8 Forward -343 -329 -4.81863 0.188
NP_441732.1_2 Reverse -324 -340 1.82849 0.026
NP_441732.1_5 Reverse -164 -178 11.701 0.21
NP_440578.1_10 Forward -351 -332 15.7324 0.246
NP_442353.1_4 Forward -199 -180 -0.00131823 0.282
NP_442489.1_7 Reverse -328 -337 0.884706 0.145
NP_442489.1_7 Forward -337 -328 0.491382 0.178
NP_440559.1_1 Reverse -329 -338 14.1594 0.0317
NP_441659.2_8 Forward -337 -327 7.94484 0.052
NP_441659.2_8 Reverse -328 -338 6.37155 0.0774
NP_442346.1_5 Forward -338 -328 14.828 0.00967
NP_442346.1_5 Reverse -327 -337 4.40493 0.29
NP_440545.1_3 Forward -341 -324 2.10379 0.106
NP_440010.1_4 Reverse -318 -337 -1.37794 0.267
NP_441833.1_4 Reverse -329 -336 14.1004 0.0258
NP_441833.1_4 Forward -336 -329 6.13563 0.198
NP_441329.1_1 Reverse -71 -90 6.2543 0.265
NP_441895.1_2 Forward -54 -35 -17.6018 0.234
NP_442162.1_9 Reverse -329 -336 6.62729 0.142
NP_442162.1_9 Forward -336 -329 6.52896 0.178
NP_442796.1_2 Forward -52 -33 15.7469 0.199
NP_442199.1_5 Reverse -320 -339 -4.52377 0.229
NP_442199.1_7 Forward -235 -216 -0.0996487 0.289
NP_442021.1_3 Forward -343 -324 -6.09707 0.257
NP_441692.1_2 Reverse -87 -106 5.40766 0.149
NP_441813.1_5 Reverse -326 -336 5.5849 0.118
NP_440590.1_4 Reverse -329 -342 9.55739 0.0347
NP_440567.1_1 Reverse -329 -343 4.62115 0.116
NP_440567.1_1 Forward -336 -322 1.67122 0.196
NP_442497.1_10 Forward -336 -327 5.89959 0.109
NP_442497.1_10 Reverse -329 -338 0.688044 0.141
NP_440821.1_4 Forward -339 -329 -0.41329 0.257
NP_441727.1_3 Forward -344 -325 12.6841 0.126
NP_440604.1_6 Forward -337 -318 0.392778 0.166
NP_440219.1_1 Forward -235 -216 12.173 0.3
NP_440863.1_2 Reverse -260 -276 16.6224 0.207
NP_442216.1_4 Reverse -374 -382 8.1805 0.255
NP_442216.1_4 Reverse -291 -299 8.08217 0.255
NP_440212.1_9 Forward -76 -57 0.753444 0.289
NP_442138.1_10 Forward -337 -318 -5.11376 0.268
NP_440546.1_4 Forward -337 -327 13.1486 0.0572
NP_440462.1_6 Reverse -326 -336 6.66654 0.105
NP_440868.1_4 Forward -341 -329 -0.944332 0.284
NP_442479.1_5 Forward -281 -262 11.4216 0.222
NP_442402.1_4 Reverse -175 -194 -9.04772 0.285
NP_441848.1_4 Reverse -211 -227 12.6117 0.199
NP_441848.1_4 Forward -83 -67 11.4658 0.224
NP_441848.1_4 Reverse -86 -102 7.74165 0.288
NP_441848.1_7 Forward -77 -58 -4.42619 0.292
NP_441084.1_6 Reverse -326 -340 14.4828 0.0972
NP_440653.1_10 Forward -190 -171 3.24438 0.281
NP_442837.1_3 Reverse -329 -336 6.13563 0.25
NP_442837.1_3 Forward -336 -329 5.93897 0.265
NP_440160.1_9 Forward -212 -193 10.0292 0.235
NP_440505.1_3 Forward -339 -329 7.94484 0.147
NP_441102.1_1 Forward -336 -317 8.65258 0.183
NP_442532.1_3 Forward -107 -88 16.5232 0.273
NP_442532.1_4 Reverse -230 -248 9.22538 0.273
NP_440914.1_1 Reverse -328 -338 14.7634 0.00997
NP_440914.1_7 Forward -100 -81 9.11906 0.251
NP_441011.1_8 Forward -336 -327 8.1612 0.147
NP_442533.1_6 Forward -337 -328 5.3096 0.145
NP_441482.1_7 Reverse -322 -336 -3.34366 0.118
NP_439944.1_9 Forward -336 -326 14.0414 0.0456
NP_441697.1_5 Reverse -57 -76 -1.38506 0.206
NP_440116.1_5 Forward -340 -323 14.8868 0.0601
NP_441527.1_4 Reverse -136 -155 -5.30023 0.198
NP_441527.1_4 Reverse -137 -156 -12.6531 0.292
NP_441527.1_7 Reverse -28 -47 7.4718 0.29
NP_440115.1_6 Forward -340 -330 8.33817 0.13
NP_441972.1_5 Reverse -317 -336 -1.18052 0.175
NP_441106.1_1 Reverse -327 -336 14.2577 0.0252
NP_441106.1_7 Reverse -320 -339 13.9616 0.205
NP_439903.1_6 Reverse -325 -344 7.07848 0.164
NP_441286.1_1 Forward -338 -326 2.59558 0.0573
NP_442674.1_1 Reverse -93 -112 13.1825 0.218
NP_440670.1_8 Reverse -328 -337 6.98123 0.0882
NP_441930.1_3 Reverse -94 -113 5.9443 0.263
NP_442264.1_2 Forward -347 -330 6.13536 0.267
NP_441463.1_3 Forward -347 -328 -10.6203 0.299
NP_441626.1_2 Forward -336 -329 6.0373 0.212
NP_441626.1_2 Reverse -329 -336 6.0373 0.212
NP_442794.1_1 Forward -341 -329 2.59558 0.287
NP_440130.1_5 Forward -267 -248 16.7157 0.0749
NP_440387.1_1 Forward -337 -321 -3.8747 0.169
NP_440387.1_3 Forward -52 -38 15.0442 0.293
NP_441431.1_2 Forward -278 -264 6.0955 0.28
NP_440358.1_8 Forward -301 -282 -2.36049 0.3
NP_442090.1_2 Forward -128 -109 6.54077 0.281
NP_442090.1_2 Reverse -81 -100 6.44528 0.282
NP_440766.1_4 Forward -394 -380 0.589577 0.276
NP_441237.1_9 Reverse -329 -339 10.5014 0.228
NP_442509.1_9 Reverse -289 -299 9.41933 0.192
NP_440554.1_4 Forward -336 -326 8.33817 0.0773
NP_442862.1_3 Forward -101 -84 8.59364 0.238
NP_442737.1_5 Forward -338 -319 13.8485 0.211
NP_441885.1_5 Reverse -328 -338 1.455 0.11
NP_441885.1_5 Forward -337 -327 0.57002 0.137
NP_441173.1_9 Forward -268 -260 14.0803 0.17
NP_440191.1_6 Reverse -112 -126 15.3858 0.294
NP_440191.1_6 Forward -127 -113 15.1948 0.294
NP_443000.1_7 Reverse -326 -336 7.05986 0.102
NP_443000.1_7 Forward -339 -329 0.471689 0.298
NP_440552.1_8 Forward -277 -260 14.5669 0.161
NP_443059.1_10 Reverse -320 -339 3.34192 0.23
NP_441842.1_10 Forward -344 -330 15.6342 0.0393
NP_442638.1_3 Forward -98 -79 14.2756 0.277
NP_441389.1_5 Forward -179 -160 19.469 0.186
NP_442214.1_1 Forward -184 -165 7.96426 0.298
NP_441105.1_3 Forward -348 -329 -6.78538 0.241
NP_440172.1_1 Forward -337 -327 10.0098 0.0572
NP_442015.1_10 Forward -341 -328 7.59077 0.0819
NP_442015.1_10 Reverse -277 -290 1.9859 0.204
NP_440198.1_10 Forward -360 -341 7.07928 0.296
NP_441111.1_7 Reverse -329 -337 8.96754 0.0463
NP_441766.1_2 Forward -337 -328 8.06287 0.0691
NP_442417.1_5 Forward -337 -323 8.45605 0.158
NP_440416.1_9 Reverse -321 -340 -20.0601 0.281
NP_442403.1_8 Forward -341 -322 -2.0655 0.263
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACCTATGAAATTCAATCGGGGGCATTACAAGGACTAGGGTTTGGAATTGGCTTTAATTACGTTGGCGATCGTTTTGGTGATTTAGCTAATACCTACACAGTGGGGGATTATATCATCGGAAACGCAGCGATTTTTTACCAACGAGATAAATATCGAGTTGCCCTAAACTTGAGGAATTTTACTAATGCTAACTACGTCCGAGCAGTCAGTGGTAACCAAACAGGAATTGAACCTGGTGAACCATTTATTATTATTGGCTCATTTTCGGTTCAGTTTTAAATCATTAAAAGTTACTTGCTGTTTTTTTAATGATTTAGGAAGTTCAAAAAAATCTGCTCTTCTTTAGCTCCAGTCAAAAAGCAGAGGAGAGCTATTTATACTTACATATTTAAATTATTGT

CDS

ATGAAAAAATATAAGATAAATTACTTTTCTACTCTCATGATTTTTATGACGTCTCTTTTGACTTCTTGTAATACAAACATAGATCGATCTTCACATCTACAACAATCAGATAAAAAAGGTTGCCGGATAATTGAGCATAAAATGGGAGAAACTGAAATCTGTGGAATTCCTCAAAGAGTTGTTGTACTTGGTCCCTATTTATTAGAACCTTTACTAGCGTTAAACATTCAACCTATTGCCTATGCAGATCACATTGCTTTTCATAAAGAAGATTATGATCATCCTACCGAGCAAATTCCTTATTTGGGACAATATATTAATAAACCCATTGCCAATGTAGGAATTGCTTACATGCCTTCGTTAGAAGGAATTTTTAAAGCAAAACCTGATTTAATTTTGAGTCCTGATCATAATAAAAATGAATATCAAAAATTTTCTCAACTTGCACCTACCTTAATGTTATCTTGGAATGAACCTACTGAAAATCTAGAGAAGATTGCCCAGGCTGTTAAGCAAGAAGAAAAAGTCGAACAACTTTTACAAGAAACTCAGCAAGAAATTGAAAAAGCAAAGCAGGAATTTTCCAAAATTGTTGCAGGATACCCCAAAATGCTTCTACTTCATGCTCAAAATTTACAGGAATTGTCTATTGCCAATAATGAAGATCTTTGTAGCTCTCTAATTGAAGAATTGGGATTTGAATTAGTTTCTTTACCAGGAGCAGGTACATCTACAAATTCAAGACTGCCCCTTTCTTTAGAATCTCTTCCTAAGTTAAATAATGCCAATTCAATTATTATCTTAGGTTATAATTTTCAAGAATTCAATAAATCAAAAAGTAGACAAAATTTTACTGAGCATCAATTATCTAATTTACAACAACAGTGGTCAGAAAATGCAATAACACAATCAATGAAAGCAAGTCGAGAAAATCGTGTTTATTATATTCCAACTTATCTATGCACGGGTTTACCAGGTTTTTTCGGTACAAAACTTTATCTTAATGAATTAAAAAAACAACTCTTAACCAATCAAAAACCATGA

Protein

MKKYKINYFSTLMIFMTSLLTSCNTNIDRSSHLQQSDKKGCRIIEHKMGETEICGIPQRVVVLGPYLLEPLLALNIQPIAYADHIAFHKEDYDHPTEQIPYLGQYINKPIANVGIAYMPSLEGIFKAKPDLILSPDHNKNEYQKFSQLAPTLMLSWNEPTENLEKIAQAVKQEEKVEQLLQETQQEIEKAKQEFSKIVAGYPKMLLLHAQNLQELSIANNEDLCSSLIEELGFELVSLPGAGTSTNSRLPLSLESLPKLNNANSIIILGYNFQEFNKSKSRQNFTEHQLSNLQQQWSENAITQSMKASRENRVYYIPTYLCTGLPGFFGTKLYLNELKKQLLTNQKP