Your browser is old and dusty. Try Google Chrome!

Details for sll1201

ORF sll1201
Accession NP_440157.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Forward -46 -39 14.6904 0.0123
NP_440795.1_7 Reverse -39 -46 14.6904 0.0123
NP_442100.1_1 Forward -229 -210 8.06865 0.24
NP_441418.1_6 Forward -47 -28 -19.4701 0.0888
NP_441418.1_6 Reverse -26 -45 -30.6798 0.291
NP_442291.1_5 Forward -48 -32 -1.51476 0.199
NP_440897.1_6 Reverse -38 -57 -3.63955 0.252
NP_441453.1_4 Reverse -38 -46 16.539 0.00633
NP_441453.1_4 Forward -47 -39 16.539 0.00633
NP_441960.1_3 Reverse -231 -250 13.6054 0.262
NP_442151.1_6 Reverse -38 -52 8.84938 0.164
NP_441818.1_1 Reverse -39 -50 15.4961 0.0264
NP_441818.1_1 Forward -23 -12 9.20294 0.25
NP_440226.1_1 Forward -47 -28 16.1257 0.022
NP_440226.1_1 Reverse -38 -57 13.7658 0.0348
NP_440996.1_3 Forward -60 -42 10.4422 0.247
NP_442173.1_1 Forward -46 -38 15.4574 0.00633
NP_442173.1_1 Reverse -39 -47 15.4574 0.00633
NP_442752.1_4 Forward -47 -40 13.8055 0.0199
NP_442752.1_4 Reverse -38 -45 13.8055 0.0199
NP_443027.1_4 Reverse -36 -46 13.2547 0.0521
NP_443027.1_4 Forward -49 -39 11.0914 0.107
NP_440784.1_7 Forward -46 -39 15.9687 0.0123
NP_440784.1_7 Reverse -39 -46 15.9687 0.0123
NP_441967.1_6 Reverse -203 -222 23.9922 0.019
NP_441250.1_3 Forward -69 -50 4.916 0.241
NP_441438.1_1 Forward -188 -169 10.3242 0.228
NP_440061.1_9 Reverse -36 -50 18.0918 0.0109
NP_440061.1_9 Forward -49 -35 12.3887 0.0971
NP_440061.1_9 Forward -340 -326 4.91554 0.3
NP_441054.1_4 Forward -57 -39 25.4869 0.00534
NP_442062.1_3 Forward -186 -167 0.0977854 0.239
NP_442062.1_8 Reverse -38 -48 17.3846 0.00193
NP_442062.1_8 Forward -47 -37 10.3048 0.0493
NP_440761.1_4 Forward -52 -33 -14.0619 0.257
NP_440304.1_4 Reverse -36 -46 10.8948 0.051
NP_440304.1_4 Forward -49 -39 1.84832 0.299
NP_442242.1_4 Forward -46 -39 14.3954 0.0124
NP_442242.1_4 Reverse -39 -46 14.3954 0.0124
NP_440044.1_8 Forward -46 -27 -3.3438 0.282
NP_441594.1_6 Forward -285 -266 5.80098 0.205
NP_442110.1_7 Forward -47 -33 2.5562 0.222
NP_440856.1_4 Reverse -31 -50 13.3725 0.0346
NP_441083.1_5 Reverse -38 -48 20.3345 0.00053
NP_441083.1_5 Forward -47 -37 11.2881 0.0159
NP_441083.1_5 Forward -24 -14 5.09324 0.125
NP_441083.1_5 Reverse -26 -36 2.43831 0.195
NP_439957.1_10 Reverse -80 -90 16.2046 0.277
NP_441738.1_2 Forward -45 -38 15.28 0.0102
NP_441738.1_2 Reverse -40 -47 15.28 0.0102
NP_441558.1_5 Reverse -36 -55 17.699 0.0191
NP_441558.1_5 Forward -49 -30 8.94757 0.135
NP_440209.1_1 Reverse -38 -46 18.1123 0.00295
NP_440209.1_1 Forward -47 -39 18.1123 0.00295
NP_440407.1_5 Forward -43 -24 19.6648 0.0977
NP_440447.1_1 Reverse -33 -51 4.54237 0.223
NP_440447.1_6 Forward -55 -37 7.68896 0.14
NP_440056.1_9 Forward -63 -44 12.8967 0.295
NP_441713.1_1 Forward -53 -34 3.83436 0.0568
NP_442570.1_3 Reverse -326 -345 -6.68705 0.259
NP_442570.1_3 Reverse -336 -355 -8.752 0.292
NP_441716.1_1 Reverse -38 -52 4.81781 0.248
NP_442111.1_4 Forward -48 -34 20.8458 0.00257
NP_442111.1_4 Forward -357 -343 2.45787 0.276
NP_440906.1_5 Forward -46 -39 15.8704 0.0124
NP_440906.1_5 Reverse -39 -46 15.8704 0.0124
NP_441209.1_3 Reverse -166 -185 17.7133 0.226
NP_440747.1_10 Reverse -35 -47 17.1486 0.000663
NP_440747.1_10 Forward -50 -38 16.7552 0.0019
NP_440747.1_10 Reverse -264 -276 -12.3507 0.27
NP_440747.1_10 Reverse -23 -35 -12.4491 0.282
NP_440747.1_10 Reverse -12 -24 -12.5474 0.297
NP_441130.1_10 Forward -49 -35 5.40779 0.231
NP_442145.1_4 Reverse -168 -187 9.31004 0.175
NP_440944.1_2 Forward -59 -40 -0.983855 0.259
NP_442634.1_2 Reverse -32 -51 -0.4922 0.293
NP_442634.1_4 Forward -49 -35 8.16106 0.0479
NP_442634.1_4 Reverse -36 -50 -1.8687 0.149
NP_442634.1_4 Reverse -13 -27 -5.31028 0.246
NP_441265.1_3 Reverse -32 -46 4.52282 0.181
NP_440470.1_5 Forward -175 -156 20.9601 0.0752
NP_440470.1_5 Forward -165 -146 17.9998 0.141
NP_440057.1_6 Reverse -145 -164 15.4883 0.235
NP_443017.1_1 Reverse -170 -189 15.1316 0.274
NP_443018.1_3 Forward -46 -39 14.8871 0.0123
NP_443018.1_3 Reverse -39 -46 14.8871 0.0123
NP_441634.1_8 Forward -49 -35 -3.24533 0.295
NP_440376.1_1 Forward -47 -38 19.4693 0.000692
NP_440376.1_1 Reverse -38 -47 19.4693 0.000692
NP_441588.1_4 Reverse -40 -50 6.46988 0.193
NP_443065.1_6 Forward -332 -313 0.786102 0.253
NP_442687.1_7 Reverse -37 -47 9.02648 0.0994
NP_442687.1_7 Forward -48 -38 8.92815 0.0994
NP_442687.1_7 Forward -265 -255 7.35486 0.134
NP_442191.1_4 Forward -46 -32 14.9684 0.073
NP_441077.1_2 Reverse -149 -168 1.38421 0.283
NP_441077.1_2 Reverse -159 -178 1.00224 0.289
NP_442485.1_3 Forward -281 -262 0.884433 0.234
NP_442958.1_3 Forward -58 -39 0.491109 0.267
NP_442530.1_2 Reverse -55 -65 14.533 0.203
NP_440642.1_10 Forward -87 -73 12.192 0.137
NP_442296.1_9 Forward -282 -263 -1.08219 0.197
NP_442658.1_1 Reverse -36 -46 14.2375 0.0237
NP_442658.1_1 Forward -49 -39 7.94438 0.199
NP_442198.1_3 Forward -56 -37 3.53937 0.285
NP_440141.1_4 Reverse -331 -350 -8.06369 0.298
NP_440141.1_8 Reverse -298 -317 5.01433 0.278
NP_442782.1_2 Forward -47 -33 10.7177 0.173
NP_441414.1_9 Reverse -38 -57 14.9458 0.0118
NP_441414.1_9 Forward -47 -28 -9.73531 0.266
NP_440184.1_7 Forward -190 -171 13.4144 0.28
NP_442937.1_5 Reverse -262 -281 8.25926 0.229
NP_441958.1_5 Reverse -37 -47 21.2195 0.000805
NP_441958.1_5 Forward -48 -38 12.2714 0.00183
NP_442486.1_4 Reverse -28 -47 11.9958 0.167
NP_440203.1_5 Reverse -258 -268 10.206 0.235
NP_442816.1_7 Reverse -169 -188 5.77684 0.244
NP_439905.1_1 Reverse -39 -52 16.5389 0.0578
NP_440984.1_7 Forward -52 -38 11.2093 0.122
NP_440984.1_7 Reverse -33 -47 10.1277 0.126
NP_439990.1_5 Forward -52 -39 19.6855 0.00652
NP_442690.1_1 Forward -165 -146 -3.83545 0.142
NP_442690.1_1 Forward -175 -156 -7.4737 0.175
NP_442690.1_1 Forward -185 -166 -14.3569 0.272
NP_442690.1_1 Forward -68 -49 -16.4218 0.289
NP_442690.1_1 Reverse -47 -66 -17.1101 0.297
NP_442911.1_2 Forward -57 -38 5.01433 0.0356
NP_442911.1_2 Reverse -28 -47 -1.08219 0.0811
NP_440153.1_5 Forward -46 -32 5.30946 0.191
NP_442064.1_1 Forward -52 -33 4.62101 0.143
NP_442536.1_8 Reverse -249 -268 16.0274 0.158
NP_440993.1_2 Forward -361 -345 5.76173 0.234
NP_440993.1_2 Reverse -33 -49 3.30346 0.259
NP_440993.1_3 Reverse -28 -47 14.4533 0.0527
NP_440602.1_2 Forward -52 -33 4.81767 0.263
NP_440138.1_7 Forward -57 -39 15.2807 0.278
NP_441099.1_5 Forward -57 -38 17.2074 0.0135
NP_442002.1_5 Reverse -284 -302 18.6029 0.187
NP_442002.1_9 Forward -265 -258 12.4288 0.185
NP_440809.1_9 Reverse -29 -47 2.0841 0.118
NP_442013.1_2 Forward -35 -16 13.3725 0.293
NP_441712.1_1 Reverse -47 -66 9.42428 0.289
NP_441294.1_7 Reverse -34 -48 10.4985 0.185
NP_441646.1_1 Forward -283 -264 -1.47551 0.287
NP_442438.1_10 Reverse -33 -47 4.71948 0.142
NP_442438.1_10 Forward -269 -255 2.16287 0.185
NP_442566.1_2 Reverse -299 -318 0.982764 0.289
NP_440377.1_1 Reverse -156 -173 15.5256 0.181
NP_441000.1_6 Forward -48 -34 -3.54032 0.224
NP_442771.1_1 Reverse -253 -271 -0.177514 0.103
NP_440147.1_4 Reverse -36 -49 17.9155 0.00539
NP_440147.1_4 Forward -49 -36 15.7522 0.0148
NP_441550.1_8 Reverse -36 -46 15.8108 0.0132
NP_441550.1_8 Forward -49 -39 15.1225 0.0132
NP_441916.1_7 Forward -47 -37 18.9579 0.00144
NP_441916.1_7 Reverse -38 -48 10.3048 0.0261
NP_440345.1_5 Reverse -54 -68 16.7213 0.263
NP_441041.1_4 Reverse -38 -57 -3.04881 0.119
NP_441041.1_4 Reverse -328 -347 -12.7836 0.274
NP_441041.1_7 Reverse -35 -47 13.3454 0.0485
NP_440016.1_9 Reverse -261 -280 8.94757 0.278
NP_442396.1_5 Forward -51 -38 11.819 0.0913
NP_440569.1_10 Forward -173 -154 10.3605 0.222
NP_440569.1_10 Forward -67 -48 4.72643 0.25
NP_441568.1_9 Forward -364 -351 17.8166 0.276
NP_440703.1_2 Forward -54 -35 17.4367 0.151
NP_441725.1_4 Reverse -33 -47 4.03056 0.278
NP_441725.1_5 Reverse -39 -49 2.04498 0.115
NP_441725.1_5 Forward -46 -36 1.94665 0.115
NP_441725.1_5 Reverse -256 -266 -0.118297 0.232
NP_439966.1_7 Forward -49 -39 15.3192 0.0152
NP_439966.1_7 Reverse -36 -46 14.3359 0.0203
NP_440202.1_8 Reverse -262 -281 10.0008 0.297
NP_442941.1_3 Forward -46 -36 19.2529 0.00262
NP_442941.1_3 Reverse -39 -49 19.2529 0.00262
NP_442941.1_5 Forward -62 -48 17.3897 0.181
NP_440289.1_2 Reverse -35 -48 3.16588 0.0811
NP_440289.1_2 Forward -50 -37 -3.71729 0.267
NP_440289.1_2 Reverse -252 -265 -4.79893 0.294
NP_441514.1_6 Forward -244 -237 14.2971 0.248
NP_442281.1_1 Reverse -33 -47 8.55376 0.0798
NP_442281.1_1 Forward -40 -26 3.04726 0.246
NP_442281.1_1 Forward -347 -333 1.5723 0.296
NP_442281.1_1 Reverse -10 -24 1.5723 0.296
NP_441334.1_7 Forward -49 -30 -21.0434 0.287
NP_441079.1_7 Reverse -155 -174 -1.27961 0.201
NP_442256.1_2 Forward -49 -31 0.609134 0.115
NP_440437.1_1 Reverse -32 -51 6.58763 0.0726
NP_440647.1_9 Reverse -36 -54 6.60732 0.219
NP_442500.1_8 Reverse -155 -169 19.2406 0.103
NP_442500.1_8 Reverse -142 -156 9.88916 0.272
NP_442012.1_2 Forward -49 -30 4.32602 0.216
NP_440498.1_1 Reverse -29 -47 -0.177514 0.218
NP_442982.1_5 Reverse -28 -47 -2.95047 0.289
NP_441644.1_6 Forward -47 -37 19.0557 0.000803
NP_441644.1_6 Reverse -38 -48 17.3841 0.00127
NP_441071.1_2 Reverse -153 -172 12.7478 0.291
NP_440867.1_9 Reverse -28 -47 12.3892 0.249
NP_442215.1_2 Forward -351 -335 -0.728113 0.171
NP_442215.1_2 Forward -26 -10 -0.826444 0.173
NP_442215.1_2 Forward -49 -33 -3.38305 0.214
NP_442029.1_6 Forward -52 -33 5.89931 0.248
NP_440253.1_2 Reverse -38 -56 -0.374176 0.209
NP_440929.1_8 Forward -47 -38 19.2726 0.000701
NP_440929.1_8 Reverse -38 -47 19.2726 0.000701
NP_440566.1_6 Forward -49 -30 9.73422 0.287
NP_442933.1_10 Forward -47 -38 17.601 0.00325
NP_442933.1_10 Reverse -38 -47 17.601 0.00325
NP_440576.1_2 Forward -174 -155 9.0459 0.252
NP_441751.2_8 Forward -46 -32 7.27608 0.0339
NP_441751.2_8 Reverse -39 -53 2.75286 0.0759
NP_442554.1_8 Forward -46 -36 17.2863 0.00543
NP_442554.1_8 Reverse -39 -49 16.2046 0.0065
NP_441762.1_7 Reverse -37 -49 -6.64753 0.284
NP_441762.1_7 Forward -48 -36 -6.84419 0.284
NP_442142.1_4 Reverse -35 -48 12.9 0.0406
NP_442142.1_4 Forward -50 -37 4.83694 0.209
NP_442292.1_1 Reverse -39 -48 18.486 0.00229
NP_442292.1_1 Forward -46 -37 17.5026 0.00435
NP_442476.1_6 Reverse -39 -53 12.1926 0.0509
NP_442476.1_6 Forward -46 -32 1.27789 0.223
NP_440895.1_3 Reverse -162 -181 16.2746 0.237
NP_440895.1_6 Forward -53 -40 10.4424 0.202
NP_441523.1_6 Reverse -34 -53 4.52268 0.251
NP_443009.1_5 Forward -48 -37 14.5128 0.02
NP_443009.1_5 Reverse -37 -48 10.1862 0.0792
NP_443009.1_5 Forward -338 -327 3.69644 0.282
NP_442301.1_2 Forward -358 -339 3.73524 0.288
NP_441715.1_4 Reverse -39 -49 17.3846 0.0106
NP_441715.1_4 Forward -46 -36 16.7946 0.0106
NP_441715.1_4 Forward -23 -13 13.5497 0.0431
NP_441715.1_4 Reverse -197 -207 5.09324 0.233
NP_440158.1_1 Reverse -171 -190 25.6392 0.00192
NP_440158.1_1 Reverse -161 -180 14.9441 0.105
NP_440379.1_5 Forward -51 -32 2.55606 0.149
NP_440379.1_5 Forward -279 -260 -6.88371 0.24
NP_441468.1_1 Forward -46 -39 15.8704 0.0124
NP_441468.1_1 Reverse -39 -46 15.8704 0.0124
NP_441673.1_1 Forward -47 -38 20.8459 0.000698
NP_441673.1_1 Reverse -38 -47 20.8459 0.000698
NP_441826.1_2 Reverse -249 -263 5.40779 0.0975
NP_441826.1_2 Reverse -32 -46 -3.34366 0.284
NP_441330.1_1 Reverse -33 -52 -12.6852 0.183
NP_441637.1_9 Forward -160 -142 2.77242 0.271
NP_442490.1_9 Forward -276 -257 -7.17871 0.275
NP_441764.1_1 Forward -166 -147 15.6341 0.0923
NP_442868.1_6 Forward -49 -39 19.2529 0.00563
NP_442868.1_6 Reverse -36 -46 10.4031 0.038
NP_442719.1_2 Forward -65 -47 -0.571569 0.162
NP_442719.1_2 Forward -160 -142 -11.8796 0.297
NP_440785.1_1 Forward -370 -351 -0.590531 0.263
NP_441612.1_2 Reverse -38 -48 8.54929 0.21
NP_441612.1_2 Forward -24 -14 7.00028 0.268
NP_441612.1_2 Reverse -196 -206 6.61303 0.283
NP_442227.1_2 Reverse -275 -294 19.5673 0.0652
NP_442427.1_8 Forward -56 -37 5.50599 0.264
NP_442808.1_1 Reverse -37 -47 8.73102 0.0481
NP_442808.1_1 Forward -48 -38 8.63269 0.0481
NP_440145.1_3 Forward -215 -196 -5.11376 0.258
NP_440145.1_3 Reverse -28 -47 -5.80207 0.279
NP_442542.1_2 Reverse -36 -49 7.88576 0.168
NP_442542.1_9 Reverse -263 -277 7.96378 0.178
NP_442050.1_5 Reverse -36 -46 15.9091 0.0091
NP_442050.1_5 Forward -49 -39 14.3359 0.0206
NP_442739.1_2 Reverse -203 -222 11.1342 0.248
NP_440558.1_2 Reverse -29 -48 -2.36049 0.226
NP_442576.1_2 Reverse -156 -175 10.5209 0.242
NP_442789.1_4 Forward -281 -262 -3.83545 0.254
NP_441878.1_6 Reverse -37 -47 10.5014 0.0176
NP_441878.1_6 Forward -48 -38 10.4031 0.0176
NP_441878.1_6 Forward -124 -114 -7.68978 0.255
NP_441036.1_8 Reverse -37 -47 15.713 0.00724
NP_441036.1_8 Forward -287 -277 9.51814 0.174
NP_441036.1_8 Forward -48 -38 8.33817 0.174
NP_441557.1_5 Forward -47 -38 19.9609 0.000699
NP_441557.1_5 Reverse -38 -47 19.9609 0.000699
NP_441445.1_1 Reverse -29 -48 1.17943 0.259
NP_442066.2_9 Forward -51 -38 20.0788 0.00699
NP_440101.1_3 Reverse -33 -52 1.67108 0.269
NP_442192.1_5 Reverse -143 -162 7.07928 0.292
NP_442166.1_7 Forward -46 -32 10.6193 0.19
NP_441819.1_2 Reverse -140 -159 16.5674 0.27
NP_441549.1_9 Forward -51 -33 14.6705 0.0304
NP_442347.1_2 Reverse -39 -48 12.4878 0.056
NP_442347.1_2 Forward -46 -37 3.34298 0.284
NP_442645.1_2 Forward -55 -36 -22.0267 0.29
NP_441037.1_4 Reverse -36 -46 7.22024 0.237
NP_441633.1_3 Forward -49 -36 3.36254 0.0699
NP_441633.1_3 Reverse -268 -281 0.412608 0.124
NP_441633.1_3 Reverse -36 -49 -3.71729 0.177
NP_440136.1_2 Forward -46 -39 15.9687 0.0123
NP_440136.1_2 Reverse -39 -46 15.9687 0.0123
NP_442998.1_5 Reverse -141 -151 12.4681 0.169
NP_442998.1_5 Reverse -55 -65 8.53483 0.261
NP_442998.1_10 Forward -45 -38 15.5754 0.0102
NP_442998.1_10 Reverse -40 -47 15.5754 0.0102
NP_440731.1_2 Forward -300 -281 2.94938 0.297
NP_440899.1_8 Forward -161 -142 -9.44032 0.262
NP_440299.1_1 Forward -51 -38 10.9334 0.0529
NP_440299.1_1 Reverse -34 -47 7.39353 0.113
NP_441799.1_1 Reverse -34 -48 15.6336 0.0172
NP_441799.1_1 Forward -51 -37 14.5519 0.0228
NP_441799.1_9 Forward -353 -334 -5.40875 0.297
NP_441007.1_10 Reverse -33 -46 1.39592 0.203
NP_441007.1_10 Forward -52 -39 1.29759 0.203
NP_442201.1_10 Reverse -27 -46 -6.58872 0.184
NP_442333.2_5 Forward -353 -334 -15.4385 0.294
NP_440256.1_1 Forward -50 -31 8.06259 0.0239
NP_440256.1_1 Reverse -35 -54 -6.29373 0.207
NP_440709.1_1 Reverse -167 -186 5.70185 0.163
NP_441559.1_8 Reverse -33 -47 8.65272 0.0676
NP_441559.1_8 Forward -52 -38 -5.90027 0.271
NP_441559.1_8 Reverse -323 -337 -5.9986 0.271
NP_441559.1_8 Reverse -22 -36 -7.57189 0.295
NP_440915.1_6 Forward -51 -37 9.73436 0.039
NP_440915.1_6 Reverse -34 -48 7.86607 0.0637
NP_440915.1_6 Reverse -324 -338 -1.18038 0.224
NP_442785.1_7 Reverse -36 -50 11.2093 0.228
NP_441464.1_1 Reverse -34 -53 10.4225 0.24
NP_440026.1_7 Reverse -33 -48 16.6962 0.159
NP_440695.1_5 Forward -47 -28 0.58944 0.284
NP_441939.1_3 Forward -46 -27 11.3075 0.114
NP_440677.1_6 Forward -252 -233 13.1758 0.185
NP_442386.1_9 Forward -48 -39 13.8639 0.0289
NP_442386.1_9 Reverse -37 -46 6.39082 0.219
NP_441404.1_7 Reverse -192 -211 10.2259 0.197
NP_442054.1_3 Forward -362 -343 -5.21209 0.297
NP_441340.1_5 Forward -46 -39 15.6737 0.0124
NP_441340.1_5 Reverse -39 -46 15.6737 0.0124
NP_442327.1_3 Forward -78 -59 5.58586 0.276
NP_442484.1_2 Forward -58 -39 5.89931 0.159
NP_442506.1_2 Forward -58 -39 3.14605 0.278
NP_442240.1_2 Forward -46 -27 -10.6203 0.137
NP_440586.1_2 Forward -260 -241 13.2741 0.239
NP_440586.1_8 Forward -46 -39 13.2151 0.026
NP_440586.1_8 Reverse -39 -46 13.2151 0.026
NP_442251.1_6 Forward -46 -39 15.2804 0.0124
NP_442251.1_6 Reverse -39 -46 15.2804 0.0124
NP_442251.1_6 Reverse -197 -204 8.20058 0.23
NP_442251.1_6 Forward -23 -16 8.10225 0.245
NP_442959.1_5 Reverse -144 -163 5.30933 0.287
NP_441912.1_10 Reverse -207 -226 14.1591 0.191
NP_441262.1_3 Reverse -38 -45 14.7888 0.0223
NP_441262.1_3 Forward -47 -40 14.7888 0.0223
NP_443051.1_1 Reverse -37 -46 19.5676 0.00335
NP_443051.1_1 Forward -48 -39 10.4228 0.00754
NP_441595.1_2 Reverse -148 -161 8.94252 0.278
NP_440408.1_3 Reverse -249 -268 6.88262 0.138
NP_440408.1_7 Forward -270 -251 8.75091 0.269
NP_440439.1_1 Reverse -35 -48 10.934 0.0339
NP_440439.1_1 Forward -50 -37 1.59258 0.148
NP_439943.1_7 Forward -52 -33 13.8641 0.0929
NP_440372.1_2 Forward -46 -39 16.3621 0.0124
NP_440372.1_2 Reverse -39 -46 16.3621 0.0124
NP_440372.1_3 Reverse -149 -163 13.094 0.274
NP_440819.1_5 Reverse -312 -320 7.8859 0.266
NP_441803.1_3 Reverse -317 -336 20.5498 0.16
NP_441572.1_7 Reverse -32 -51 -2.75381 0.2
NP_441572.1_7 Forward -53 -34 -3.83545 0.22
NP_441572.1_7 Reverse -249 -268 -4.22878 0.229
NP_440267.1_2 Reverse -33 -47 19.5668 0.0168
NP_442384.1_10 Reverse -38 -51 19.2922 0.00338
NP_442384.1_10 Forward -47 -34 17.9155 0.00564
NP_442384.1_10 Reverse -255 -268 3.36254 0.193
NP_441877.1_9 Forward -178 -161 4.16874 0.284
NP_441018.1_7 Forward -51 -32 10.8159 0.194
NP_441018.1_7 Reverse -335 -354 6.4893 0.286
NP_442262.1_10 Forward -46 -39 14.1988 0.0123
NP_442262.1_10 Reverse -39 -46 14.1988 0.0123
NP_441689.1_5 Reverse -36 -46 8.3377 0.132
NP_441689.1_5 Forward -49 -39 5.78111 0.197
NP_440163.1_3 Forward -343 -324 21.3373 0.0672
NP_440282.1_10 Reverse -28 -47 -8.85033 0.266
NP_440282.1_10 Reverse -251 -270 -9.047 0.269
NP_441965.1_10 Forward -50 -34 8.71166 0.123
NP_441965.1_10 Reverse -35 -51 1.92682 0.297
NP_442693.1_6 Reverse -32 -51 1.57275 0.278
NP_440297.1_9 Reverse -39 -49 -0.118297 0.282
NP_440297.1_9 Forward -46 -36 -0.216628 0.282
NP_440894.1_10 Reverse -265 -284 2.75272 0.283
NP_440999.1_9 Reverse -11 -25 2.16287 0.154
NP_440999.1_9 Reverse -34 -48 0.687908 0.177
NP_440999.1_9 Forward -51 -37 -3.34366 0.291
NP_440888.1_2 Forward -47 -33 15.1419 0.0122
NP_440888.1_2 Reverse -38 -52 15.1419 0.0122
NP_442277.1_4 Reverse -29 -48 2.06362 0.256
NP_441543.1_2 Reverse -39 -48 16.9127 0.00359
NP_441543.1_2 Forward -46 -37 15.9293 0.00518
NP_442845.1_2 Forward -53 -39 5.89945 0.22
NP_441551.1_5 Forward -51 -35 6.44936 0.269
NP_442710.1_7 Reverse -166 -185 1.61936 0.169
NP_441469.1_8 Reverse -37 -46 6.5879 0.227
NP_441469.1_8 Forward -48 -39 6.48957 0.227
NP_443064.1_6 Reverse -38 -48 12.5669 0.0796
NP_443064.1_6 Forward -47 -37 10.8217 0.13
NP_442337.1_8 Reverse -238 -257 1.57275 0.237
NP_442578.1_7 Forward -46 -39 14.5921 0.026
NP_442578.1_7 Reverse -39 -46 14.5921 0.026
NP_440710.1_1 Reverse -30 -48 1.49411 0.135
NP_441462.1_2 Forward -47 -37 20.2362 0.000805
NP_441462.1_2 Reverse -38 -48 11.5831 0.00406
NP_441621.1_7 Forward -49 -35 -5.21195 0.248
NP_443062.1_1 Forward -47 -29 16.3465 0.031
NP_443062.1_1 Reverse -38 -56 10.4961 0.116
NP_443062.1_6 Reverse -247 -266 5.30933 0.206
NP_443062.1_6 Forward -55 -36 1.67108 0.271
NP_441410.1_3 Reverse -29 -48 11.2092 0.185
NP_442204.1_1 Reverse -34 -45 11.3667 0.0565
NP_442204.1_2 Reverse -28 -47 10.8159 0.223
NP_442780.1_3 Forward -69 -50 6.73176 0.269
NP_440454.1_2 Reverse -146 -160 10.4202 0.291
NP_440516.1_2 Forward -53 -35 -2.14413 0.298
NP_440516.1_8 Forward -47 -38 16.9127 0.00442
NP_440516.1_8 Reverse -38 -47 16.9127 0.00442
NP_442428.1_5 Forward -46 -39 15.8704 0.0124
NP_442428.1_5 Reverse -39 -46 15.8704 0.0124
NP_440673.1_3 Forward -45 -38 12.4288 0.0426
NP_440673.1_3 Reverse -40 -47 12.4288 0.0426
NP_440673.1_3 Reverse -257 -264 7.51227 0.252
NP_441052.1_2 Reverse -38 -48 19.9412 0.00106
NP_441052.1_2 Forward -47 -37 10.4031 0.0285
NP_442219.1_9 Reverse -39 -48 17.7976 0.00718
NP_442219.1_9 Forward -46 -37 8.25953 0.0681
NP_440436.1_4 Reverse -39 -48 17.2072 0.00233
NP_440436.1_4 Forward -46 -37 9.24241 0.0871
NP_442086.1_3 Forward -46 -27 5.70265 0.288
NP_440314.1_9 Reverse -39 -58 10.0292 0.0293
NP_441719.1_4 Forward -46 -39 16.3621 0.0124
NP_441719.1_4 Reverse -39 -46 16.3621 0.0124
NP_442813.1_4 Forward -318 -299 -3.93378 0.296
NP_442366.1_3 Forward -265 -247 -1.35749 0.211
NP_442366.1_7 Forward -269 -251 15.7521 0.241
NP_441115.1_4 Forward -48 -30 10.3431 0.181
NP_441115.1_4 Reverse -37 -55 8.57317 0.244
NP_440728.1_1 Reverse -145 -164 14.2566 0.216
NP_441851.1_10 Forward -48 -38 15.8113 0.00552
NP_441851.1_10 Reverse -37 -47 8.53483 0.114
NP_441555.1_5 Forward -72 -53 15.6332 0.245
NP_442011.1_1 Forward -48 -29 6.09597 0.186
NP_442515.1_1 Reverse -37 -51 11.701 0.0388
NP_442515.1_1 Forward -48 -34 -4.7203 0.298
NP_441396.1_5 Reverse -338 -347 8.25953 0.224
NP_441982.1_6 Reverse -54 -63 12.6763 0.274
NP_440463.1_8 Reverse -260 -279 7.98396 0.264
NP_440165.1_5 Forward -48 -29 1.27776 0.128
NP_442709.1_3 Forward -54 -35 7.86593 0.121
NP_442709.1_4 Forward -185 -166 8.65445 0.161
NP_441046.1_2 Forward -58 -39 1.17943 0.26
NP_442689.1_8 Forward -161 -144 -5.27103 0.27
NP_441349.1_10 Reverse -28 -47 0.786102 0.0864
NP_441409.1_6 Forward -53 -34 2.3594 0.0584
NP_441394.1_1 Forward -317 -303 16.5192 0.271
NP_440389.1_3 Reverse -264 -283 15.2408 0.186
NP_440432.1_9 Forward -46 -31 -3.06836 0.179
NP_440432.1_9 Reverse -39 -54 -4.93665 0.228
NP_442843.1_6 Forward -63 -44 2.16274 0.29
NP_441124.1_5 Forward -168 -158 13.3901 0.215
NP_441124.1_5 Reverse -55 -65 12.4352 0.221
NP_441124.1_5 Forward -71 -61 10.0479 0.298
NP_440431.1_3 Reverse -37 -56 3.24438 0.0923
NP_441031.1_1 Reverse -165 -184 8.17242 0.25
NP_442243.1_1 Reverse -239 -257 6.01657 0.178
NP_441570.1_1 Forward -47 -29 -1.65248 0.0583
NP_440078.1_10 Forward -337 -318 2.85105 0.269
NP_441078.1_4 Forward -47 -38 19.6659 0.0007
NP_441078.1_4 Reverse -38 -47 19.6659 0.0007
NP_442729.1_8 Forward -51 -38 10.639 0.125
NP_441663.1_8 Reverse -32 -51 4.12936 0.169
NP_442348.1_2 Forward -326 -317 8.25953 0.28
NP_440526.1_3 Reverse -39 -50 1.04151 0.267
NP_441432.1_8 Reverse -37 -46 16.8143 0.00595
NP_441432.1_8 Forward -48 -39 16.8143 0.00595
NP_441432.1_9 Forward -62 -49 9.18011 0.28
NP_441432.1_9 Forward -169 -156 8.79228 0.287
NP_442320.1_8 Forward -53 -39 -2.36035 0.0871
NP_441732.1_2 Reverse -34 -50 -6.7263 0.0495
NP_441732.1_2 Forward -28 -12 -17.2477 0.247
NP_440629.1_4 Reverse -45 -64 11.7992 0.217
NP_442003.1_4 Reverse -39 -58 9.24257 0.3
NP_440760.1_1 Reverse -38 -57 -2.75381 0.0332
NP_442510.1_5 Forward -56 -37 12.9791 0.248
NP_440913.1_1 Forward -49 -31 8.47561 0.183
NP_442727.1_1 Forward -314 -300 10.6193 0.297
NP_442400.1_10 Reverse -50 -63 9.99293 0.269
NP_440713.1_4 Reverse -28 -47 7.86593 0.174
NP_442489.1_2 Forward -259 -240 1.67108 0.285
NP_442489.1_7 Forward -47 -38 20.1576 0.000695
NP_442489.1_7 Reverse -38 -47 20.1576 0.000695
NP_442489.1_7 Reverse -255 -264 -1.77023 0.247
NP_442489.1_7 Forward -24 -15 -1.86856 0.259
NP_442079.1_7 Reverse -39 -58 4.71934 0.187
NP_442079.1_7 Forward -46 -27 2.3594 0.229
NP_440559.1_1 Reverse -39 -48 17.4043 0.00658
NP_440559.1_1 Forward -46 -37 8.65285 0.0586
NP_441659.2_8 Forward -47 -37 20.9245 0.000805
NP_441659.2_8 Reverse -38 -48 18.1713 0.00133
NP_440426.1_7 Reverse -28 -47 3.14605 0.207
NP_440860.1_8 Forward -324 -305 13.9625 0.296
NP_442913.1_10 Reverse -29 -48 4.52268 0.0864
NP_439956.1_7 Forward -53 -34 3.83436 0.257
NP_442008.1_2 Forward -50 -31 5.89931 0.223
NP_440708.1_6 Reverse -235 -254 -5.70374 0.234
NP_441800.1_10 Forward -270 -251 0.196116 0.293
NP_442776.1_1 Forward -58 -39 2.94938 0.294
NP_442346.1_5 Forward -48 -38 16.6963 0.00248
NP_442346.1_5 Reverse -37 -47 16.303 0.00248
NP_442346.1_5 Forward -265 -255 10.5014 0.0934
NP_442346.1_10 Reverse -228 -247 -2.45882 0.294
NP_440545.1_3 Reverse -34 -51 -1.43612 0.168
NP_440545.1_3 Forward -51 -34 -4.58271 0.229
NP_441856.1_3 Reverse -12 -31 5.99764 0.124
NP_441856.1_3 Forward -50 -31 3.83436 0.17
NP_441856.1_3 Reverse -35 -54 1.67108 0.212
NP_440025.1_3 Reverse -290 -304 12.4502 0.269
NP_440025.1_3 Reverse -229 -243 10.0299 0.29
NP_440486.1_6 Forward -238 -219 6.88262 0.278
NP_440250.1_4 Forward -195 -176 2.9486 0.277
NP_441653.1_2 Reverse -27 -46 9.81081 0.141
NP_442603.1_7 Reverse -38 -52 16.9119 0.0273
NP_440449.1_6 Reverse -113 -131 6.31057 0.255
NP_441948.1_4 Reverse -31 -49 4.73903 0.0894
NP_441358.1_2 Forward -282 -263 6.19431 0.275
NP_441833.1_4 Forward -46 -39 15.9687 0.0124
NP_441833.1_4 Reverse -39 -46 15.9687 0.0124
NP_442162.1_9 Forward -46 -39 16.2637 0.0124
NP_442162.1_9 Reverse -39 -46 16.2637 0.0124
NP_443015.1_8 Reverse -89 -103 17.4247 0.235
NP_440671.1_1 Forward -178 -159 3.73847 0.296
NP_440671.1_4 Reverse -249 -263 7.37441 0.219
NP_440224.1_1 Reverse -27 -46 9.0459 0.0617
NP_441973.1_6 Forward -172 -154 15.6609 0.27
NP_442943.1_1 Reverse -158 -173 15.8342 0.0725
NP_442943.1_1 Reverse -51 -66 10.6662 0.184
NP_442943.1_1 Forward -66 -51 4.54118 0.231
NP_442199.1_5 Reverse -30 -49 -0.0988766 0.175
NP_442140.1_3 Reverse -39 -49 10.3048 0.0902
NP_442140.1_3 Forward -46 -36 4.69992 0.238
NP_441609.1_1 Forward -65 -46 0.884433 0.205
NP_440875.1_9 Forward -45 -35 16.5483 0.0145
NP_441813.1_5 Reverse -36 -46 18.1713 0.00743
NP_441813.1_5 Forward -49 -39 18.1713 0.00743
NP_440594.1_8 Reverse -39 -52 12.2117 0.152
NP_440590.1_4 Reverse -39 -52 11.7207 0.0187
NP_440590.1_4 Forward -46 -33 -5.38892 0.277
NP_440567.1_1 Forward -46 -32 9.83269 0.0414
NP_442497.1_10 Forward -46 -37 17.601 0.00813
NP_442497.1_10 Reverse -39 -48 10.4228 0.0087
NP_440821.1_4 Forward -49 -39 9.41981 0.0286
NP_440821.1_4 Reverse -36 -46 2.24165 0.131
NP_441239.1_9 Reverse -36 -48 13.0187 0.0389
NP_441239.1_9 Forward -49 -37 5.25052 0.223
NP_440624.1_5 Forward -173 -155 6.60692 0.298
NP_442044.1_1 Reverse -33 -52 -14.0619 0.283
NP_440219.1_1 Forward -172 -153 13.2234 0.255
NP_442643.1_1 Forward -53 -34 -11.7019 0.231
NP_440833.1_6 Reverse -231 -245 13.9619 0.157
NP_440833.1_6 Reverse -57 -71 9.53707 0.261
NP_440876.1_5 Reverse -40 -59 8.55425 0.277
NP_442138.1_1 Forward -263 -244 5.99684 0.24
NP_442138.1_10 Forward -47 -28 1.86774 0.12
NP_442809.1_6 Reverse -82 -101 3.83436 0.256
NP_440546.1_4 Forward -47 -37 13.5365 0.0459
NP_440546.1_4 Reverse -38 -48 10.046 0.109
NP_440462.1_6 Reverse -36 -46 18.7612 0.00454
NP_440462.1_6 Forward -49 -39 9.61647 0.0429
NP_442611.1_1 Forward -47 -28 5.40766 0.179
NP_440868.1_4 Reverse -34 -46 15.0836 0.0164
NP_440868.1_4 Forward -51 -39 9.97041 0.0405
NP_441497.1_5 Forward -223 -204 18.1493 0.248
NP_442479.1_5 Forward -65 -46 10.7488 0.222
NP_441848.1_4 Reverse -146 -162 11.4658 0.224
NP_441848.1_4 Forward -223 -207 8.79206 0.288
NP_441848.1_4 Reverse -75 -91 8.79206 0.288
NP_441848.1_5 Forward -170 -151 14.9314 0.214
NP_441084.1_6 Reverse -36 -50 13.4163 0.133
NP_442882.1_7 Reverse -31 -45 10.9137 0.272
NP_442039.1_4 Forward -46 -39 15.1821 0.0124
NP_442039.1_4 Reverse -39 -46 15.1821 0.0124
NP_442039.1_7 Reverse -52 -62 11.8781 0.257
NP_442039.1_7 Forward -255 -245 6.8632 0.292
NP_442837.1_3 Forward -46 -39 15.7721 0.0124
NP_442837.1_3 Reverse -39 -46 15.7721 0.0124
NP_440160.1_5 Reverse -42 -52 15.0242 0.267
NP_442053.1_1 Forward -47 -38 18.3876 0.0007
NP_442053.1_1 Reverse -38 -47 18.3876 0.0007
NP_440505.1_3 Forward -49 -39 18.3679 0.00213
NP_440505.1_3 Reverse -36 -46 17.188 0.00332
NP_441203.1_1 Forward -46 -27 -14.8485 0.205
NP_442532.1_3 Forward -167 -148 15.8609 0.294
NP_442532.1_4 Forward -173 -155 9.12842 0.273
NP_441576.1_10 Forward -77 -58 12.1925 0.289
NP_440914.1_1 Reverse -38 -48 17.5935 0.000537
NP_440914.1_1 Forward -47 -37 16.3248 0.00196
NP_441011.1_8 Forward -46 -37 16.6177 0.00602
NP_441011.1_8 Reverse -39 -48 8.25953 0.144
NP_442533.1_6 Forward -47 -38 17.2076 0.00137
NP_442533.1_6 Reverse -38 -47 17.2076 0.00137
NP_441482.1_7 Reverse -32 -46 -2.85201 0.1
NP_441482.1_7 Forward -41 -27 -10.8168 0.216
NP_441482.1_7 Forward -53 -39 -12.3901 0.295
NP_439944.1_9 Reverse -39 -49 10.5014 0.0887
NP_439944.1_9 Forward -46 -36 9.12481 0.1
NP_442597.1_9 Forward -166 -147 15.7065 0.284
NP_441697.1_5 Forward -174 -155 -8.54695 0.263
NP_441697.1_5 Forward -173 -154 -9.02441 0.268
NP_441697.1_5 Reverse -166 -185 -11.4117 0.295
NP_441028.1_6 Forward -149 -139 4.89613 0.275
NP_442202.1_6 Reverse -144 -163 -1.27885 0.272
NP_440116.1_8 Forward -46 -27 1.67108 0.0915
NP_440116.1_8 Reverse -39 -58 -5.99873 0.2
NP_441527.1_4 Forward -231 -212 -9.97933 0.263
NP_441527.1_4 Reverse -144 -163 -12.1756 0.285
NP_441527.1_4 Reverse -153 -172 -12.6531 0.292
NP_441527.1_4 Reverse -143 -162 -13.0351 0.298
NP_441527.1_5 Reverse -36 -55 12.4059 0.297
NP_440115.1_6 Reverse -35 -45 14.0414 0.0615
NP_440115.1_6 Forward -50 -40 6.76487 0.167
NP_440115.1_6 Forward -267 -257 4.79825 0.282
NP_440007.1_9 Reverse -34 -48 7.17775 0.213
NP_441602.1_3 Forward -52 -33 -4.22878 0.261
NP_441972.1_5 Forward -46 -27 -4.6221 0.211
NP_441972.1_5 Reverse -39 -58 -6.29373 0.229
NP_441972.1_5 Reverse -27 -46 -8.45701 0.265
NP_441106.1_1 Reverse -37 -46 18.486 0.0028
NP_441106.1_1 Forward -48 -39 9.63616 0.0311
NP_439903.1_6 Reverse -252 -271 0.785326 0.256
NP_442928.1_6 Forward -254 -241 18.4072 0.247
NP_442306.1_10 Reverse -33 -52 -20.2567 0.202
NP_441286.1_1 Forward -48 -36 5.93884 0.0258
NP_441286.1_1 Reverse -37 -49 3.48056 0.0467
NP_442674.1_1 Reverse -47 -66 14.6387 0.204
NP_442674.1_2 Forward -71 -52 7.96426 0.262
NP_442674.1_3 Reverse -32 -51 2.26028 0.3
NP_440670.1_8 Forward -47 -38 18.3876 0.000699
NP_440670.1_8 Reverse -38 -47 18.3876 0.000699
NP_440670.1_8 Reverse -255 -264 3.44131 0.267
NP_441479.1_1 Forward -50 -31 7.7676 0.278
NP_442908.1_8 Reverse -272 -291 15.3391 0.221
NP_440886.1_7 Reverse -37 -47 8.04271 0.0805
NP_440886.1_7 Forward -48 -38 7.94438 0.0805
NP_442614.1_2 Reverse -38 -52 9.04604 0.242
NP_442614.1_2 Forward -47 -33 8.25939 0.255
NP_442072.1_9 Forward -48 -30 -11.5839 0.0789
NP_440513.1_4 Forward -47 -28 8.75091 0.295
NP_439899.1_1 Forward -179 -161 3.79798 0.284
NP_439899.1_1 Forward -189 -171 3.31129 0.3
NP_440907.2_8 Forward -46 -36 9.616 0.103
NP_441021.1_1 Reverse -39 -58 1.27776 0.0848
NP_441463.1_2 Forward -161 -143 2.10063 0.242
NP_441463.1_2 Forward -171 -153 1.04342 0.261
NP_441463.1_2 Forward -181 -163 -1.35932 0.293
NP_441463.1_3 Reverse -28 -47 -2.55715 0.156
NP_441463.1_3 Forward -57 -38 -8.55534 0.271
NP_441626.1_2 Forward -46 -39 15.7721 0.0124
NP_441626.1_2 Reverse -39 -46 15.7721 0.0124
NP_442365.1_7 Forward -51 -32 3.44104 0.156
NP_442794.1_1 Forward -51 -39 7.31547 0.142
NP_442615.1_1 Reverse -29 -47 20.5703 0.00395
NP_442615.1_1 Forward -56 -38 -4.99573 0.201
NP_440387.1_1 Forward -47 -31 -1.3181 0.142
NP_440387.1_1 Reverse -38 -54 -3.18639 0.156
NP_440387.1_1 Reverse -267 -283 -4.66135 0.194
NP_440387.1_1 Reverse -270 -286 -5.93965 0.258
NP_441431.1_2 Reverse -35 -49 6.68548 0.263
NP_441836.1_2 Reverse -32 -51 4.03102 0.147
NP_441836.1_2 Forward -53 -34 3.83436 0.147
NP_441836.1_2 Forward -282 -263 -4.22878 0.255
NP_442084.1_6 Reverse -180 -198 7.09898 0.221
NP_440467.1_3 Forward -46 -27 17.6042 0.0604
NP_440467.1_3 Reverse -27 -46 15.8463 0.114
NP_440114.1_10 Forward -47 -33 9.04604 0.186
NP_440114.1_10 Forward -130 -116 8.45605 0.202
NP_442437.1_8 Forward -46 -27 4.916 0.256
NP_442087.1_2 Reverse -38 -57 13.2118 0.257
NP_440293.1_3 Forward -250 -231 -4.81876 0.265
NP_440766.1_5 Reverse -53 -65 15.0087 0.193
NP_442743.1_4 Forward -46 -27 -3.3438 0.227
NP_441311.1_2 Reverse -32 -46 14.1586 0.229
NP_442930.1_1 Reverse -155 -165 16.9908 0.19
NP_442930.1_1 Reverse -101 -111 10.4026 0.276
NP_442930.1_1 Reverse -59 -69 9.81266 0.28
NP_439910.1_2 Forward -55 -38 -12.8425 0.103
NP_442867.1_8 Forward -256 -237 9.14423 0.227
NP_440457.1_1 Reverse -34 -46 10.2654 0.092
NP_440457.1_1 Forward -51 -39 -0.74767 0.273
NP_440987.1_4 Reverse -144 -163 13.0775 0.143
NP_440798.1_6 Forward -46 -33 10.8357 0.0721
NP_442297.1_4 Reverse -34 -53 14.9613 0.181
NP_441332.1_4 Reverse -154 -173 15.9291 0.149
NP_441332.1_4 Reverse -47 -66 14.4541 0.149
NP_440473.1_1 Reverse -35 -54 15.2101 0.124
NP_442509.1_9 Reverse -38 -48 8.14104 0.192
NP_442509.1_9 Forward -47 -37 8.04271 0.192
NP_442509.1_9 Reverse -255 -265 7.35439 0.225
NP_441489.1_3 Reverse -53 -67 10.4202 0.232
NP_442514.1_5 Reverse -30 -49 -5.70449 0.261
NP_440554.1_4 Forward -46 -36 17.9746 0.0131
NP_440554.1_4 Reverse -39 -49 8.92815 0.0646
NP_441845.1_6 Forward -59 -41 0.0191479 0.274
NP_441885.1_5 Reverse -38 -48 20.9245 0.000538
NP_441885.1_5 Forward -47 -37 11.3864 0.00668
NP_441885.1_5 Forward -276 -266 -1.78992 0.284
NP_440628.1_3 Reverse -56 -70 15.4376 0.262
NP_440478.1_4 Forward -39 -20 10.0292 0.293
NP_440478.1_10 Reverse -36 -50 6.6861 0.288
NP_442341.1_7 Forward -265 -251 5.30946 0.162
NP_441173.1_9 Forward -62 -54 13.2937 0.17
NP_440750.1_5 Reverse -144 -158 4.81781 0.294
NP_443000.1_7 Reverse -36 -46 20.3345 0.00223
NP_443000.1_7 Forward -49 -39 19.9412 0.00223
NP_440275.1_3 Reverse -36 -46 16.1063 0.0155
NP_440275.1_3 Forward -49 -39 15.123 0.0182
NP_441359.1_5 Forward -267 -248 2.0644 0.28
NP_441207.1_7 Reverse -144 -158 11.9662 0.241
NP_441207.1_7 Reverse -57 -71 8.96496 0.282
NP_440175.1_7 Reverse -335 -353 10.339 0.257
NP_441105.1_3 Reverse -27 -46 -6.98204 0.243
NP_440216.1_1 Forward -47 -33 26.254 0.000481
NP_440216.1_1 Reverse -38 -52 -0.787057 0.0284
NP_440172.1_1 Forward -47 -37 17.5813 0.00421
NP_440172.1_1 Reverse -38 -48 15.0247 0.00945
NP_440172.1_1 Forward -35 -25 2.7333 0.268
NP_440172.1_1 Reverse -15 -25 2.63497 0.274
NP_442015.1_10 Reverse -34 -47 3.75586 0.178
NP_442015.1_10 Forward -51 -38 2.67422 0.187
NP_441226.1_7 Forward -46 -39 14.4934 0.0123
NP_441226.1_7 Reverse -39 -46 14.4934 0.0123
NP_441757.1_3 Forward -48 -29 3.6377 0.155
NP_441111.1_7 Forward -46 -38 18.7023 0.00294
NP_441111.1_7 Reverse -39 -47 18.7023 0.00294
NP_442379.1_10 Reverse -31 -48 0.137172 0.223
NP_441766.1_2 Forward -47 -38 17.5026 0.00297
NP_441766.1_2 Reverse -38 -47 17.5026 0.00297
NP_442417.1_5 Forward -47 -33 4.52282 0.292
NP_440416.1_9 Reverse -31 -50 3.34271 0.0375
NP_440416.1_9 Forward -42 -23 -16.9135 0.226
NP_442116.1_6 Reverse -145 -162 11.4157 0.198
NP_442116.1_6 Reverse -147 -164 6.06813 0.287
NP_442154.1_1 Reverse -253 -271 -16.2055 0.236
NP_440261.1_5 Forward -46 -33 6.60746 0.0318
NP_440261.1_5 Reverse -39 -52 5.03416 0.0478
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TGATGTCGTAGTTAGTCCAAAAAACGTAGCTCATCAAAACAAAATCCGCTAGACCCACACCAAGGGCATACCAGCGGACTTGTTTCCCGTCTTTGTCGGGAATTAACGGAATGAAGAGGGCGGCGACTAACGGCAGGGCAATCATCGTTGTCAGCCAGGGGAAGTGTTCCAACATGGTAATAAGAATAAATACCTAGTGATCTTCCTCCGATTATATTAAACTTTGTAAACTTTTGAGAATTTTTTTTGAGATTTTCCCTATAGAAGTCAGAGAATGGGCTCTATCCATGTGAATAAGTTCTTTGACCTAGGTTTTTCCTCGCCTAACCTTGTTAAATTTTTGCCAATTTTCTGGCGATCGCCTGGCGGATCTCTAGGAGATTACCAGTAGAATTCGGCT

CDS

ATGTTTGACAATCTCTGCAAATTCCTCGCTGAATCCTTTTCCGAAGACTATGCCGCCTGGTTACTGGGACGACCCATTAAATTGACTAAGCTGAGTCCGACGGAACTATCTTTGGAGCCAATTCGGGCTGACTCTCTGATTTTGGAGCAATCGGAAGACTTGGTGTTGCATCTGGAATTCCAAACGGAGCCTGACCCCACCATGGGCTTTCGGATGTTGGACTATCGGGTAAGGGTTTATCGCCGTTTCCCCCAGAAGACGATGCACCAATTTGTCATCTACCTGAAACGTAGTAACAATGACTTGGTTTATCAGGATAGTTTTCAGTTGGGAGAGACTGTGCACCGTTACCAAGCGATCCGGCTCTGGGAGCACCCCTCGGAGATATTCCTCCAAAGCCCAGGGCTATTGCCCCTAGCGGTATTGACGCAGACCTCTGACCCTACATTAAAATTGAGGGAAGTGGCGACTGCATTGGAACAGATTGAAGATAATCGAGTTAAGGCAAATCTCATGGCGGCAACCTCTGTTTTTGGAGGAATTCTGCTGACCCCTGAGCTGATCAAGACAATTCTAAGGAGTGAAATTATGAAGGAATCCGCTGTTTATCAGGAAATTCTACAGGAAGGGGAACAAAGAGGCTTACTTAAAGGCAAATTAGAAGGAAGGCTGGAGGCAAAACTAGAAACTATACCTTTGTTGAAAAAATTGGGGTTGACAATCGCCGAAATTGCCAAGGAGTTAGATATTGATGTTGAACTGGTTAATCGGTTTGTTGCTAACCAAAACAACTAA

Protein

MFDNLCKFLAESFSEDYAAWLLGRPIKLTKLSPTELSLEPIRADSLILEQSEDLVLHLEFQTEPDPTMGFRMLDYRVRVYRRFPQKTMHQFVIYLKRSNNDLVYQDSFQLGETVHRYQAIRLWEHPSEIFLQSPGLLPLAVLTQTSDPTLKLREVATALEQIEDNRVKANLMAATSVFGGILLTPELIKTILRSEIMKESAVYQEILQEGEQRGLLKGKLEGRLEAKLETIPLLKKLGLTIAEIAKELDIDVELVNRFVANQNN