Your browser is old and dusty. Try Google Chrome!

Details for sll1198

ORF sll1198
Accession NP_440163.1
Symbol
Category Aminoacyl tRNA synthetases and tRNA modification
Definition tRNA (guanine-N1)-methyltransferase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -54 -68 17.6008 0.0218
NP_441061.1_2 Forward -61 -47 3.53951 0.163
NP_440795.1_7 Forward -61 -54 14.6904 0.0123
NP_440795.1_7 Reverse -54 -61 14.6904 0.0123
NP_441418.1_6 Reverse -53 -72 -1.57384 0.0142
NP_441418.1_6 Forward -62 -43 -20.1584 0.106
NP_441418.1_6 Forward -372 -353 -23.2067 0.192
NP_441418.1_6 Forward -143 -124 -30.3848 0.274
NP_441418.1_6 Forward -71 -52 -30.3848 0.274
NP_442291.1_5 Forward -63 -47 15.1032 0.0222
NP_442291.1_5 Reverse -52 -68 -1.71142 0.202
NP_441453.1_4 Reverse -53 -61 16.539 0.00633
NP_441453.1_4 Forward -62 -54 16.539 0.00633
NP_442151.1_6 Reverse -62 -76 5.40779 0.278
NP_441818.1_1 Forward -61 -50 18.446 0.0046
NP_441818.1_1 Reverse -364 -375 11.5629 0.176
NP_441818.1_9 Forward -154 -135 -9.93197 0.291
NP_440226.1_1 Forward -62 -43 10.1275 0.0654
NP_442169.1_1 Forward -56 -37 -1.57384 0.265
NP_441630.1_3 Forward -380 -361 5.60432 0.138
NP_441630.1_3 Reverse -45 -64 -0.197208 0.285
NP_441098.1_3 Forward -241 -222 -4.77918 0.28
NP_442173.1_1 Forward -61 -53 15.4574 0.00633
NP_442173.1_1 Reverse -54 -62 15.4574 0.00633
NP_442173.1_1 Reverse -364 -372 8.27922 0.101
NP_442752.1_4 Forward -62 -55 13.8055 0.0199
NP_442752.1_4 Reverse -53 -60 13.8055 0.0199
NP_443027.1_4 Forward -64 -54 14.828 0.0437
NP_443027.1_4 Reverse -51 -61 11.0914 0.107
NP_439997.1_5 Reverse -186 -205 19.7719 0.113
NP_441812.1_3 Reverse -52 -66 16.2242 0.0755
NP_442975.1_10 Forward -66 -52 5.21053 0.228
NP_441225.1_4 Reverse -49 -68 -12.4886 0.284
NP_440784.1_7 Forward -61 -54 15.9687 0.0123
NP_440784.1_7 Reverse -54 -61 15.9687 0.0123
NP_440061.1_9 Forward -64 -50 11.2087 0.116
NP_442062.1_3 Forward -313 -294 3.53937 0.206
NP_442062.1_8 Reverse -53 -63 19.4496 0.000558
NP_442062.1_8 Forward -62 -52 17.3846 0.00193
NP_441859.1_2 Forward -282 -263 11.11 0.219
NP_441859.1_3 Reverse -52 -71 9.63507 0.127
NP_441641.1_4 Forward -220 -201 7.7676 0.296
NP_440304.1_4 Forward -64 -54 10.8948 0.051
NP_440304.1_4 Reverse -51 -61 1.84832 0.299
NP_442242.1_4 Forward -61 -54 14.3954 0.0124
NP_442242.1_4 Reverse -54 -61 14.3954 0.0124
NP_440044.1_8 Forward -61 -42 -2.75381 0.269
NP_441935.1_9 Reverse -52 -71 12.8432 0.294
NP_441208.1_1 Forward -203 -184 -5.40875 0.281
NP_441594.1_6 Reverse -56 -75 10.9142 0.122
NP_441594.1_6 Forward -71 -52 2.75272 0.244
NP_441594.1_6 Reverse -101 -120 0.687771 0.282
NP_442110.1_7 Forward -62 -48 0.982901 0.241
NP_440330.1_2 Forward -137 -118 13.5691 0.266
NP_441083.1_5 Forward -62 -52 20.3345 0.00053
NP_441083.1_5 Reverse -363 -373 14.9263 0.0138
NP_441083.1_5 Reverse -53 -63 11.3864 0.0159
NP_441738.1_2 Forward -60 -53 15.28 0.0102
NP_441738.1_2 Reverse -55 -62 15.28 0.0102
NP_441738.1_2 Reverse -365 -372 13.3134 0.0335
NP_440209.1_1 Reverse -53 -61 18.1123 0.00295
NP_440209.1_1 Forward -62 -54 18.1123 0.00295
NP_442889.1_8 Forward -65 -51 4.52221 0.263
NP_442889.1_8 Reverse -50 -64 3.34225 0.281
NP_440178.1_7 Forward -63 -44 -14.1602 0.149
NP_442570.1_3 Forward -146 -127 -9.34199 0.298
NP_441716.1_1 Forward -62 -48 10.3243 0.0963
NP_441327.1_1 Forward -244 -225 10.941 0.184
NP_442111.1_3 Reverse -232 -245 12.1892 0.294
NP_442111.1_4 Reverse -52 -66 10.3243 0.0545
NP_440906.1_5 Forward -61 -54 15.8704 0.0124
NP_440906.1_5 Reverse -54 -61 15.8704 0.0124
NP_441209.1_8 Forward -237 -219 9.13108 0.24
NP_440747.1_10 Reverse -50 -62 16.8536 0.00143
NP_440747.1_10 Forward -65 -53 7.70879 0.00236
NP_440747.1_10 Forward -375 -363 -12.4491 0.282
NP_441130.1_10 Forward -64 -50 19.7641 0.00955
NP_441130.1_10 Reverse -361 -375 7.76774 0.149
NP_441486.1_1 Reverse -50 -64 11.3077 0.0164
NP_441486.1_1 Forward -65 -51 4.52282 0.0432
NP_441194.1_1 Forward -336 -317 13.3207 0.238
NP_442634.1_4 Reverse -51 -65 7.76774 0.0479
NP_440403.1_4 Reverse -44 -63 3.34271 0.126
NP_442848.1_1 Reverse -47 -61 16.5192 0.0143
NP_442848.1_9 Reverse -47 -66 -0.688862 0.279
NP_443018.1_3 Forward -61 -54 14.8871 0.0123
NP_443018.1_3 Reverse -54 -61 14.8871 0.0123
NP_441634.1_8 Reverse -51 -65 6.48943 0.114
NP_441634.1_8 Forward -374 -360 6.09611 0.114
NP_440376.1_1 Forward -62 -53 19.4693 0.000692
NP_440376.1_1 Reverse -53 -62 19.4693 0.000692
NP_440376.1_1 Forward -131 -122 -0.0986038 0.285
NP_441857.1_5 Forward -161 -143 13.6872 0.153
NP_441588.1_4 Forward -60 -50 8.73149 0.14
NP_441588.1_4 Reverse -147 -157 5.68323 0.245
NP_442687.1_7 Forward -63 -53 15.8113 0.0125
NP_442687.1_7 Reverse -52 -62 8.92815 0.0994
NP_442485.1_3 Forward -73 -54 3.83436 0.193
NP_442485.1_3 Reverse -123 -142 -1.37718 0.257
NP_442485.1_3 Forward -374 -355 -3.73712 0.277
NP_442485.1_3 Forward -302 -283 -5.11376 0.287
NP_441846.1_10 Reverse -270 -289 -19.3717 0.256
NP_441846.1_10 Reverse -277 -296 -23.6 0.294
NP_440642.1_10 Forward -282 -268 9.93039 0.175
NP_441422.1_7 Reverse -51 -68 -5.46769 0.247
NP_442658.1_1 Forward -64 -54 15.9091 0.00966
NP_442658.1_1 Reverse -51 -61 7.94438 0.199
NP_442658.1_1 Reverse -45 -55 5.28945 0.274
NP_440662.1_2 Reverse -355 -374 -1.08219 0.276
NP_442544.1_6 Forward -69 -50 11.8975 0.0884
NP_441414.1_9 Reverse -53 -72 0.0977854 0.0851
NP_441414.1_9 Reverse -343 -362 -6.68705 0.201
NP_441414.1_9 Forward -372 -353 -10.1286 0.277
NP_442937.1_5 Reverse -48 -67 13.2741 0.095
NP_442937.1_5 Forward -325 -306 8.35759 0.225
NP_442937.1_5 Forward -377 -358 7.57094 0.248
NP_442937.1_5 Forward -76 -57 5.99764 0.293
NP_441958.1_5 Forward -63 -53 12.2714 0.00183
NP_441958.1_5 Reverse -52 -62 12.2714 0.00183
NP_441127.1_1 Reverse -104 -118 8.06273 0.3
NP_442057.1_5 Forward -149 -131 15.9593 0.194
NP_442836.1_5 Reverse -47 -66 7.86593 0.154
NP_442836.1_10 Forward -371 -361 14.0414 0.212
NP_440984.1_1 Forward -374 -355 11.0125 0.275
NP_440984.1_9 Forward -155 -142 16.3422 0.12
NP_439990.1_5 Reverse -48 -61 12.6056 0.11
NP_442690.1_1 Reverse -224 -243 -7.76869 0.178
NP_442690.1_1 Forward -246 -227 -17.3068 0.299
NP_442911.1_2 Forward -72 -53 4.916 0.0361
NP_442911.1_2 Reverse -353 -372 2.75272 0.0485
NP_442911.1_2 Reverse -43 -62 -10.817 0.289
NP_440153.1_5 Forward -61 -47 8.06273 0.149
NP_440325.1_1 Forward -334 -315 14.1591 0.188
NP_442064.1_1 Reverse -325 -344 -9.44032 0.259
NP_443055.1_3 Reverse -44 -63 15.1332 0.105
NP_443055.1_6 Reverse -77 -95 1.88669 0.224
NP_442210.1_5 Forward -76 -57 15.0441 0.19
NP_442210.1_5 Forward -151 -132 11.3075 0.22
NP_441099.1_5 Reverse -43 -62 6.58763 0.045
NP_442002.1_9 Reverse -4 -11 11.1505 0.185
NP_442002.1_9 Forward -63 -56 10.7572 0.185
NP_440809.1_9 Forward -71 -53 -6.86402 0.225
NP_441424.1_2 Forward -333 -314 14.8486 0.14
NP_441646.1_1 Forward -69 -50 -0.295539 0.26
NP_442438.1_10 Forward -67 -53 4.22782 0.15
NP_441000.1_6 Forward -63 -49 4.91614 0.0933
NP_441000.1_6 Reverse -362 -376 2.94952 0.123
NP_440484.1_3 Reverse -51 -65 11.406 0.242
NP_440147.1_4 Forward -64 -51 11.0324 0.0341
NP_440147.1_4 Reverse -51 -64 7.39411 0.0695
NP_440147.1_4 Forward -374 -361 2.67422 0.203
NP_441550.1_8 Reverse -51 -61 15.1225 0.0132
NP_441550.1_8 Forward -64 -54 6.0761 0.214
NP_441916.1_7 Reverse -53 -63 18.4663 0.00144
NP_441916.1_7 Forward -62 -52 10.3048 0.0261
NP_440345.1_5 Reverse -220 -234 13.5701 0.285
NP_441041.1_4 Forward -62 -43 -6.58872 0.169
NP_441041.1_4 Reverse -53 -72 -7.57203 0.19
NP_441041.1_7 Reverse -50 -62 10.8188 0.0864
NP_441041.1_7 Forward -65 -53 7.61196 0.162
NP_442396.1_5 Forward -66 -53 6.80412 0.219
NP_441725.1_4 Reverse -48 -62 4.22722 0.278
NP_441725.1_5 Reverse -54 -64 11.2881 0.0247
NP_441725.1_5 Forward -61 -51 2.04498 0.115
NP_439966.1_7 Forward -64 -54 18.4657 0.00473
NP_439966.1_7 Reverse -51 -61 15.3192 0.0152
NP_439966.1_7 Reverse -361 -371 7.45273 0.15
NP_439966.1_9 Forward -64 -55 0.983037 0.253
NP_442941.1_3 Forward -61 -51 19.2529 0.00262
NP_442941.1_3 Reverse -54 -64 11.4848 0.0116
NP_442941.1_3 Reverse -364 -374 -0.0199663 0.244
NP_440289.1_2 Forward -65 -52 11.819 0.0171
NP_440289.1_2 Reverse -50 -63 5.91914 0.0605
NP_440289.1_2 Reverse -360 -373 -2.83231 0.262
NP_440983.1_5 Reverse -65 -84 -2.26216 0.231
NP_440983.1_9 Reverse -44 -63 5.89931 0.282
NP_442281.1_1 Forward -67 -53 19.8618 0.00247
NP_442281.1_1 Reverse -48 -62 17.1085 0.00656
NP_442256.1_2 Reverse -51 -69 -9.71562 0.288
NP_442049.1_6 Reverse -45 -64 9.3409 0.215
NP_441457.1_7 Forward -302 -283 -1.18052 0.293
NP_440723.1_4 Forward -65 -46 -10.227 0.272
NP_440498.1_1 Forward -71 -53 7.78729 0.0827
NP_441644.1_6 Forward -62 -52 17.3841 0.00127
NP_441644.1_6 Reverse -53 -63 10.1076 0.0628
NP_441644.1_6 Reverse -363 -373 4.69947 0.228
NP_442215.1_2 Forward -145 -129 3.89344 0.0903
NP_442215.1_2 Forward -64 -48 -1.51476 0.186
NP_442215.1_2 Reverse -51 -67 -6.13632 0.264
NP_442029.1_5 Reverse -52 -71 16.5164 0.217
NP_440253.1_2 Forward -62 -44 11.3272 0.0322
NP_440253.1_2 Reverse -363 -381 8.7706 0.0526
NP_440929.1_8 Forward -62 -53 19.2726 0.000701
NP_440929.1_8 Reverse -53 -62 19.2726 0.000701
NP_442933.1_10 Forward -62 -53 17.601 0.00325
NP_442933.1_10 Reverse -53 -62 17.601 0.00325
NP_442933.1_10 Forward -154 -145 8.75118 0.0688
NP_441751.2_8 Reverse -54 -68 16.7159 0.00876
NP_441751.2_8 Forward -61 -47 4.22782 0.0521
NP_442554.1_8 Forward -61 -51 16.2046 0.0065
NP_442554.1_8 Reverse -54 -64 13.8447 0.0145
NP_442554.1_8 Reverse -364 -374 3.71661 0.215
NP_440133.1_10 Forward -154 -135 3.6377 0.283
NP_441762.1_7 Reverse -52 -64 2.89058 0.0676
NP_441762.1_7 Forward -63 -51 2.39892 0.0676
NP_441762.1_7 Forward -373 -361 -5.07423 0.187
NP_442142.1_4 Forward -65 -52 17.1282 0.0264
NP_442142.1_4 Reverse -50 -63 14.7683 0.0302
NP_442142.1_4 Reverse -142 -155 5.91857 0.178
NP_442292.1_1 Forward -61 -52 18.486 0.00229
NP_442292.1_1 Reverse -54 -63 9.63616 0.0183
NP_442292.1_1 Reverse -364 -373 6.5879 0.101
NP_442292.1_2 Reverse -321 -335 17.4885 0.248
NP_442476.1_6 Reverse -54 -68 2.35953 0.186
NP_443009.1_5 Reverse -52 -63 18.3477 0.00265
NP_441715.1_4 Forward -61 -51 17.3846 0.0106
NP_441715.1_4 Reverse -54 -64 16.303 0.0117
NP_441715.1_4 Reverse -364 -374 6.27322 0.155
NP_440183.1_1 Forward -284 -265 6.98095 0.27
NP_441468.1_1 Forward -61 -54 15.8704 0.0124
NP_441468.1_1 Reverse -54 -61 15.8704 0.0124
NP_441020.2_6 Forward -64 -47 6.33202 0.267
NP_441020.2_7 Reverse -129 -148 8.06178 0.269
NP_441673.1_1 Forward -62 -53 20.8459 0.000698
NP_441673.1_1 Reverse -53 -62 20.8459 0.000698
NP_441876.1_2 Reverse -219 -238 11.3075 0.268
NP_441826.1_2 Reverse -47 -61 11.6026 0.0356
NP_441826.1_2 Forward -68 -54 10.521 0.0471
NP_441637.1_8 Reverse -347 -364 13.9035 0.197
NP_442490.1_9 Forward -74 -55 -4.22878 0.259
NP_441764.1_1 Forward -333 -314 7.96426 0.28
NP_442868.1_6 Reverse -51 -61 19.2529 0.00563
NP_442868.1_6 Forward -64 -54 0.963343 0.205
NP_442868.1_6 Forward -374 -364 -0.118297 0.264
NP_442719.1_2 Reverse -243 -261 -11.8796 0.297
NP_441251.1_7 Reverse -230 -243 12.3107 0.266
NP_441056.1_1 Forward -62 -43 -0.000545616 0.156
NP_441612.1_2 Forward -62 -52 8.54929 0.21
NP_442227.1_2 Reverse -118 -137 -0.39387 0.253
NP_443058.1_7 Reverse -52 -71 3.6377 0.26
NP_442808.1_1 Forward -63 -53 18.4657 0.00201
NP_442808.1_1 Reverse -362 -372 9.91099 0.0481
NP_442808.1_1 Reverse -52 -62 8.63269 0.0481
NP_441101.1_10 Reverse -49 -68 8.65258 0.172
NP_440145.1_3 Reverse -43 -62 6.58763 0.0509
NP_442542.1_2 Forward -64 -51 9.45906 0.134
NP_442050.1_1 Reverse -270 -289 11.5042 0.233
NP_442050.1_1 Reverse -269 -288 11.3075 0.233
NP_442050.1_5 Reverse -51 -61 14.3359 0.0206
NP_442050.1_5 Forward -64 -54 9.12434 0.193
NP_442903.1_1 Forward -255 -236 19.5673 0.0628
NP_442342.1_4 Reverse -121 -140 12.9791 0.283
NP_440558.1_2 Forward -128 -109 -6.49039 0.275
NP_440274.1_2 Reverse -195 -209 14.4536 0.236
NP_440923.1_2 Forward -336 -317 24.3978 0.00775
NP_441878.1_6 Forward -63 -53 10.4031 0.0176
NP_441878.1_6 Reverse -52 -62 10.4031 0.0176
NP_441878.1_6 Reverse -83 -93 -7.68978 0.255
NP_441036.1_8 Forward -63 -53 17.7779 0.000554
NP_441036.1_8 Reverse -52 -62 8.33817 0.174
NP_441557.1_5 Forward -62 -53 19.9609 0.000699
NP_441557.1_5 Reverse -53 -62 19.9609 0.000699
NP_441445.1_1 Forward -71 -52 11.3075 0.0863
NP_442066.2_9 Reverse -49 -62 8.37742 0.185
NP_441308.1_8 Forward -64 -54 10.1081 0.22
NP_442183.1_1 Reverse -53 -67 20.6491 0.00378
NP_442183.1_1 Forward -62 -48 9.5377 0.0966
NP_442183.1_1 Forward -372 -358 6.48943 0.171
NP_440979.1_3 Reverse -54 -72 13.0972 0.234
NP_441819.1_5 Reverse -318 -337 8.83258 0.293
NP_442135.1_8 Forward -73 -55 12.8022 0.207
NP_441574.1_1 Reverse -53 -72 -6.58872 0.277
NP_442347.1_2 Forward -61 -52 12.4878 0.056
NP_442347.1_2 Reverse -54 -63 11.1111 0.056
NP_442347.1_2 Reverse -364 -373 3.34298 0.284
NP_442645.1_2 Reverse -45 -64 -2.95047 0.0487
NP_442965.1_2 Reverse -271 -290 3.83436 0.168
NP_441037.1_4 Forward -64 -54 7.02532 0.237
NP_442594.1_8 Reverse -269 -288 4.22769 0.269
NP_442594.1_10 Forward -287 -268 7.76679 0.288
NP_440932.1_5 Forward -363 -344 3.24438 0.274
NP_442317.1_6 Forward -99 -80 5.99764 0.238
NP_440563.1_4 Forward -106 -93 18.0139 0.181
NP_441633.1_3 Reverse -51 -64 10.7374 0.0286
NP_441633.1_3 Forward -64 -51 -3.71729 0.177
NP_441633.1_3 Forward -73 -60 -5.68391 0.236
NP_440136.1_2 Forward -61 -54 15.9687 0.0123
NP_440136.1_2 Reverse -54 -61 15.9687 0.0123
NP_442590.1_10 Forward -68 -49 3.34271 0.294
NP_441728.2_4 Forward -337 -318 12.0793 0.273
NP_442998.1_5 Reverse -233 -243 11.7798 0.176
NP_442998.1_10 Forward -60 -53 15.5754 0.0102
NP_442998.1_10 Reverse -55 -62 15.5754 0.0102
NP_442998.1_10 Reverse -365 -372 12.3305 0.0564
NP_440299.1_1 Reverse -49 -62 12.0151 0.0427
NP_440299.1_1 Forward -66 -53 10.4418 0.0573
NP_441799.1_1 Forward -66 -52 12.8803 0.0385
NP_441799.1_1 Reverse -49 -63 7.27547 0.147
NP_441799.1_1 Reverse -359 -373 5.70218 0.197
NP_441007.1_10 Forward -67 -54 1.69091 0.203
NP_441007.1_10 Reverse -48 -61 0.314277 0.233
NP_440256.1_1 Forward -65 -46 0.0977854 0.087
NP_440256.1_1 Reverse -50 -69 -0.688862 0.0954
NP_440087.1_1 Forward -372 -353 -5.9004 0.249
NP_441559.1_4 Forward -146 -127 2.94938 0.191
NP_441559.1_8 Reverse -48 -62 -5.70361 0.27
NP_441559.1_8 Forward -67 -53 -6.98191 0.281
NP_440915.1_6 Reverse -49 -63 11.3077 0.0263
NP_440164.1_1 Forward -315 -296 27.6305 0.000791
NP_440164.1_2 Forward -337 -318 30.9737 0.000136
NP_440164.1_7 Forward -400 -381 18.6823 0.0638
NP_440164.1_9 Forward -236 -217 20.8456 0.121
NP_442866.1_1 Forward -67 -48 -7.76869 0.268
NP_441464.1_10 Forward -206 -192 14.6509 0.166
NP_440695.1_5 Reverse -53 -72 8.94757 0.15
NP_441199.1_3 Reverse -124 -142 -2.24246 0.27
NP_442993.1_1 Reverse -53 -69 0.451859 0.0636
NP_440677.1_1 Reverse -160 -179 7.07928 0.243
NP_440677.1_1 Forward -71 -52 6.98095 0.247
NP_442386.1_9 Forward -63 -54 15.7322 0.0144
NP_442386.1_9 Reverse -52 -61 13.8639 0.0289
NP_442386.1_9 Reverse -362 -371 4.52254 0.297
NP_441340.1_5 Forward -61 -54 15.6737 0.0124
NP_441340.1_5 Reverse -54 -61 15.6737 0.0124
NP_441340.1_9 Reverse -232 -242 8.15881 0.256
NP_441947.1_10 Forward -121 -103 -0.964162 0.284
NP_440168.1_9 Reverse -51 -70 3.73603 0.231
NP_442506.1_9 Forward -148 -129 8.75091 0.229
NP_442240.1_2 Forward -61 -42 -19.6667 0.295
NP_440586.1_8 Forward -61 -54 13.2151 0.026
NP_440586.1_8 Reverse -54 -61 13.2151 0.026
NP_442251.1_6 Forward -61 -54 15.2804 0.0124
NP_442251.1_6 Reverse -54 -61 15.2804 0.0124
NP_440684.1_9 Forward -68 -54 16.7159 0.0687
NP_441262.1_3 Reverse -53 -60 14.7888 0.0223
NP_441262.1_3 Forward -62 -55 14.7888 0.0223
NP_440027.1_3 Reverse -43 -61 6.50823 0.225
NP_443051.1_1 Reverse -52 -61 10.4228 0.00754
NP_443051.1_1 Forward -63 -54 10.4228 0.00754
NP_439937.1_8 Reverse -102 -121 0.58944 0.235
NP_441167.1_1 Forward -336 -317 5.80098 0.237
NP_440439.1_1 Forward -65 -52 8.37742 0.0537
NP_440439.1_1 Reverse -50 -63 1.9859 0.138
NP_440372.1_2 Forward -61 -54 16.3621 0.0124
NP_440372.1_2 Reverse -54 -61 16.3621 0.0124
NP_440171.1_3 Reverse -266 -285 12.4875 0.177
NP_440316.1_10 Forward -138 -128 5.87989 0.277
NP_441803.1_2 Forward -67 -48 7.37428 0.139
NP_439977.1_10 Forward -363 -344 14.9458 0.218
NP_441616.1_7 Reverse -132 -150 16.7354 0.28
NP_441572.1_7 Forward -68 -49 -4.03212 0.224
NP_442384.1_10 Reverse -53 -66 13.884 0.018
NP_442384.1_10 Forward -62 -49 13.4906 0.0197
NP_442035.1_8 Reverse -59 -73 12.8809 0.243
NP_442572.1_6 Forward -71 -52 7.7676 0.276
NP_442790.1_4 Forward -71 -52 -7.37537 0.153
NP_442790.1_4 Reverse -44 -63 -8.26035 0.166
NP_442262.1_10 Forward -61 -54 14.1988 0.0123
NP_442262.1_10 Reverse -54 -61 14.1988 0.0123
NP_442262.1_10 Reverse -364 -371 9.67555 0.173
NP_441689.1_5 Forward -64 -54 8.53436 0.132
NP_441689.1_5 Reverse -51 -61 5.78111 0.197
NP_440163.1_10 Forward -65 -55 16.303 0.0762
NP_440344.1_10 Forward -69 -52 1.71047 0.0299
NP_440344.1_10 Reverse -46 -63 -8.22096 0.124
NP_440282.1_10 Forward -72 -53 0.0977854 0.196
NP_440531.1_6 Reverse -45 -64 -4.42544 0.28
NP_440531.1_6 Forward -70 -51 -5.31042 0.296
NP_441335.1_8 Reverse -359 -378 8.55425 0.253
NP_441335.1_8 Forward -373 -354 6.78429 0.281
NP_441965.1_10 Reverse -50 -66 14.3165 0.0851
NP_442556.1_10 Forward -49 -30 12.0775 0.217
NP_440297.1_9 Reverse -54 -64 9.32148 0.0917
NP_440297.1_9 Forward -61 -51 -0.118297 0.282
NP_442187.1_3 Forward -373 -363 14.6313 0.165
NP_441896.1_1 Reverse -316 -335 8.16011 0.258
NP_441896.1_5 Forward -149 -142 15.3787 0.268
NP_440999.1_9 Forward -66 -52 10.1277 0.055
NP_440999.1_9 Reverse -49 -63 2.06454 0.154
NP_440999.1_9 Reverse -58 -72 1.57289 0.162
NP_440999.1_9 Reverse -359 -373 1.08123 0.171
NP_440888.1_2 Forward -62 -48 17.4035 0.00402
NP_440888.1_2 Reverse -53 -67 11.307 0.0705
NP_440888.1_2 Reverse -363 -377 7.86545 0.179
NP_440600.1_4 Reverse -45 -63 -7.55234 0.293
NP_440600.1_9 Forward -240 -221 13.5117 0.243
NP_442147.1_7 Reverse -269 -288 9.43923 0.257
NP_442948.1_2 Reverse -52 -71 3.53937 0.283
NP_442033.1_10 Forward -64 -45 -4.91709 0.179
NP_441123.1_3 Reverse -250 -269 18.9773 0.0484
NP_441949.1_5 Forward -335 -316 13.1865 0.2
NP_440575.1_1 Reverse -180 -199 -3.44288 0.294
NP_441543.1_2 Reverse -54 -63 18.486 0.00236
NP_441543.1_2 Forward -61 -52 16.9127 0.00359
NP_442845.1_2 Forward -68 -54 7.17775 0.198
NP_442845.1_2 Forward -143 -129 4.42448 0.259
NP_441469.1_8 Forward -63 -54 16.126 0.00797
NP_441469.1_8 Reverse -52 -61 6.48957 0.227
NP_443064.1_6 Forward -62 -52 12.5669 0.0796
NP_442578.1_7 Forward -61 -54 14.5921 0.026
NP_442578.1_7 Reverse -54 -61 14.5921 0.026
NP_440710.1_4 Forward -170 -156 13.476 0.242
NP_441462.1_2 Forward -62 -52 11.5831 0.00406
NP_441462.1_2 Reverse -53 -63 11.5831 0.00406
NP_441621.1_7 Reverse -51 -65 -3.44199 0.188
NP_443062.1_1 Reverse -53 -71 17.7116 0.0246
NP_443062.1_1 Forward -62 -44 6.8883 0.19
NP_443062.1_6 Forward -70 -51 10.6192 0.112
NP_443062.1_6 Reverse -45 -64 6.29264 0.183
NP_441601.1_2 Forward -378 -359 -0.688862 0.219
NP_442204.1_1 Reverse -49 -60 2.22195 0.266
NP_442204.1_1 Forward -66 -55 -0.137991 0.286
NP_441560.1_3 Reverse -128 -146 8.67227 0.28
NP_441351.1_8 Reverse -60 -79 0.982764 0.276
NP_440516.1_2 Forward -68 -50 5.52568 0.128
NP_440516.1_8 Forward -62 -53 16.9127 0.00442
NP_440516.1_8 Reverse -53 -62 16.9127 0.00442
NP_440516.1_8 Forward -372 -363 9.14451 0.0354
NP_442768.1_5 Reverse -332 -351 14.3558 0.268
NP_442428.1_5 Forward -61 -54 15.8704 0.0124
NP_442428.1_5 Reverse -54 -61 15.8704 0.0124
NP_441443.1_1 Reverse -268 -287 -2.16383 0.26
NP_441443.1_10 Forward -278 -260 2.08335 0.275
NP_442859.1_2 Forward -61 -42 8.25926 0.199
NP_440673.1_3 Forward -60 -53 12.4288 0.0426
NP_440673.1_3 Reverse -55 -62 12.4288 0.0426
NP_441052.1_2 Forward -62 -52 19.9412 0.00106
NP_441052.1_2 Reverse -53 -63 10.5014 0.0285
NP_441052.1_2 Reverse -62 -72 5.5849 0.111
NP_441052.1_2 Reverse -363 -373 1.25834 0.249
NP_442219.1_9 Forward -61 -52 17.7976 0.00718
NP_442219.1_9 Reverse -54 -63 8.35786 0.0681
NP_440436.1_4 Reverse -54 -63 18.1905 0.00233
NP_440436.1_4 Forward -61 -52 17.2072 0.00233
NP_441884.1_9 Reverse -252 -271 -20.945 0.218
NP_441884.1_9 Forward -375 -356 -23.5016 0.284
NP_441884.1_9 Forward -65 -46 -24.5833 0.288
NP_442864.1_2 Reverse -63 -82 10.2259 0.274
NP_442907.1_9 Reverse -129 -148 -3.24547 0.265
NP_441719.1_4 Forward -61 -54 16.3621 0.0124
NP_441719.1_4 Reverse -54 -61 16.3621 0.0124
NP_441733.1_10 Reverse -50 -63 9.85238 0.106
NP_441733.1_10 Forward -375 -362 8.9674 0.131
NP_442813.1_4 Forward -282 -263 -3.24547 0.289
NP_442366.1_3 Reverse -52 -70 0.0191479 0.181
NP_442366.1_3 Forward -63 -45 -1.94747 0.219
NP_440129.1_10 Forward -69 -55 5.99778 0.185
NP_442873.1_9 Reverse -112 -131 5.80018 0.259
NP_442206.1_10 Reverse -53 -68 7.45305 0.178
NP_442206.1_10 Forward -62 -47 1.06154 0.238
NP_442854.1_6 Forward -62 -43 3.83436 0.253
NP_443054.1_2 Forward -64 -50 3.44117 0.24
NP_443054.1_2 Reverse -51 -65 1.08123 0.251
NP_443054.1_2 Reverse -82 -96 0.294584 0.269
NP_443054.1_2 Forward -96 -82 -0.590395 0.299
NP_440864.1_9 Forward -111 -92 -6.09707 0.254
NP_441851.1_10 Forward -63 -53 16.008 0.00552
NP_441851.1_10 Reverse -52 -62 15.8113 0.00552
NP_442011.1_1 Reverse -52 -71 5.99764 0.186
NP_442856.1_2 Reverse -264 -283 19.6656 0.0231
NP_442515.1_1 Reverse -52 -66 4.12949 0.108
NP_441683.1_7 Reverse -269 -288 -12.0953 0.284
NP_440463.1_6 Forward -65 -46 8.35759 0.256
NP_440165.1_5 Forward -63 -44 1.86774 0.116
NP_442689.1_8 Reverse -321 -338 -6.94266 0.292
NP_441349.1_10 Forward -72 -53 -6.78538 0.236
NP_441349.1_10 Reverse -43 -62 -8.26035 0.272
NP_442024.1_8 Forward -335 -325 15.418 0.254
NP_441409.1_6 Forward -68 -49 -6.09707 0.119
NP_441409.1_6 Reverse -357 -376 -15.5368 0.297
NP_440432.1_9 Forward -61 -46 3.91314 0.0797
NP_442843.1_1 Forward -61 -42 0.884433 0.17
NP_439960.1_10 Reverse -261 -279 -4.60241 0.293
NP_440474.1_8 Reverse -54 -68 7.86545 0.196
NP_440431.1_3 Reverse -144 -163 -6.98204 0.201
NP_442450.1_5 Forward -64 -54 9.32148 0.115
NP_440588.1_2 Forward -71 -52 -1.08219 0.155
NP_440588.1_2 Forward -146 -127 -6.09707 0.269
NP_440023.1_2 Forward -118 -99 10.4225 0.193
NP_442006.1_2 Reverse -263 -280 -10.0892 0.197
NP_442006.1_2 Forward -137 -120 -17.1691 0.27
NP_442006.1_2 Reverse -262 -279 -18.1524 0.288
NP_441003.1_9 Forward -379 -360 4.81767 0.277
NP_442243.1_1 Reverse -91 -109 -2.83317 0.297
NP_441570.1_1 Forward -62 -44 0.904127 0.0353
NP_441570.1_1 Reverse -53 -71 -16.5988 0.249
NP_440078.1_10 Reverse -53 -72 13.1758 0.155
NP_441078.1_4 Forward -62 -53 19.6659 0.0007
NP_441078.1_4 Reverse -53 -62 19.6659 0.0007
NP_442729.1_8 Forward -66 -53 9.36073 0.125
NP_441663.1_8 Forward -68 -49 -3.73712 0.295
NP_440793.1_1 Forward -283 -269 9.53707 0.293
NP_440526.1_3 Forward -61 -50 10.2846 0.0646
NP_441432.1_8 Reverse -52 -61 16.8143 0.00595
NP_441432.1_8 Forward -63 -54 8.25953 0.0755
NP_441432.1_8 Forward -373 -364 4.42462 0.213
NP_442320.1_8 Reverse -47 -61 4.03116 0.0559
NP_442320.1_8 Forward -68 -54 -4.13031 0.148
NP_442344.1_7 Reverse -54 -73 8.25926 0.0489
NP_441732.1_2 Forward -66 -50 -7.90627 0.0983
NP_442003.1_4 Forward -61 -42 11.3075 0.277
NP_440760.1_1 Forward -62 -43 -13.6686 0.11
NP_440760.1_1 Forward -320 -301 -16.5201 0.179
NP_442797.1_7 Forward -138 -120 15.9488 0.107
NP_440199.1_10 Reverse -50 -60 7.25653 0.231
NP_442353.1_4 Reverse -47 -66 0.981987 0.259
NP_442489.1_7 Forward -62 -53 20.1576 0.000695
NP_442489.1_7 Reverse -53 -62 20.1576 0.000695
NP_440559.1_1 Forward -61 -52 17.4043 0.00658
NP_440559.1_1 Reverse -54 -63 8.75118 0.0586
NP_441659.2_8 Forward -62 -52 18.1713 0.00133
NP_441659.2_8 Reverse -53 -63 11.9764 0.0147
NP_441800.1_7 Reverse -38 -56 -2.3408 0.263
NP_442346.1_5 Reverse -52 -62 16.6963 0.00248
NP_442346.1_5 Forward -63 -53 9.02648 0.118
NP_442346.1_10 Forward -302 -283 -3.24547 0.294
NP_440545.1_3 Reverse -49 -66 2.69378 0.0961
NP_442603.1_7 Forward -62 -48 9.43874 0.146
NP_442603.1_7 Forward -372 -358 6.29216 0.249
NP_442603.1_7 Reverse -53 -67 5.50552 0.29
NP_442828.1_7 Reverse -267 -286 -3.83545 0.276
NP_441888.1_7 Reverse -48 -62 11.996 0.0743
NP_441888.1_7 Forward -67 -53 3.53951 0.225
NP_441050.1_5 Forward -132 -114 -2.83245 0.284
NP_441948.1_4 Forward -379 -361 -1.55415 0.146
NP_441047.1_2 Reverse -122 -141 -2.26216 0.273
NP_440170.1_2 Reverse -41 -60 14.4541 0.125
NP_440170.1_5 Forward -72 -53 15.5357 0.0674
NP_441833.1_4 Forward -61 -54 15.9687 0.0124
NP_441833.1_4 Reverse -54 -61 15.9687 0.0124
NP_441895.1_2 Reverse -264 -283 -26.4516 0.24
NP_442162.1_9 Forward -61 -54 16.2637 0.0124
NP_442162.1_9 Reverse -54 -61 16.2637 0.0124
NP_440671.1_4 Forward -68 -54 13.2743 0.0864
NP_440671.1_4 Reverse -47 -61 7.86607 0.207
NP_442140.1_3 Forward -61 -51 10.3048 0.0902
NP_442140.1_3 Reverse -54 -64 8.33817 0.119
NP_442723.1_1 Reverse -185 -204 3.34192 0.278
NP_442021.1_3 Forward -149 -130 -1.18052 0.251
NP_440875.1_9 Reverse -55 -65 9.05339 0.233
NP_440875.1_9 Forward -60 -50 7.69067 0.255
NP_441813.1_5 Reverse -51 -61 18.1713 0.00743
NP_441813.1_5 Forward -64 -54 17.188 0.00979
NP_440590.1_4 Forward -61 -48 13.9823 0.0112
NP_440590.1_4 Reverse -364 -377 -5.68391 0.286
NP_440567.1_1 Reverse -54 -68 11.3077 0.0292
NP_440567.1_1 Forward -371 -357 0.294584 0.25
NP_442497.1_10 Forward -61 -52 10.4228 0.0087
NP_442497.1_10 Reverse -54 -63 10.4228 0.0087
NP_440821.1_4 Forward -64 -54 19.0562 0.00399
NP_440821.1_4 Reverse -51 -61 9.41981 0.0286
NP_440227.1_2 Forward -244 -228 7.2367 0.295
NP_441239.1_9 Forward -64 -52 13.3137 0.037
NP_441239.1_9 Reverse -361 -373 10.3637 0.0807
NP_441239.1_9 Reverse -51 -63 7.80712 0.148
NP_440400.1_1 Reverse -37 -56 -2.06626 0.285
NP_441892.1_1 Reverse -44 -61 -2.81276 0.228
NP_440604.1_6 Forward -266 -247 -6.1954 0.29
NP_442193.1_8 Forward -65 -46 10.2251 0.286
NP_441017.1_6 Reverse -49 -63 12.2903 0.221
NP_441541.1_1 Reverse -222 -240 5.63601 0.164
NP_442216.1_4 Forward -358 -350 8.08217 0.255
NP_440949.1_7 Forward -70 -51 13.6666 0.206
NP_442138.1_9 Reverse -134 -153 8.55343 0.262
NP_442138.1_10 Reverse -53 -72 -1.18052 0.171
NP_442138.1_10 Forward -158 -139 -7.37537 0.288
NP_440546.1_4 Reverse -53 -63 11.8882 0.0679
NP_440546.1_4 Forward -372 -362 10.4338 0.109
NP_440546.1_4 Forward -62 -52 10.046 0.109
NP_440546.1_4 Forward -154 -144 9.27034 0.146
NP_440675.1_1 Forward -146 -127 11.3075 0.193
NP_440462.1_6 Forward -64 -54 15.418 0.0142
NP_440462.1_6 Reverse -51 -61 9.61647 0.0429
NP_440462.1_6 Reverse -361 -371 4.69992 0.187
NP_441607.1_1 Reverse -270 -289 13.1181 0.289
NP_440868.1_4 Forward -66 -54 17.7386 0.0124
NP_440868.1_4 Reverse -359 -371 3.77555 0.133
NP_440868.1_4 Reverse -49 -61 1.02229 0.193
NP_440401.1_9 Reverse -192 -199 12.6251 0.287
NP_442402.1_2 Forward -281 -267 14.1586 0.263
NP_442402.1_4 Forward -286 -267 -5.21283 0.238
NP_442402.1_4 Reverse -180 -199 -5.40949 0.244
NP_442402.1_4 Forward -249 -230 -6.98278 0.268
NP_441848.1_4 Reverse -227 -243 16.1449 0.151
NP_441084.1_6 Reverse -143 -157 12.9315 0.152
NP_442039.1_4 Forward -61 -54 15.1821 0.0124
NP_442039.1_4 Reverse -54 -61 15.1821 0.0124
NP_442039.1_7 Forward -135 -125 10.9931 0.257
NP_442837.1_3 Forward -61 -54 15.7721 0.0124
NP_442837.1_3 Reverse -54 -61 15.7721 0.0124
NP_440160.1_9 Reverse -121 -140 12.3892 0.216
NP_442053.1_1 Forward -62 -53 18.3876 0.0007
NP_442053.1_1 Reverse -53 -62 18.3876 0.0007
NP_442053.1_1 Reverse -363 -372 4.81794 0.222
NP_442053.1_1 Forward -372 -363 4.22796 0.261
NP_440505.1_3 Reverse -51 -61 18.3679 0.00213
NP_440505.1_3 Forward -64 -54 13.8447 0.0247
NP_440505.1_3 Forward -374 -364 7.05986 0.165
NP_442532.1_7 Forward -372 -358 2.75286 0.226
NP_440914.1_1 Forward -62 -52 17.5935 0.000537
NP_440914.1_1 Reverse -53 -63 8.6151 0.186
NP_441699.1_5 Reverse -135 -154 9.93088 0.2
NP_441011.1_8 Reverse -54 -63 16.9127 0.00602
NP_441011.1_8 Forward -61 -52 8.25953 0.144
NP_442533.1_6 Forward -62 -53 17.2076 0.00137
NP_442533.1_6 Reverse -53 -62 17.2076 0.00137
NP_442541.1_10 Reverse -115 -129 2.5556 0.255
NP_442232.1_3 Forward -133 -114 -10.3253 0.27
NP_441482.1_7 Reverse -47 -61 7.07942 0.0257
NP_441482.1_7 Forward -68 -54 -1.5737 0.0755
NP_439944.1_9 Forward -61 -51 10.5014 0.0887
NP_439944.1_9 Reverse -54 -64 10.3048 0.0887
NP_442269.1_10 Forward -148 -129 3.6377 0.248
NP_441028.1_6 Forward -276 -266 15.2208 0.152
NP_441028.1_6 Forward -275 -265 4.10949 0.278
NP_441028.1_6 Forward -277 -267 3.42118 0.296
NP_440116.1_8 Forward -61 -42 -6.58872 0.211
NP_440115.1_6 Reverse -50 -60 6.8632 0.167
NP_440007.1_9 Forward -66 -52 0.491246 0.297
NP_440007.1_9 Reverse -49 -63 0.392915 0.298
NP_441680.1_4 Reverse -362 -381 -3.63879 0.3
NP_441972.1_5 Forward -73 -54 -1.18052 0.175
NP_441106.1_1 Forward -63 -54 18.191 0.0028
NP_441106.1_1 Reverse -52 -61 9.63616 0.0311
NP_439903.1_6 Forward -65 -46 0.293673 0.267
NP_439903.1_6 Reverse -50 -69 -0.197979 0.277
NP_001035870.1_3 Reverse -299 -318 -0.590531 0.2
NP_441286.1_1 Reverse -52 -64 14.4936 0.00418
NP_441286.1_1 Forward -63 -51 3.38223 0.0467
NP_441286.1_1 Forward -373 -361 -5.46756 0.203
NP_440670.1_8 Forward -62 -53 18.3876 0.000699
NP_440670.1_8 Reverse -53 -62 18.3876 0.000699
NP_440670.1_8 Forward -372 -363 5.50626 0.152
NP_439955.1_10 Reverse -117 -136 13.0766 0.258
NP_440886.1_7 Forward -63 -53 17.7774 0.0011
NP_440886.1_7 Reverse -52 -62 7.94438 0.0805
NP_440886.1_7 Reverse -362 -372 6.76441 0.114
NP_440886.1_7 Reverse -61 -71 3.42118 0.282
NP_440886.1_7 Reverse -194 -204 3.22451 0.291
NP_442072.1_9 Forward -63 -45 -13.9439 0.126
NP_442072.1_9 Reverse -52 -70 -22.2037 0.225
NP_440907.2_8 Reverse -54 -64 7.84605 0.117
NP_442264.1_2 Forward -72 -55 14.9851 0.127
NP_441021.1_1 Forward -61 -42 3.83436 0.0818
NP_441021.1_1 Forward -124 -105 -9.63698 0.218
NP_441021.1_8 Reverse -48 -66 4.05072 0.225
NP_441463.1_3 Forward -72 -53 10.4225 0.0481
NP_441463.1_6 Reverse -51 -65 5.54623 0.287
NP_441626.1_2 Forward -61 -54 15.7721 0.0124
NP_441626.1_2 Reverse -54 -61 15.7721 0.0124
NP_442211.1_3 Reverse -98 -117 9.12548 0.261
NP_442365.1_5 Reverse -54 -73 9.53756 0.204
NP_442365.1_7 Reverse -49 -68 -1.86883 0.196
NP_442365.1_7 Forward -66 -47 -2.0655 0.199
NP_442794.1_1 Reverse -49 -61 10.4621 0.0721
NP_442794.1_1 Forward -75 -63 5.84051 0.203
NP_442615.1_1 Forward -71 -53 8.37728 0.0284
NP_441962.1_4 Reverse -48 -67 1.27776 0.104
NP_441962.1_4 Reverse -306 -325 -13.3736 0.272
NP_440387.1_1 Reverse -53 -69 13.7265 0.00818
NP_440387.1_1 Forward -62 -46 5.56507 0.0315
NP_441431.1_3 Forward -137 -118 2.65439 0.282
NP_441836.1_1 Forward -73 -54 12.7655 0.242
NP_441993.1_1 Forward -62 -43 4.48058 0.22
NP_440814.1_4 Forward -190 -171 -5.9004 0.212
NP_440114.1_10 Reverse -53 -67 6.09611 0.285
NP_440737.1_1 Reverse -281 -300 7.96426 0.251
NP_442698.1_10 Reverse -267 -286 5.40766 0.238
NP_442698.1_10 Reverse -55 -74 -0.39387 0.297
NP_441510.2_7 Forward -68 -54 12.2903 0.28
NP_440766.1_4 Reverse -49 -63 9.04604 0.0871
NP_439910.1_2 Forward -70 -53 -21.299 0.183
NP_442867.1_8 Forward -279 -260 5.70265 0.276
NP_440457.1_1 Reverse -49 -61 6.33216 0.123
NP_440457.1_1 Forward -66 -54 1.21895 0.244
NP_441801.1_4 Reverse -259 -269 3.32329 0.231
NP_442509.1_9 Reverse -53 -63 16.2041 0.00739
NP_442509.1_9 Forward -62 -52 8.14104 0.192
NP_440524.1_2 Forward -111 -92 6.78429 0.16
NP_442936.1_10 Reverse -178 -192 8.40253 0.269
NP_442514.1_5 Forward -280 -261 -7.3761 0.276
NP_442514.1_5 Reverse -257 -276 -9.24438 0.295
NP_440554.1_4 Reverse -54 -64 14.6313 0.02
NP_440554.1_4 Forward -61 -51 8.92815 0.0646
NP_440554.1_4 Reverse -364 -374 2.7333 0.254
NP_442862.1_3 Forward -242 -225 11.3469 0.202
NP_441885.1_5 Forward -62 -52 20.9245 0.000538
NP_441885.1_5 Reverse -53 -63 11.4848 0.00668
NP_441885.1_8 Forward -379 -360 22.0247 0.0373
NP_442341.1_7 Reverse -52 -66 14.0609 0.0326
NP_442341.1_7 Forward -63 -49 11.2093 0.0567
NP_442341.1_7 Forward -373 -359 2.85119 0.243
NP_442341.1_9 Forward -134 -120 8.55376 0.168
NP_442341.1_9 Forward -64 -50 5.89884 0.252
NP_440119.1_1 Reverse -118 -134 2.22182 0.223
NP_440423.1_6 Forward -70 -51 -16.8151 0.232
NP_440423.1_6 Forward -380 -361 -20.945 0.276
NP_443000.1_7 Reverse -51 -61 19.9412 0.00223
NP_443000.1_7 Forward -64 -54 8.73149 0.0437
NP_443000.1_7 Forward -374 -364 0.57002 0.294
NP_440727.1_3 Forward -104 -85 12.6841 0.29
NP_440275.1_3 Reverse -51 -61 15.123 0.0182
NP_440275.1_3 Forward -64 -54 8.4365 0.0602
NP_440275.1_3 Forward -374 -364 2.7333 0.254
NP_442932.1_9 Reverse -265 -284 7.37428 0.241
NP_440091.1_1 Forward -66 -54 1.41561 0.197
NP_440091.1_1 Reverse -49 -61 1.31728 0.198
NP_441307.1_6 Forward -143 -124 6.98095 0.225
NP_442354.1_2 Forward -145 -126 1.27776 0.299
NP_443010.1_10 Forward -65 -48 4.99337 0.214
NP_442451.1_3 Reverse -38 -57 20.3531 0.258
NP_440149.1_8 Forward -62 -43 -7.76869 0.292
NP_441105.1_3 Forward -73 -54 -6.1954 0.23
NP_441105.1_3 Reverse -42 -61 -6.49039 0.236
NP_440216.1_1 Forward -62 -48 0.0979218 0.0284
NP_440216.1_1 Reverse -53 -67 -2.26202 0.0484
NP_440172.1_1 Forward -62 -52 15.0247 0.00945
NP_440172.1_1 Reverse -53 -63 8.73149 0.0586
NP_442015.1_10 Reverse -49 -62 12.6056 0.0365
NP_442015.1_10 Forward -66 -53 9.36073 0.0503
NP_441226.1_7 Forward -61 -54 14.4934 0.0123
NP_441226.1_7 Reverse -54 -61 14.4934 0.0123
NP_441111.1_7 Forward -61 -53 18.7023 0.00294
NP_441111.1_7 Reverse -54 -62 18.7023 0.00294
NP_441766.1_2 Forward -62 -53 17.5026 0.00297
NP_441766.1_2 Reverse -53 -62 17.5026 0.00297
NP_441766.1_2 Reverse -363 -372 5.01461 0.148
NP_442417.1_5 Reverse -53 -67 11.6026 0.0983
NP_440416.1_9 Forward -69 -50 -12.0953 0.155
NP_440416.1_9 Reverse -46 -65 -18.5851 0.26
NP_440416.1_9 Reverse -303 -322 -20.945 0.289
NP_443052.1_8 Forward -72 -53 -9.24366 0.187
NP_442116.1_6 Reverse -227 -244 5.39969 0.299
NP_442564.1_10 Reverse -262 -276 8.94771 0.296
NP_440261.1_5 Reverse -54 -67 -1.06236 0.0655
NP_440261.1_5 Forward -61 -48 -12.0754 0.27
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACGATTAAGTTCCTAGCAGTTCCTAACTGGCGATCTGGGCCATATTTCCCCGATAAAGCAGCGCAATTGTAAAGAAATGTGGCGGATGTTAAAGCTTAGTTGCAAAAACCGCCCTTTCTCTCCCTTTTCCCCCGGGGGAGTGATACGTTGTAAAACGAAATTTTTCCATAACTTTAATTAATCGGATCAATAACTAAGGGGTGGGGGTTAAAAATCATGTTTGATCGTTCCAACAAAGATTTAATCAGCGCTGGTTTGGTTTCCGCCCTGGGGGCAGGCATTGTGACTTCCTTTGCCGTTAATCAGGGGCAAGACCCCTTTGTTGCTTTGATGATCACGGCGATCGCCAGTGTTTGTGGTATGGTGTGTCACCAGTTTGATCTAATTTGATTTGCCCTCT

CDS

GTGCAGTTTGACGTTCTCACCCTGTTTCCTGATTTTTTTACTTCTCCCCTGCAATCTGGCCTTCTAGGTAAAGCCCTCGAAAAGGCGATCGCCAGCGTTAATTTGATTAACCCCAGGGATTTCACCACGGATAAACATCGCCGGGTGGATGATGAACCCTACGGCGGTGGGGTGGGTATGGTGATCAAACCAGAGCCTATTTTTGCGGCGGTGGAATCGTTGCCAGTACTGTCCAAACGGGAAGTGATTTTAATGACTCCCCAGGGACAGCCCATGGACCAGGCTTTGTTTCGGGAATTGACGAACTATGACCAATTGGTGTTGATCTGTGGCCATTACGAAGGGGTGGACGAAAGAGTCTGCCAACTGGTGACAAGGGAGGTTTCCCTGGGGGATTTTGTGCTCACCTGTGGCGAAATTCCCGCTTTAACTTTAATTAATGGTGTCATCCGTTTACTACCCGGCACCGTGGGCAAAGAAGCATCTTTAATCGCTGAGAGTTTTAGCACCGATCTGTTGGATTATCCCCACTACACCAGGCCGCCAGTGTTCCGGGGCTTGGCCGTGCCCCCAGTGTTACTTTCCGGCAACCACCAGGCGATCGCCCAATGGCGATTGGAACAGCAGGAGGAACGAACCCAACAGAGGCGGCCGGATTTGTGGCAAAAATGGCAAGATCGACAGCCTTCCCCATGA

Protein

MQFDVLTLFPDFFTSPLQSGLLGKALEKAIASVNLINPRDFTTDKHRRVDDEPYGGGVGMVIKPEPIFAAVESLPVLSKREVILMTPQGQPMDQALFRELTNYDQLVLICGHYEGVDERVCQLVTREVSLGDFVLTCGEIPALTLINGVIRLLPGTVGKEASLIAESFSTDLLDYPHYTRPPVFRGLAVPPVLLSGNHQAIAQWRLEQQEERTQQRRPDLWQKWQDRQPSP