Your browser is old and dusty. Try Google Chrome!

Details for sll1200

ORF sll1200
Accession NP_440159.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441418.1_6 Reverse -260 -279 -18.8801 0.0839
NP_441418.1_6 Forward -301 -282 -22.6167 0.182
NP_441418.1_6 Reverse -280 -299 -30.7781 0.296
NP_441453.1_4 Reverse -91 -99 5.13263 0.179
NP_442151.1_6 Forward -100 -86 9.63603 0.142
NP_442182.1_3 Reverse -74 -93 2.16274 0.264
NP_441818.1_9 Reverse -254 -273 -8.65367 0.279
NP_441818.1_9 Reverse -377 -396 -10.0303 0.292
NP_442287.1_1 Forward -358 -348 13.3526 0.277
NP_441745.1_3 Forward -354 -335 18.8781 0.201
NP_440784.1_7 Forward -268 -261 6.43063 0.218
NP_442062.1_3 Reverse -176 -195 1.37609 0.23
NP_441859.1_3 Forward -263 -244 2.55527 0.258
NP_440044.1_8 Reverse -68 -87 -3.54046 0.286
NP_441492.1_5 Reverse -173 -192 7.11289 0.237
NP_439918.1_2 Forward -22 -3 3.14605 0.188
NP_439918.1_2 Reverse -254 -273 2.3594 0.207
NP_439918.1_2 Forward -247 -228 1.27776 0.217
NP_439918.1_2 Reverse -376 -395 -5.21209 0.298
NP_441352.1_2 Forward -217 -198 7.17762 0.173
NP_441210.1_3 Reverse -10 -29 12.8808 0.259
NP_441208.1_9 Reverse -88 -102 6.19444 0.253
NP_441594.1_6 Reverse -82 -101 0.392778 0.287
NP_440370.1_10 Reverse -82 -101 6.4893 0.291
NP_442742.1_9 Forward -325 -306 -5.21209 0.221
NP_442110.1_7 Forward -100 -86 -0.295402 0.281
NP_441925.1_4 Forward -291 -272 -17.5041 0.296
NP_442827.1_8 Forward -325 -306 0.392004 0.21
NP_441738.1_2 Forward -32 -25 8.29857 0.176
NP_442111.1_4 Forward -101 -87 7.9644 0.0826
NP_441533.1_7 Forward -350 -332 18.3079 0.188
NP_440343.1_3 Forward -273 -255 2.96833 0.285
NP_440832.1_10 Forward -167 -148 19.3707 0.0504
NP_441209.1_8 Forward -154 -136 9.89671 0.217
NP_441209.1_8 Forward -78 -60 9.89671 0.217
NP_442634.1_4 Reverse -89 -103 -5.01529 0.228
NP_442634.1_4 Reverse -258 -272 -5.50694 0.258
NP_440470.1_5 Forward -201 -182 11.3154 0.177
NP_440842.1_4 Forward -193 -174 15.1137 0.0343
NP_443017.1_1 Forward -192 -173 14.5434 0.274
NP_441014.1_9 Forward -320 -301 6.4893 0.234
NP_441012.1_4 Forward -296 -283 10.344 0.262
NP_441634.1_8 Reverse -278 -292 -2.85201 0.295
NP_440376.1_1 Forward -100 -91 4.0313 0.182
NP_440376.1_1 Reverse -369 -378 0.491382 0.273
NP_441797.1_7 Reverse -210 -228 10.7372 0.286
NP_442485.1_2 Forward -170 -151 11.4058 0.288
NP_442958.1_3 Reverse -272 -291 -2.26216 0.293
NP_440642.1_10 Reverse -212 -226 11.7987 0.144
NP_440360.1_10 Reverse -216 -230 2.16287 0.27
NP_440141.1_8 Forward -232 -213 7.96426 0.232
NP_442782.1_2 Reverse -337 -351 2.65453 0.275
NP_441414.1_9 Forward -378 -359 -0.197208 0.0875
NP_439968.1_8 Reverse -262 -278 12.8416 0.285
NP_441487.1_7 Reverse -136 -155 7.96426 0.238
NP_441478.1_6 Forward -278 -259 13.6666 0.191
NP_441958.1_5 Forward -101 -91 -0.609952 0.215
NP_439905.1_1 Forward -274 -261 9.45906 0.219
NP_440984.1_7 Reverse -364 -378 7.66941 0.166
NP_441097.1_2 Reverse -339 -356 11.2486 0.193
NP_442376.1_6 Forward -169 -150 -2.36049 0.295
NP_442690.1_1 Forward -202 -183 -11.8003 0.233
NP_442911.1_2 Forward -240 -221 -9.93197 0.267
NP_440993.1_4 Reverse -221 -238 5.15205 0.263
NP_440138.1_1 Forward -275 -257 8.08151 0.214
NP_442002.1_1 Reverse -339 -357 -8.33898 0.264
NP_441294.1_7 Forward -360 -346 8.77068 0.281
NP_441424.1_2 Reverse -176 -195 11.5064 0.186
NP_441646.1_1 Reverse -348 -367 7.96426 0.152
NP_441550.1_8 Reverse -89 -99 6.86274 0.188
NP_441916.1_10 Forward -225 -206 3.04771 0.236
NP_440569.1_10 Forward -210 -191 5.58586 0.237
NP_442004.1_6 Forward -363 -349 3.24451 0.244
NP_439966.1_9 Reverse -263 -272 3.7363 0.253
NP_440260.1_7 Forward -208 -189 -5.60541 0.271
NP_441514.1_4 Reverse -180 -199 13.1825 0.269
NP_441678.1_1 Reverse -174 -193 19.8142 0.154
NP_441334.1_7 Forward -102 -83 -3.73712 0.112
NP_440177.1_1 Forward -90 -72 6.01734 0.272
NP_440437.1_1 Forward -352 -333 -3.83545 0.246
NP_442068.1_1 Forward -213 -194 4.03102 0.27
NP_441644.1_6 Reverse -91 -101 6.86274 0.144
NP_442029.1_1 Reverse -335 -354 -10.6203 0.221
NP_440929.1_8 Reverse -91 -100 4.81794 0.176
NP_442554.1_8 Forward -99 -89 7.64985 0.0853
NP_442142.1_4 Forward -349 -336 10.4418 0.0724
NP_442142.1_4 Forward -272 -259 2.47701 0.29
NP_442292.1_2 Forward -198 -184 17.7794 0.248
NP_441726.1_7 Reverse -17 -36 9.53756 0.147
NP_442301.1_2 Forward -279 -260 5.60352 0.263
NP_440279.1_6 Forward -237 -218 4.52268 0.28
NP_441448.1_1 Forward -84 -65 12.9791 0.165
NP_441448.1_1 Forward -211 -192 6.39097 0.249
NP_441015.1_10 Reverse -332 -351 -5.60541 0.228
NP_441876.1_2 Reverse -177 -196 13.3725 0.268
NP_441764.1_4 Reverse -174 -191 16.0931 0.0893
NP_441764.1_4 Reverse -47 -64 10.9366 0.232
NP_441764.1_8 Reverse -189 -199 14.1818 0.284
NP_440789.1_1 Forward -193 -174 18.4848 0.0727
NP_442808.1_1 Forward -276 -266 4.40448 0.199
NP_440145.1_3 Reverse -81 -100 6.19431 0.0548
NP_442050.1_1 Reverse -276 -295 8.06259 0.255
NP_442050.1_5 Reverse -89 -99 10.9926 0.116
NP_442342.1_9 Forward -162 -146 2.22182 0.29
NP_441937.1_5 Reverse -215 -234 1.67108 0.278
NP_441114.1_1 Forward -351 -333 14.6697 0.279
NP_441114.1_3 Forward -147 -138 13.2744 0.231
NP_440558.1_2 Forward -278 -259 2.75272 0.165
NP_440558.1_2 Reverse -136 -155 -6.49039 0.275
NP_442789.1_4 Reverse -332 -351 -8.35868 0.299
NP_441878.1_6 Forward -161 -151 -0.118297 0.167
NP_441445.1_1 Reverse -338 -357 2.65439 0.233
NP_441445.1_1 Reverse -28 -47 1.96607 0.245
NP_441590.1_4 Forward -282 -263 4.91521 0.279
NP_442419.1_2 Forward -351 -332 -2.95047 0.247
NP_442469.1_7 Reverse -35 -54 12.8808 0.282
NP_442183.1_1 Reverse -91 -105 6.29277 0.18
NP_441459.1_3 Forward -278 -259 11.5225 0.283
NP_442888.1_6 Forward -357 -338 3.14605 0.244
NP_441037.1_4 Reverse -89 -99 8.29227 0.237
NP_442998.1_10 Forward -344 -337 4.16902 0.259
NP_440899.1_1 Forward -111 -92 5.67487 0.297
NP_441799.1_4 Forward -277 -258 -2.0655 0.203
NP_442802.1_10 Reverse -313 -332 18.9547 0.273
NP_440709.1_1 Forward -195 -176 2.16195 0.22
NP_441559.1_8 Forward -153 -139 -5.9986 0.271
NP_442302.1_6 Forward -213 -194 12.6841 0.27
NP_441704.1_2 Forward -52 -33 11.995 0.119
NP_441199.1_7 Reverse -173 -192 7.27595 0.184
NP_442993.1_1 Reverse -369 -385 -3.38305 0.13
NP_442993.1_1 Reverse -91 -107 -11.6429 0.255
NP_441340.1_5 Forward -99 -92 11.0522 0.0749
NP_440327.1_6 Reverse -377 -396 3.34271 0.285
NP_442506.1_9 Reverse -377 -396 8.25926 0.229
NP_442240.1_2 Reverse -338 -357 -19.8634 0.295
NP_441160.1_5 Reverse -26 -45 -6.58872 0.288
NP_440192.1_4 Reverse -263 -282 9.49463 0.276
NP_441262.1_3 Forward -100 -93 5.34899 0.181
NP_440027.1_3 Forward -356 -338 3.36165 0.273
NP_443051.1_1 Forward -101 -92 4.81794 0.105
NP_443051.1_1 Reverse -90 -99 -0.0986038 0.256
NP_440408.1_7 Reverse -139 -158 7.66927 0.284
NP_440372.1_2 Forward -99 -92 4.07068 0.262
NP_440171.1_3 Reverse -333 -352 1.76941 0.293
NP_440316.1_10 Forward -210 -200 12.6647 0.214
NP_439977.1_5 Reverse -288 -307 1.27776 0.195
NP_441877.1_9 Forward -68 -51 8.39697 0.228
NP_441018.1_7 Reverse -262 -281 6.19431 0.297
NP_440282.1_10 Forward -279 -260 -9.73531 0.288
NP_440531.1_6 Forward -347 -328 -5.01543 0.291
NP_440562.1_3 Forward -166 -149 4.3654 0.197
NP_440562.1_3 Forward -99 -82 4.16874 0.201
NP_441592.1_4 Forward -289 -270 -3.63879 0.286
NP_441896.1_3 Forward -109 -90 -1.7705 0.268
NP_441896.1_3 Forward -43 -24 -2.26216 0.28
NP_440894.1_10 Reverse -147 -166 4.42435 0.254
NP_441771.1_7 Forward -191 -172 12.4867 0.172
NP_442033.1_10 Forward -291 -272 -12.8819 0.277
NP_441543.1_5 Forward -83 -64 -2.36049 0.245
NP_441304.1_10 Reverse -23 -32 14.651 0.164
NP_443064.1_8 Reverse -291 -301 14.9258 0.29
NP_440071.1_1 Forward -276 -259 8.88789 0.274
NP_441462.1_2 Reverse -369 -379 4.99491 0.0764
NP_441462.1_2 Forward -100 -90 -1.10161 0.281
NP_441462.1_5 Reverse -334 -353 0.0977854 0.297
NP_441621.1_7 Reverse -335 -349 4.22782 0.0934
NP_441621.1_7 Reverse -275 -289 -6.19526 0.279
NP_441621.1_7 Forward -102 -88 -6.19526 0.279
NP_441601.1_4 Forward -350 -331 2.94938 0.206
NP_440519.1_8 Reverse -260 -276 6.35172 0.21
NP_440519.1_8 Reverse -334 -350 5.76173 0.21
NP_441351.1_8 Forward -291 -272 11.3075 0.141
NP_442487.1_2 Forward -54 -35 5.01354 0.232
NP_442780.1_1 Reverse -178 -197 16.2241 0.112
NP_440516.1_8 Reverse -369 -378 -0.295266 0.232
NP_441790.1_4 Reverse -147 -166 14.5524 0.268
NP_441867.1_2 Forward -309 -290 -13.9635 0.277
NP_440673.1_3 Forward -376 -369 8.8889 0.206
NP_441052.1_2 Forward -50 -40 -0.806614 0.299
NP_441884.1_9 Forward -235 -216 -13.9635 0.138
NP_441336.1_3 Reverse -79 -93 14.5526 0.298
NP_442864.1_3 Reverse -363 -382 11.5042 0.181
NP_440648.1_1 Reverse -308 -327 7.47261 0.189
NP_440648.1_1 Forward -378 -359 4.12936 0.231
NP_440041.1_2 Reverse -258 -277 5.70265 0.104
NP_442577.1_10 Reverse -106 -125 8.75009 0.216
NP_441004.1_4 Reverse -366 -376 8.92815 0.262
NP_442366.1_5 Reverse -351 -361 10.206 0.282
NP_441115.1_9 Reverse -333 -351 8.37728 0.288
NP_441115.1_9 Forward -89 -71 8.08229 0.288
NP_442206.1_10 Reverse -260 -275 2.24151 0.205
NP_441396.1_5 Reverse -387 -396 7.37455 0.279
NP_442689.1_8 Forward -198 -181 -5.36936 0.271
NP_441031.1_1 Forward -197 -178 19.8376 0.0396
NP_441031.1_1 Reverse -171 -190 8.07601 0.25
NP_439950.1_1 Reverse -24 -33 16.0277 0.145
NP_440023.1_5 Forward -171 -152 7.37428 0.228
NP_441570.1_1 Reverse -260 -278 -4.20908 0.0743
NP_441078.1_4 Reverse -91 -100 -1.47524 0.266
NP_442443.1_1 Reverse -273 -292 -6.39206 0.294
NP_441432.1_8 Reverse -90 -99 5.70292 0.144
NP_441432.1_8 Reverse -265 -274 2.65466 0.292
NP_442797.1_7 Forward -290 -272 -0.964162 0.291
NP_442274.1_8 Reverse -199 -217 12.9017 0.297
NP_441945.1_6 Forward -192 -173 12.3892 0.173
NP_441945.1_10 Reverse -259 -278 10.9142 0.238
NP_441945.1_10 Reverse -330 -349 6.98095 0.291
NP_441805.1_6 Reverse -284 -303 7.7676 0.292
NP_442353.1_4 Forward -88 -69 0.392004 0.272
NP_441072.1_2 Reverse -249 -268 6.19431 0.288
NP_440941.1_1 Reverse -346 -356 16.7946 0.241
NP_441659.2_8 Reverse -91 -101 4.89658 0.123
NP_441022.1_1 Forward -329 -320 12.3136 0.238
NP_441092.1_3 Reverse -147 -166 3.24438 0.183
NP_441800.1_1 Reverse -148 -167 21.2381 0.0913
NP_441800.1_7 Forward -280 -262 6.41066 0.158
NP_442346.1_1 Reverse -254 -273 9.63589 0.287
NP_442346.1_10 Reverse -263 -282 2.94938 0.194
NP_440352.1_5 Forward -228 -209 10.5143 0.272
NP_440545.1_3 Reverse -87 -104 -5.07437 0.24
NP_440459.1_2 Forward -225 -208 8.49531 0.259
NP_440010.1_3 Reverse -147 -166 -8.65367 0.299
NP_440170.1_6 Reverse -202 -221 11.6025 0.285
NP_441329.1_1 Forward -145 -126 10.265 0.194
NP_441044.1_4 Reverse -189 -207 1.88744 0.261
NP_440772.1_10 Reverse -180 -199 12.2267 0.253
NP_442140.1_3 Reverse -338 -348 7.15819 0.149
NP_442140.1_3 Reverse -215 -225 6.46988 0.168
NP_439901.1_2 Forward -54 -35 14.7483 0.254
NP_440590.1_4 Forward -99 -86 -5.68391 0.286
NP_442839.1_10 Forward -87 -73 13.6676 0.288
NP_441239.1_9 Forward -380 -368 4.75886 0.243
NP_441951.1_6 Reverse -157 -176 10.6192 0.248
NP_440156.1_4 Reverse -193 -203 13.2542 0.176
NP_442568.1_8 Reverse -180 -194 9.83269 0.257
NP_441892.1_1 Reverse -299 -316 -1.82945 0.214
NP_442044.1_1 Forward -100 -81 -14.7502 0.299
NP_442643.1_3 Reverse -331 -350 -1.86883 0.252
NP_442629.1_3 Reverse -249 -268 2.55606 0.275
NP_441541.1_1 Reverse -175 -193 13.0844 0.0795
NP_442216.1_4 Forward -33 -25 8.1805 0.255
NP_440876.1_5 Reverse -123 -142 13.4708 0.226
NP_440354.1_7 Reverse -238 -256 5.82068 0.297
NP_441617.1_6 Reverse -194 -213 -3.14714 0.264
NP_442138.1_10 Reverse -260 -279 6.98095 0.0716
NP_442052.1_6 Forward -277 -259 17.9146 0.184
NP_442052.1_8 Reverse -138 -148 12.6647 0.258
NP_441782.1_10 Forward -156 -142 15.5636 0.23
NP_440546.1_4 Reverse -337 -347 6.55553 0.291
NP_440462.1_6 Reverse -89 -99 6.66654 0.105
NP_442611.1_1 Forward -100 -81 -0.197208 0.266
NP_442479.1_5 Reverse -57 -76 9.30716 0.222
NP_441269.1_6 Reverse -259 -277 13.3922 0.208
NP_442402.1_4 Reverse -61 -80 -4.03287 0.22
NP_441084.1_6 Forward -271 -257 9.8289 0.263
NP_439942.1_7 Reverse -334 -353 -4.22878 0.248
NP_440843.1_3 Reverse -133 -152 8.94757 0.29
NP_442023.1_2 Forward -224 -205 15.8307 0.106
NP_442039.1_4 Forward -99 -92 8.59391 0.193
NP_442039.1_7 Forward -221 -211 10.0098 0.257
NP_442039.1_7 Forward -286 -276 6.76487 0.299
NP_442696.1_6 Forward -40 -21 -12.8819 0.253
NP_440160.1_1 Reverse -172 -191 27.1859 0.000386
NP_440160.1_9 Reverse -139 -158 18.9773 0.104
NP_441102.1_1 Reverse -254 -273 3.53937 0.286
NP_441102.1_10 Reverse -253 -272 7.66927 0.229
NP_442533.1_6 Forward -269 -260 2.458 0.255
NP_442533.1_6 Forward -378 -369 2.06468 0.275
NP_442533.1_6 Reverse -151 -160 1.57302 0.294
NP_442541.1_10 Forward -275 -261 3.44058 0.254
NP_443016.1_5 Reverse -291 -310 8.65176 0.195
NP_441482.1_7 Reverse -85 -99 6.6861 0.0269
NP_440816.1_2 Reverse -178 -197 5.56364 0.297
NP_440007.1_9 Reverse -87 -101 1.57289 0.285
NP_441602.1_3 Reverse -248 -267 -2.65548 0.235
NP_441602.1_4 Reverse -297 -316 8.55425 0.288
NP_442890.1_3 Forward -303 -284 17.2074 0.222
NP_441106.1_1 Reverse -368 -377 2.55633 0.28
NP_441106.1_7 Forward -52 -33 15.4366 0.205
NP_441825.1_4 Reverse -374 -384 11.9764 0.252
NP_439903.1_6 Reverse -88 -107 0.195343 0.268
NP_442674.1_1 Forward -75 -56 10.7556 0.261
NP_442674.1_3 Reverse -300 -319 2.45694 0.3
NP_440670.1_8 Forward -100 -91 5.3096 0.167
NP_440670.1_8 Reverse -91 -100 3.93297 0.212
NP_440205.1_3 Forward -157 -138 3.73603 0.285
NP_440513.1_6 Forward -170 -151 14.2566 0.189
NP_442213.1_5 Reverse -249 -268 -1.7705 0.293
NP_441753.1_10 Reverse -328 -347 1.27776 0.272
NP_441808.1_8 Reverse -251 -270 10.0292 0.242
NP_441463.1_3 Reverse -255 -274 -8.16202 0.266
NP_441626.1_2 Forward -99 -92 10.7572 0.0837
NP_442794.1_1 Forward -350 -338 5.05386 0.236
NP_440387.1_1 Forward -100 -84 2.22182 0.085
NP_442647.1_7 Forward -267 -254 6.60746 0.257
NP_441993.1_1 Reverse -337 -356 0.874656 0.29
NP_440143.1_9 Forward -200 -181 5.30853 0.126
NP_440114.1_10 Reverse -91 -105 12.4876 0.0814
NP_440114.1_10 Forward -346 -332 5.60446 0.3
NP_442323.1_7 Reverse -86 -105 5.50519 0.203
NP_441500.1_1 Forward -353 -335 14.0805 0.263
NP_440293.1_3 Reverse -341 -360 -2.0655 0.239
NP_440293.1_3 Reverse -143 -162 -5.99873 0.285
NP_439910.1_2 Forward -386 -369 -14.3175 0.183
NP_440798.1_6 Reverse -363 -376 1.29759 0.224
NP_440798.1_6 Forward -345 -332 0.412608 0.267
NP_441984.1_3 Reverse -327 -345 6.01734 0.276
NP_441436.1_8 Forward -293 -274 8.65258 0.279
NP_442582.1_8 Reverse -345 -363 5.32902 0.28
NP_440554.1_4 Reverse -92 -102 4.79825 0.175
NP_441761.1_7 Reverse -368 -387 17.0099 0.258
NP_441275.1_1 Forward -194 -176 1.49411 0.243
NP_442703.1_1 Reverse -176 -195 5.39487 0.283
NP_442341.1_9 Forward -271 -257 8.94708 0.162
NP_441756.1_5 Reverse -147 -166 -4.81876 0.296
NP_442451.1_2 Forward -42 -23 -3.14714 0.191
NP_441207.1_7 Reverse -130 -144 8.96496 0.282
NP_439962.1_4 Forward -90 -71 1.86774 0.197
NP_442373.1_2 Reverse -257 -276 1.27776 0.174
NP_442373.1_2 Reverse -331 -350 -0.0988766 0.19
NP_440216.1_9 Forward -221 -212 14.651 0.172
NP_441226.1_7 Forward -377 -370 8.59356 0.197
NP_441766.1_2 Forward -378 -369 1.67135 0.278
NP_443052.1_9 Forward -276 -257 -6.78538 0.289
NP_442116.1_2 Forward -84 -65 22.5164 0.0451
NP_440591.1_5 Forward -385 -366 13.3716 0.207
NP_442154.1_1 Reverse -258 -276 -13.0589 0.217
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGCCCCCACATCGAAAATAAAACCCCGTCGCCGAAAGGTGGATGCACAACCCCCCACTATGGCCGCCTGTTCATAAACTTTGACTCGATAACCCTGTTGGGCTAACAGGGCCGCCGTTGTCAGACCACCAATGCCAGCACCAATTACAACTACGGATTGAGATTCAGCATTGCTAGGGACCATGGGAAAAGGACAGTGGGGAAATTTTCTTTACATTTCTTAATGTAACTGGTTGCAACGGTTCCTGGCCCAGGCATTGTTCAAGATTCTGTCAATAGTCAATTGATTTGGTGGAGTAAATGCGATAGGCTCGGCTCCAACAGTGGCAAGCATTGGTAAATAGTTTTCAACGTTAACAACAGCAACTTAAATCCCCCTTGAATAGGATTTGGAATTACCC

CDS

ATGGGTCAGTATTCTGCGGTTCTGTGGCGGCGGGTTTGGGGCATTGCCTTGGTTCAGGGCTCAGTAACTTTGATGTGGATAACTTACCGCCTTTACCTGGGGGACTTGCTCAAGGGCTGGGGATTCTCGCCGGAGTTTGTGGTGGGATTGCTAACCTTTGAAATGGTTTTGGGGGTGGTGATGGAACCTCTCTTTGGGGCCCTGAGCGATCGCCAACAGCAAAATTTAGGCACTCGATTCCCATTAATTTCCTTGGGGGTGATTCTCGCCGCCGGTTTTTTCCTCTTAATTCCCTTAGTATTTTTCCTGCCCATTGCCAACGTAGCTCGGTTCTTACTCCCCAGCCTGGCGATCGCCTGGGCCATAGCTATGACCTTATTTCGTAGTCCCACCATGGTGCTGATTGGTCAATGTGCGCCAACCAACCAACTGCCTTTAGCCATGGGAGTTTTGAGTTTGGTGGGAGGGATAGTTGCTACATTTCGGCAACCGATGGGTAAGTGGTTATTAAGTTTGGGGAGTTTACCAGCTTTTTTACTCGGTTCAGTAGTGCTATTGGGGGCCAGCCTATTTTTAAGTCGAGTTTTACCACCAATTGAAAAGAAAGAGGCAATAAGTCCGGCAACGGTGAGAGCTTTTCCTTGGATTGCCATGGTCAATATTGCTCTATTTGCCATTGGCACCACCTGGGGCACTAGGGTGTTAATGCTAGTTTTAACCAAACAATTGGAGGGAATTAGTAATGGCTTAATGGGTTTGCAATTTCTGTTGGCATTAATGGCCCTACCTGCAGGGTGGTTAATCCGTAAAACAGGTCATCCAGTGGCATCCCTCACCACAGCTTTGGGACTTTTAGTGCTGACTTTGTTCTGTTTGTTAAACGGATTTTGGTTACCGGCGATCGCCTTCTCCTGGTTATTGGGTTCCAGCATTTTAAACAATGGTTTAATTCCTTTGCTACTGGAAATTCTCCAGGGTAATCAGACCGGTGTGGGCATCGGTTTATATTTTGGCTGTGTGGGTCTAGCGGGGGACGTTTTTACCCGTTATTGGTCAACTCAGTCCAGCCAGATGCACGGGGGGTTGGGACTGGCAATGTTGGTAATGTCTACCTTGCTTTGTGCCCGATATTGGCAAGGATTCAGAGTCCCAAACAAAAAAGGAGCAGGAGATTAA

Protein

MGQYSAVLWRRVWGIALVQGSVTLMWITYRLYLGDLLKGWGFSPEFVVGLLTFEMVLGVVMEPLFGALSDRQQQNLGTRFPLISLGVILAAGFFLLIPLVFFLPIANVARFLLPSLAIAWAIAMTLFRSPTMVLIGQCAPTNQLPLAMGVLSLVGGIVATFRQPMGKWLLSLGSLPAFLLGSVVLLGASLFLSRVLPPIEKKEAISPATVRAFPWIAMVNIALFAIGTTWGTRVLMLVLTKQLEGISNGLMGLQFLLALMALPAGWLIRKTGHPVASLTTALGLLVLTLFCLLNGFWLPAIAFSWLLGSSILNNGLIPLLLEILQGNQTGVGIGLYFGCVGLAGDVFTRYWSTQSSQMHGGLGLAMLVMSTLLCARYWQGFRVPNKKGAGD