Your browser is old and dusty. Try Google Chrome!

Details for sll1191

ORF sll1191
Accession NP_440172.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -303 -317 8.16106 0.0927
NP_441061.1_2 Forward -310 -296 2.65453 0.173
NP_441061.1_3 Forward -39 -20 15.0432 0.217
NP_440795.1_7 Forward -310 -303 14.6904 0.0123
NP_440795.1_7 Reverse -303 -310 14.6904 0.0123
NP_440795.1_7 Forward -349 -342 7.80726 0.232
NP_441418.1_6 Reverse -302 -321 -1.27885 0.013
NP_441418.1_6 Forward -311 -292 -18.4868 0.0832
NP_441418.1_6 Reverse -153 -172 -27.8282 0.203
NP_441418.1_6 Reverse -290 -309 -29.5982 0.23
NP_441418.1_6 Forward -55 -36 -30.2865 0.267
NP_441418.1_6 Forward -359 -340 -30.3848 0.274
NP_440897.1_6 Reverse -302 -321 8.84842 0.0706
NP_440897.1_6 Forward -126 -107 5.99684 0.108
NP_441453.1_1 Forward -397 -379 2.96833 0.281
NP_441453.1_4 Reverse -302 -310 16.539 0.00633
NP_441453.1_4 Forward -311 -303 16.539 0.00633
NP_442151.1_6 Forward -311 -297 20.0591 0.0045
NP_442151.1_6 Reverse -302 -316 8.75105 0.164
NP_442151.1_6 Reverse -33 -47 8.06273 0.183
NP_441818.1_1 Reverse -303 -314 14.2178 0.0541
NP_440226.1_1 Forward -311 -292 4.03102 0.206
NP_442623.1_3 Forward -310 -291 0.982764 0.0521
NP_442287.1_1 Reverse -248 -258 13.0576 0.288
NP_442173.1_1 Forward -310 -302 15.4574 0.00633
NP_442173.1_1 Reverse -303 -311 15.4574 0.00633
NP_442752.1_4 Forward -311 -304 13.8055 0.0199
NP_442752.1_4 Reverse -302 -309 13.8055 0.0199
NP_443027.1_4 Forward -313 -303 7.35486 0.24
NP_442975.1_10 Forward -315 -301 12.5853 0.0477
NP_440784.1_7 Forward -310 -303 15.9687 0.0123
NP_440784.1_7 Reverse -303 -310 15.9687 0.0123
NP_440061.1_3 Forward -141 -122 7.96426 0.278
NP_440061.1_9 Reverse -300 -314 10.422 0.124
NP_440110.1_4 Reverse -291 -310 3.44104 0.225
NP_441476.1_5 Reverse -230 -249 -7.76869 0.29
NP_440878.1_9 Reverse -292 -311 4.81767 0.174
NP_442062.1_8 Reverse -302 -312 17.6796 0.00193
NP_442062.1_8 Forward -311 -301 17.3846 0.00193
NP_442062.1_8 Forward -399 -389 4.79825 0.198
NP_442826.1_3 Forward -392 -373 12.2908 0.121
NP_442974.1_8 Reverse -372 -391 14.8466 0.294
NP_441859.1_2 Forward -60 -41 14.5516 0.178
NP_441859.1_3 Reverse -301 -320 10.7167 0.118
NP_440304.1_4 Forward -313 -303 18.9579 0.00406
NP_440304.1_4 Forward -301 -291 2.63497 0.299
NP_440304.1_4 Reverse -300 -310 1.84832 0.299
NP_442242.1_4 Forward -310 -303 14.3954 0.0124
NP_442242.1_4 Reverse -303 -310 14.3954 0.0124
NP_439918.1_3 Reverse -299 -318 7.57094 0.252
NP_441208.1_9 Reverse -299 -313 6.98109 0.229
NP_442110.1_7 Forward -311 -297 10.6193 0.0644
NP_441082.1_10 Forward -262 -249 10.8357 0.236
NP_442726.1_7 Forward -318 -300 -1.45582 0.296
NP_440330.1_2 Reverse -320 -339 11.7992 0.282
NP_440856.1_4 Reverse -295 -314 -1.27885 0.195
NP_440856.1_4 Forward -306 -287 -4.13045 0.25
NP_440856.1_7 Forward -58 -39 -1.47551 0.182
NP_441083.1_5 Forward -311 -301 20.3345 0.00053
NP_441083.1_5 Reverse -302 -312 19.3512 0.000718
NP_439957.1_9 Reverse -63 -82 2.81659 0.3
NP_441738.1_2 Forward -309 -302 15.28 0.0102
NP_441738.1_2 Reverse -304 -311 15.28 0.0102
NP_441558.1_5 Forward -313 -294 12.3892 0.0679
NP_440209.1_1 Reverse -302 -310 18.1123 0.00295
NP_440209.1_1 Forward -311 -303 18.1123 0.00295
NP_442889.1_1 Reverse -314 -333 -4.22878 0.152
NP_442889.1_8 Forward -314 -300 19.1735 0.0084
NP_440056.1_9 Reverse -285 -304 12.7015 0.295
NP_441713.1_3 Forward -320 -301 5.01433 0.253
NP_440178.1_7 Forward -312 -293 -12.0953 0.112
NP_441716.1_1 Reverse -302 -316 10.226 0.0968
NP_441716.1_1 Forward -311 -297 3.93283 0.259
NP_442111.1_4 Reverse -301 -315 19.2725 0.00439
NP_442111.1_4 Forward -312 -298 9.63603 0.0593
NP_441163.1_9 Forward -320 -301 13.7658 0.236
NP_440906.1_5 Forward -310 -303 15.8704 0.0124
NP_440906.1_5 Reverse -303 -310 15.8704 0.0124
NP_440747.1_7 Reverse -277 -295 15.9488 0.28
NP_440747.1_10 Reverse -299 -311 24.7201 0.00036
NP_440747.1_10 Forward -314 -302 -2.02597 0.0196
NP_440747.1_10 Reverse -148 -160 -12.0557 0.199
NP_441486.1_1 Reverse -299 -313 12.8809 0.00979
NP_441486.1_1 Forward -314 -300 5.80112 0.0344
NP_441880.2_10 Forward -349 -331 10.3439 0.208
NP_442634.1_4 Forward -313 -299 -2.75368 0.156
NP_441265.1_3 Reverse -296 -310 2.85119 0.181
NP_440403.1_10 Reverse -341 -360 1.67108 0.288
NP_440842.1_10 Forward -314 -300 0.982901 0.296
NP_441014.1_8 Forward -283 -264 -6.39206 0.276
NP_441014.1_8 Forward -49 -30 -7.67036 0.281
NP_441014.1_10 Reverse -301 -320 -1.77127 0.265
NP_442848.1_1 Forward -317 -303 -1.47537 0.263
NP_442848.1_9 Reverse -332 -351 0.196116 0.275
NP_442848.1_9 Forward -219 -200 -1.57384 0.293
NP_441012.1_4 Forward -59 -46 7.29578 0.272
NP_443018.1_3 Forward -310 -303 14.8871 0.0123
NP_443018.1_3 Reverse -303 -310 14.8871 0.0123
NP_441316.1_7 Forward -313 -298 4.69978 0.121
NP_441634.1_8 Reverse -330 -344 -2.65535 0.295
NP_440376.1_1 Forward -311 -302 19.4693 0.000692
NP_440376.1_1 Reverse -302 -311 19.4693 0.000692
NP_440376.1_1 Forward -399 -390 4.42462 0.159
NP_440376.1_1 Reverse -34 -43 3.63797 0.2
NP_440376.1_1 Forward -299 -290 2.16301 0.233
NP_441588.1_4 Forward -309 -299 9.02648 0.14
NP_442730.1_8 Reverse -294 -313 6.58682 0.228
NP_443065.1_6 Forward -351 -332 9.14423 0.151
NP_442687.1_7 Forward -312 -302 18.5646 0.0028
NP_442687.1_7 Reverse -301 -311 8.92815 0.0994
NP_442687.1_7 Reverse -389 -399 3.71661 0.292
NP_442191.1_4 Reverse -291 -305 10.7992 0.288
NP_442485.1_3 Reverse -44 -63 -4.03212 0.277
NP_442485.1_3 Forward -66 -47 -4.72043 0.285
NP_442485.1_3 Reverse -35 -54 -5.60541 0.293
NP_440642.1_10 Reverse -93 -107 1.5723 0.29
NP_441013.1_2 Reverse -124 -142 4.9357 0.222
NP_441013.1_2 Reverse -297 -315 -3.6191 0.29
NP_440042.1_2 Forward -321 -302 -0.000545616 0.22
NP_441422.1_7 Reverse -336 -353 -0.452814 0.168
NP_441422.1_7 Forward -291 -274 -1.53445 0.194
NP_441950.1_8 Reverse -337 -351 8.06273 0.209
NP_441950.1_8 Forward -65 -51 4.71948 0.292
NP_442296.1_9 Forward -310 -291 4.42435 0.156
NP_442658.1_1 Forward -313 -303 14.8275 0.0188
NP_442658.1_1 Reverse -300 -310 6.76441 0.214
NP_440141.1_8 Reverse -40 -59 7.7676 0.236
NP_440141.1_8 Forward -320 -301 5.60432 0.273
NP_441855.2_4 Forward -319 -300 11.9332 0.204
NP_442782.1_2 Reverse -46 -60 6.19444 0.229
NP_441414.1_9 Reverse -302 -321 3.6377 0.0578
NP_441414.1_9 Forward -311 -292 -8.06369 0.229
NP_443061.1_10 Reverse -49 -68 17.8957 0.269
NP_442937.1_5 Reverse -297 -316 6.39097 0.28
NP_442937.1_5 Reverse -28 -47 5.80098 0.3
NP_441958.1_5 Forward -312 -302 20.5312 0.000966
NP_441958.1_5 Reverse -301 -311 12.2714 0.00183
NP_441127.1_1 Reverse -332 -346 12.4876 0.213
NP_441127.1_1 Reverse -58 -72 8.35772 0.3
NP_442836.1_10 Forward -258 -248 11.1898 0.269
NP_440203.1_5 Forward -308 -298 14.2375 0.0886
NP_440984.1_7 Reverse -297 -311 9.34103 0.127
NP_440984.1_7 Reverse -286 -300 6.3911 0.217
NP_439990.1_5 Reverse -297 -310 11.229 0.128
NP_442911.1_2 Forward -321 -302 14.8474 0.0112
NP_442911.1_2 Reverse -292 -311 -0.983855 0.0804
NP_442911.1_2 Forward -357 -338 -4.52377 0.136
NP_442911.1_2 Reverse -130 -149 -10.6203 0.284
NP_440153.1_8 Reverse -40 -53 -2.63565 0.246
NP_442064.1_4 Forward -321 -302 6.98015 0.246
NP_441099.1_5 Reverse -292 -311 0.687771 0.0744
NP_441099.1_5 Forward -321 -302 -2.26216 0.12
NP_442002.1_9 Forward -312 -305 14.1004 0.074
NP_440809.1_9 Forward -320 -302 -7.55234 0.225
NP_441646.1_1 Reverse -268 -287 -1.08219 0.278
NP_442438.1_10 Reverse -297 -311 9.04604 0.0692
NP_442438.1_10 Reverse -135 -149 6.48943 0.114
NP_442438.1_10 Forward -352 -338 0.294584 0.232
NP_442431.1_10 Forward -60 -42 3.85406 0.213
NP_441000.1_9 Forward -224 -205 18.0059 0.229
NP_442771.1_1 Forward -313 -295 3.95239 0.0672
NP_442771.1_1 Reverse -300 -318 -7.35568 0.17
NP_440147.1_4 Reverse -300 -313 11.6223 0.0326
NP_440147.1_4 Forward -313 -300 4.05085 0.173
NP_441550.1_8 Forward -313 -303 15.4175 0.0132
NP_441550.1_8 Reverse -300 -310 14.6309 0.0132
NP_441916.1_7 Reverse -302 -312 16.893 0.00407
NP_441916.1_7 Forward -311 -301 10.3048 0.0261
NP_441916.1_10 Forward -307 -288 1.37609 0.264
NP_441041.1_4 Forward -311 -292 7.37428 0.0395
NP_441041.1_4 Reverse -302 -321 -4.91709 0.145
NP_441041.1_4 Reverse -290 -309 -13.7669 0.295
NP_441041.1_7 Reverse -299 -311 8.58373 0.133
NP_442642.1_9 Forward -318 -301 4.3654 0.192
NP_440569.1_6 Forward -101 -82 5.01433 0.24
NP_442004.1_6 Forward -311 -297 5.80112 0.181
NP_442004.1_6 Reverse -302 -316 2.16287 0.273
NP_441725.1_4 Forward -316 -302 9.04542 0.178
NP_441725.1_5 Reverse -303 -313 21.0229 0.00533
NP_441725.1_5 Forward -310 -300 2.04498 0.115
NP_441725.1_8 Reverse -36 -55 15.8307 0.132
NP_439966.1_7 Forward -313 -303 9.12434 0.119
NP_439966.1_7 Reverse -300 -310 7.25606 0.15
NP_442941.1_3 Reverse -303 -313 11.3864 0.0116
NP_442941.1_3 Forward -310 -300 11.0914 0.0116
NP_440289.1_2 Forward -314 -301 13.0973 0.0132
NP_440289.1_2 Reverse -299 -312 -2.144 0.251
NP_440289.1_2 Reverse -387 -400 -4.60227 0.29
NP_440983.1_5 Reverse -34 -53 -5.11376 0.263
NP_440260.1_8 Reverse -293 -311 4.05072 0.157
NP_441514.1_6 Forward -99 -92 12.7238 0.29
NP_442281.1_1 Reverse -297 -311 17.6002 0.00542
NP_442281.1_1 Forward -316 -302 12.2903 0.0385
NP_441334.1_7 Forward -313 -294 -12.8819 0.175
NP_441334.1_7 Reverse -333 -352 -21.1417 0.29
NP_442256.1_2 Reverse -300 -318 -0.669169 0.142
NP_442256.1_2 Forward -313 -295 -5.68405 0.214
NP_440437.1_1 Reverse -281 -300 -5.31042 0.28
NP_442012.1_1 Reverse -296 -315 9.83255 0.0878
NP_441556.1_4 Forward -320 -301 20.8027 0.0346
NP_441556.1_10 Reverse -297 -311 14.018 0.178
NP_441556.1_10 Forward -346 -332 14.018 0.178
NP_440498.1_1 Reverse -293 -311 8.18062 0.0795
NP_442982.1_5 Reverse -292 -311 -2.45882 0.286
NP_441644.1_6 Forward -311 -301 17.3841 0.00127
NP_441644.1_6 Reverse -302 -312 15.7125 0.0048
NP_440867.1_10 Reverse -287 -306 4.22769 0.283
NP_442215.1_2 Reverse -300 -316 8.02334 0.0666
NP_442215.1_2 Forward -313 -297 7.72835 0.0674
NP_442215.1_2 Reverse -31 -47 -2.69473 0.202
NP_442177.1_5 Forward -261 -247 9.73436 0.236
NP_442029.1_6 Forward -54 -35 5.50599 0.25
NP_442029.1_10 Forward -348 -329 12.9791 0.158
NP_442029.1_10 Reverse -287 -306 4.52268 0.29
NP_442247.1_8 Reverse -300 -314 10.9143 0.247
NP_440253.1_2 Reverse -302 -320 3.65739 0.114
NP_440253.1_2 Reverse -341 -359 3.55906 0.116
NP_440929.1_8 Forward -311 -302 19.2726 0.000701
NP_440929.1_8 Reverse -302 -311 19.2726 0.000701
NP_442933.1_10 Forward -311 -302 17.601 0.00325
NP_442933.1_10 Reverse -302 -311 17.601 0.00325
NP_441751.2_8 Reverse -303 -317 -2.26202 0.132
NP_442926.1_3 Forward -310 -291 2.55606 0.295
NP_442554.1_8 Forward -310 -300 15.3197 0.00882
NP_442554.1_8 Reverse -303 -313 14.828 0.0108
NP_442554.1_8 Reverse -141 -151 2.63497 0.265
NP_441762.1_7 Forward -312 -300 8.9871 0.0142
NP_441762.1_7 Reverse -340 -352 -5.46756 0.212
NP_441762.1_7 Reverse -301 -313 -6.94252 0.284
NP_442142.1_4 Forward -314 -301 5.91857 0.178
NP_442142.1_4 Reverse -299 -312 5.52525 0.188
NP_442142.1_4 Forward -320 -307 3.7553 0.246
NP_442292.1_1 Forward -310 -301 18.486 0.00229
NP_442292.1_1 Reverse -303 -312 9.53783 0.0183
NP_442381.1_2 Forward -44 -30 21.2391 0.105
NP_443009.1_5 Reverse -301 -312 15.7911 0.0107
NP_443009.1_5 Forward -312 -301 11.1696 0.066
NP_443009.1_5 Forward -400 -389 6.05637 0.177
NP_441715.1_4 Forward -310 -300 7.94484 0.107
NP_441715.1_4 Reverse -303 -313 7.25653 0.108
NP_440158.1_8 Reverse -300 -319 9.14423 0.285
NP_442076.1_5 Reverse -377 -396 6.39097 0.264
NP_440183.1_9 Forward -56 -37 -20.8467 0.292
NP_441198.1_1 Reverse -34 -53 2.16274 0.235
NP_441198.1_8 Forward -313 -303 13.076 0.108
NP_440379.1_5 Forward -64 -45 -3.3438 0.204
NP_440379.1_5 Forward -308 -289 -11.6036 0.299
NP_440464.1_10 Forward -310 -300 13.0082 0.169
NP_441468.1_1 Forward -310 -303 15.8704 0.0124
NP_441468.1_1 Reverse -303 -310 15.8704 0.0124
NP_441020.2_6 Reverse -300 -317 17.5418 0.0183
NP_441020.2_6 Forward -313 -296 10.4619 0.142
NP_441015.1_10 Forward -54 -35 6.29264 0.109
NP_441673.1_1 Forward -311 -302 20.8459 0.000698
NP_441673.1_1 Reverse -302 -311 20.8459 0.000698
NP_441731.1_3 Reverse -294 -313 -6.1954 0.29
NP_441731.1_9 Reverse -337 -354 11.2486 0.275
NP_441016.2_6 Reverse -243 -262 6.88182 0.25
NP_441826.1_2 Reverse -296 -310 6.98109 0.0899
NP_441826.1_2 Forward -329 -315 3.73617 0.106
NP_441826.1_2 Forward -317 -303 3.04785 0.115
NP_441826.1_2 Reverse -335 -349 -2.26202 0.269
NP_442490.1_9 Forward -323 -304 1.86774 0.165
NP_442868.1_6 Reverse -300 -310 9.81313 0.038
NP_442868.1_6 Forward -313 -303 9.22315 0.0527
NP_441056.1_1 Forward -311 -292 -4.32711 0.249
NP_441612.1_2 Forward -126 -116 15.1326 0.21
NP_441612.1_2 Forward -311 -301 8.54929 0.21
NP_442361.1_3 Reverse -296 -309 17.7189 0.0481
NP_442808.1_1 Forward -312 -302 8.73102 0.0481
NP_442808.1_1 Reverse -301 -311 8.63269 0.0481
NP_442050.1_5 Forward -313 -303 15.8108 0.0091
NP_442050.1_5 Reverse -300 -310 7.64939 0.243
NP_441493.2_10 Reverse -291 -310 7.86593 0.249
NP_441114.1_3 Forward -328 -319 6.39124 0.277
NP_440558.1_2 Forward -320 -301 -2.16383 0.223
NP_440558.1_2 Forward -344 -325 -5.60541 0.262
NP_440558.1_2 Reverse -293 -312 -6.09707 0.271
NP_440111.2_2 Forward -322 -303 -2.95047 0.261
NP_441878.1_6 Forward -312 -302 20.2362 0.0046
NP_441878.1_6 Reverse -301 -311 10.4031 0.0176
NP_441878.1_6 Reverse -274 -284 0.963343 0.128
NP_441878.1_6 Forward -400 -390 -6.11649 0.191
NP_441878.1_6 Forward -127 -117 -7.98478 0.285
NP_441878.1_6 Forward -43 -33 -7.98478 0.285
NP_441036.1_8 Forward -312 -302 8.4365 0.174
NP_441036.1_8 Reverse -301 -311 8.33817 0.174
NP_442650.1_2 Forward -311 -297 8.25939 0.13
NP_441557.1_5 Forward -311 -302 19.9609 0.000699
NP_441557.1_5 Reverse -302 -311 19.9609 0.000699
NP_441445.1_3 Reverse -306 -325 11.8975 0.22
NP_442469.1_8 Reverse -278 -292 18.6825 0.167
NP_442192.1_8 Reverse -331 -350 10.9142 0.259
NP_442183.1_1 Reverse -302 -316 20.6491 0.00378
NP_441459.1_8 Forward -318 -305 14.6706 0.286
NP_441574.1_1 Reverse -302 -321 -6.1954 0.276
NP_441238.1_10 Forward -136 -122 10.6193 0.292
NP_442347.1_2 Forward -310 -301 12.4878 0.056
NP_442347.1_2 Reverse -303 -312 3.34298 0.284
NP_442645.1_2 Reverse -294 -313 -22.8133 0.296
NP_442888.1_8 Reverse -277 -296 13.5691 0.179
NP_441037.1_4 Forward -313 -303 9.65667 0.21
NP_441037.1_4 Reverse -300 -310 7.9999 0.237
NP_441633.1_3 Reverse -300 -313 10.5407 0.0286
NP_440136.1_2 Forward -310 -303 15.9687 0.0123
NP_440136.1_2 Reverse -303 -310 15.9687 0.0123
NP_442590.1_9 Reverse -286 -305 5.30933 0.273
NP_442590.1_10 Reverse -314 -333 9.0459 0.2
NP_442590.1_10 Forward -311 -292 5.99764 0.254
NP_442998.1_5 Forward -115 -105 7.84651 0.28
NP_442998.1_10 Forward -309 -302 15.5754 0.0102
NP_442998.1_10 Reverse -304 -311 15.5754 0.0102
NP_440731.1_2 Reverse -290 -309 7.57094 0.275
NP_440299.1_1 Reverse -298 -311 22.3398 0.000547
NP_440299.1_1 Forward -315 -302 19.4882 0.00234
NP_440299.1_1 Forward -348 -335 4.34528 0.209
NP_441799.1_1 Forward -315 -301 4.42388 0.25
NP_442802.1_2 Reverse -39 -58 15.9282 0.203
NP_441007.1_10 Forward -54 -41 7.29578 0.145
NP_441007.1_10 Reverse -297 -310 -0.669033 0.287
NP_441007.1_10 Forward -316 -303 -0.865694 0.295
NP_441435.1_6 Forward -63 -44 2.75272 0.259
NP_442333.2_1 Forward -343 -324 -10.3253 0.288
NP_440256.1_1 Reverse -299 -318 12.9791 0.0106
NP_440256.1_1 Forward -95 -76 -9.83364 0.289
NP_441559.1_8 Forward -345 -331 2.2612 0.147
NP_441559.1_8 Reverse -297 -311 -6.88358 0.281
NP_440915.1_6 Reverse -298 -312 11.5043 0.0256
NP_440915.1_6 Reverse -271 -285 5.50613 0.0898
NP_440915.1_6 Forward -315 -301 5.40779 0.0903
NP_441179.1_9 Forward -170 -160 9.12434 0.284
NP_442069.1_1 Reverse -41 -60 16.7149 0.266
NP_440695.1_5 Reverse -302 -321 8.16093 0.15
NP_441939.1_3 Reverse -303 -322 6.19431 0.248
NP_441199.1_6 Reverse -298 -317 4.52268 0.164
NP_442993.1_1 Forward -36 -20 -9.87289 0.197
NP_442993.1_1 Forward -347 -331 -11.0529 0.233
NP_440677.1_1 Forward -320 -301 14.9458 0.105
NP_440677.1_1 Forward -135 -116 11.0125 0.163
NP_440677.1_1 Reverse -293 -312 6.88262 0.247
NP_442386.1_9 Reverse -301 -310 13.8639 0.0289
NP_442386.1_9 Forward -312 -303 6.39082 0.219
NP_442386.1_10 Forward -258 -245 4.24752 0.265
NP_440570.1_5 Reverse -292 -311 12.1925 0.132
NP_441340.1_5 Forward -310 -303 15.6737 0.0124
NP_441340.1_5 Reverse -303 -310 15.6737 0.0124
NP_442186.1_9 Forward -313 -294 9.0459 0.228
NP_442484.1_2 Reverse -291 -310 16.1257 0.035
NP_442484.1_2 Forward -60 -41 6.78429 0.156
NP_442484.1_2 Reverse -256 -275 -0.39387 0.262
NP_440168.1_4 Reverse -292 -311 -3.44213 0.255
NP_440168.1_8 Forward -356 -337 1.17943 0.3
NP_442714.1_5 Reverse -333 -352 0.884433 0.253
NP_442714.1_5 Reverse -41 -60 -0.295539 0.272
NP_440586.1_1 Reverse -30 -49 -5.31042 0.285
NP_440586.1_8 Forward -310 -303 13.2151 0.026
NP_440586.1_8 Reverse -303 -310 13.2151 0.026
NP_442874.1_1 Reverse -35 -54 16.2241 0.107
NP_442251.1_6 Forward -310 -303 15.2804 0.0124
NP_442251.1_6 Reverse -303 -310 15.2804 0.0124
NP_440192.1_4 Forward -343 -324 11.8231 0.2
NP_440684.1_9 Reverse -332 -346 11.406 0.177
NP_441262.1_2 Forward -329 -315 19.5875 0.182
NP_441262.1_3 Reverse -302 -309 14.7888 0.0223
NP_441262.1_3 Forward -311 -304 14.7888 0.0223
NP_440027.1_3 Forward -292 -274 2.77167 0.286
NP_443051.1_1 Forward -312 -303 18.0926 0.00402
NP_443051.1_1 Reverse -301 -310 10.4228 0.00754
NP_439937.1_8 Reverse -336 -355 2.45773 0.216
NP_439937.1_8 Reverse -44 -63 0.294447 0.235
NP_439937.1_8 Forward -63 -44 -3.14714 0.265
NP_439937.1_9 Reverse -301 -318 -16.5797 0.287
NP_440408.1_3 Forward -329 -310 -5.21209 0.284
NP_440408.1_3 Forward -61 -42 -5.80207 0.295
NP_440408.1_7 Forward -317 -298 9.3409 0.262
NP_440408.1_7 Forward -311 -292 7.96426 0.284
NP_440439.1_1 Reverse -299 -312 2.2809 0.136
NP_440439.1_1 Forward -287 -274 0.510939 0.188
NP_440372.1_2 Forward -310 -303 16.3621 0.0124
NP_440372.1_2 Reverse -303 -310 16.3621 0.0124
NP_441789.1_7 Forward -294 -275 -4.52452 0.283
NP_441803.1_2 Reverse -41 -60 3.34271 0.191
NP_441803.1_2 Forward -291 -272 3.04771 0.197
NP_441803.1_2 Forward -54 -35 0.58944 0.249
NP_439977.1_5 Reverse -296 -315 5.40766 0.15
NP_440139.1_1 Forward -317 -298 11.2084 0.0835
NP_442384.1_10 Reverse -302 -315 18.3088 0.00492
NP_442384.1_10 Forward -311 -298 17.4239 0.00585
NP_441018.1_7 Forward -153 -134 11.2092 0.19
NP_441018.1_7 Forward -262 -243 10.3242 0.209
NP_441018.1_7 Reverse -298 -317 7.47261 0.269
NP_442262.1_10 Forward -310 -303 14.1988 0.0123
NP_442262.1_10 Reverse -303 -310 14.1988 0.0123
NP_441689.1_5 Forward -313 -303 8.63269 0.132
NP_441689.1_5 Reverse -300 -310 5.78111 0.197
NP_440163.1_10 Reverse -335 -345 10.5998 0.201
NP_440344.1_10 Forward -318 -301 16.8534 0.0034
NP_440344.1_10 Forward -27 -10 -9.20427 0.141
NP_440344.1_10 Forward -62 -45 -9.79426 0.156
NP_440282.1_10 Forward -321 -302 -9.44032 0.28
NP_442123.1_3 Reverse -302 -321 10.1275 0.294
NP_442910.1_1 Reverse -295 -314 -6.09707 0.254
NP_440562.1_3 Forward -310 -293 7.02034 0.15
NP_441965.1_10 Forward -314 -298 12.8416 0.105
NP_441965.1_10 Forward -301 -285 2.41848 0.288
NP_440297.1_9 Reverse -303 -313 19.0562 0.0359
NP_440297.1_9 Forward -310 -300 -0.118297 0.282
NP_440100.1_3 Reverse -146 -165 -1.96717 0.166
NP_441592.1_4 Forward -304 -285 -1.57384 0.254
NP_441592.1_4 Forward -20 -1 -2.95047 0.274
NP_440894.1_10 Forward -316 -297 2.65439 0.286
NP_443036.1_1 Reverse -339 -358 10.9134 0.261
NP_440999.1_9 Forward -351 -337 4.52282 0.116
NP_440999.1_9 Reverse -298 -312 0.982901 0.172
NP_440888.1_2 Forward -311 -297 10.717 0.0861
NP_440888.1_2 Reverse -302 -316 9.73373 0.116
NP_440600.1_4 Forward -319 -301 -7.749 0.294
NP_440491.1_1 Forward -314 -295 10.8153 0.18
NP_440052.1_5 Reverse -291 -310 -0.4922 0.191
NP_442033.1_10 Forward -352 -333 -6.58872 0.186
NP_442033.1_10 Forward -313 -294 -9.24366 0.212
NP_441123.1_6 Reverse -294 -312 14.3755 0.132
NP_441543.1_2 Forward -310 -301 16.9127 0.00359
NP_441543.1_2 Reverse -303 -312 9.34117 0.0818
NP_441543.1_3 Reverse -246 -260 11.1104 0.204
NP_442845.1_2 Forward -311 -297 7.37441 0.195
NP_442845.1_2 Reverse -296 -310 5.70279 0.225
NP_440380.1_1 Reverse -332 -351 -9.83364 0.267
NP_441469.1_8 Forward -312 -303 13.3727 0.073
NP_441469.1_8 Reverse -139 -148 11.9961 0.136
NP_441469.1_8 Reverse -301 -310 6.48957 0.227
NP_443064.1_6 Reverse -302 -312 13.8273 0.0796
NP_443064.1_6 Forward -311 -301 12.5669 0.0796
NP_442578.1_7 Forward -310 -303 14.5921 0.026
NP_442578.1_7 Reverse -303 -310 14.5921 0.026
NP_441462.1_2 Reverse -302 -312 20.1379 0.000967
NP_441462.1_2 Forward -311 -301 11.5831 0.00406
NP_441621.1_7 Reverse -339 -353 12.6843 0.0393
NP_441621.1_7 Forward -313 -299 -4.7203 0.242
NP_441621.1_7 Reverse -44 -58 -5.21195 0.248
NP_443062.1_1 Forward -311 -293 6.59578 0.195
NP_443062.1_1 Reverse -302 -320 6.49827 0.198
NP_441601.1_7 Reverse -333 -352 11.4058 0.201
NP_442204.1_1 Reverse -298 -309 8.7118 0.0852
NP_442204.1_1 Forward -315 -304 0.353664 0.281
NP_442204.1_5 Forward -52 -33 -0.197208 0.28
NP_442697.1_1 Reverse -227 -246 8.75091 0.277
NP_442487.1_2 Reverse -35 -54 3.24359 0.232
NP_440516.1_8 Forward -311 -302 16.9127 0.00442
NP_440516.1_8 Reverse -302 -311 16.9127 0.00442
NP_442428.1_4 Forward -312 -293 5.60432 0.211
NP_442428.1_5 Forward -310 -303 15.8704 0.0124
NP_442428.1_5 Reverse -303 -310 15.8704 0.0124
NP_440783.1_5 Reverse -332 -351 -5.80207 0.285
NP_442120.1_10 Forward -383 -364 -14.3569 0.288
NP_442120.1_10 Forward -250 -231 -15.6352 0.294
NP_440673.1_2 Reverse -331 -350 12.3406 0.149
NP_440673.1_2 Forward -71 -52 9.31652 0.248
NP_440673.1_3 Forward -309 -302 12.4288 0.0426
NP_440673.1_3 Reverse -304 -311 12.4288 0.0426
NP_440865.1_9 Reverse -332 -351 -5.99873 0.218
NP_441052.1_2 Forward -311 -301 19.9412 0.00106
NP_441052.1_2 Reverse -302 -312 10.4031 0.0285
NP_441052.1_2 Forward -126 -116 0.963343 0.255
NP_442219.1_9 Forward -310 -301 17.7976 0.00718
NP_442219.1_9 Reverse -303 -312 8.25953 0.0681
NP_440436.1_4 Forward -310 -301 17.2072 0.00233
NP_440436.1_4 Reverse -303 -312 15.9289 0.00508
NP_441884.1_9 Forward -314 -295 -14.3569 0.138
NP_441893.1_10 Reverse -51 -70 12.2908 0.229
NP_442864.1_3 Reverse -296 -315 8.45592 0.233
NP_440314.1_9 Forward -310 -291 -6.88371 0.233
NP_441719.1_4 Forward -310 -303 16.3621 0.0124
NP_441719.1_4 Reverse -303 -310 16.3621 0.0124
NP_441733.1_10 Reverse -299 -312 5.62415 0.21
NP_441004.1_1 Forward -132 -113 -13.2752 0.256
NP_441004.1_1 Forward -317 -298 -16.8151 0.287
NP_442366.1_3 Forward -312 -294 9.0656 0.0584
NP_442366.1_5 Reverse -299 -309 14.0409 0.0497
NP_440129.1_10 Forward -318 -304 16.0275 0.0373
NP_442873.1_3 Forward -321 -302 9.53674 0.182
NP_443029.1_8 Forward -64 -45 11.7008 0.293
NP_442206.1_1 Reverse -302 -321 -12.4886 0.228
NP_442206.1_10 Forward -311 -296 3.71647 0.181
NP_442206.1_10 Reverse -153 -168 1.15987 0.236
NP_440328.1_4 Forward -48 -29 1.17943 0.232
NP_440094.1_9 Reverse -301 -320 -0.787193 0.199
NP_441228.1_8 Forward -346 -327 9.73422 0.235
NP_443054.1_2 Forward -313 -299 3.44117 0.24
NP_441851.1_10 Forward -312 -302 17.4829 0.0027
NP_441851.1_10 Reverse -301 -311 15.8113 0.00552
NP_442856.1_7 Reverse -293 -312 3.14605 0.151
NP_442515.1_1 Reverse -301 -315 13.9626 0.0278
NP_442515.1_1 Forward -312 -298 -4.91696 0.298
NP_441396.1_1 Reverse -131 -150 2.75272 0.27
NP_441396.1_2 Reverse -101 -118 25.8007 0.00177
NP_440593.1_1 Forward -137 -118 12.8808 0.298
NP_440593.1_3 Reverse -297 -316 -0.000545616 0.198
NP_440593.1_3 Forward -54 -35 -0.983855 0.211
NP_440593.1_3 Forward -328 -309 -6.98204 0.285
NP_440463.1_8 Reverse -273 -292 18.4397 0.0813
NP_440463.1_8 Forward -59 -40 16.3099 0.158
NP_440940.1_7 Reverse -36 -54 3.26332 0.274
NP_441349.1_10 Reverse -328 -347 -6.1954 0.223
NP_441349.1_10 Reverse -292 -311 -8.65367 0.278
NP_440432.1_9 Reverse -303 -318 0.176559 0.159
NP_442843.1_1 Forward -275 -256 -12.0953 0.298
NP_439960.1_10 Forward -59 -41 -3.81576 0.282
NP_440474.1_8 Reverse -53 -67 4.71887 0.268
NP_442450.1_5 Forward -313 -303 19.1546 0.0103
NP_442450.1_5 Reverse -300 -310 7.55152 0.13
NP_442168.1_5 Forward -310 -291 6.88262 0.187
NP_440588.1_2 Reverse -293 -312 7.27595 0.0502
NP_440588.1_2 Reverse -108 -127 -4.72043 0.226
NP_440588.1_2 Reverse -286 -305 -5.60541 0.256
NP_440588.1_3 Forward -114 -95 8.55425 0.296
NP_442006.1_2 Forward -305 -288 -8.12263 0.192
NP_442006.1_2 Reverse -40 -57 -17.1691 0.27
NP_441003.1_9 Reverse -293 -312 3.14605 0.298
NP_442243.1_1 Reverse -296 -314 4.73828 0.193
NP_442243.1_1 Forward -49 -31 1.00172 0.22
NP_441570.1_1 Forward -311 -293 -1.16082 0.0543
NP_441570.1_1 Reverse -302 -320 -7.25734 0.0879
NP_441078.1_4 Forward -311 -302 19.6659 0.0007
NP_441078.1_4 Reverse -302 -311 19.6659 0.0007
NP_442729.1_5 Forward -306 -296 13.648 0.228
NP_442729.1_8 Forward -315 -302 18.2105 0.0325
NP_442348.1_2 Forward -400 -391 13.1761 0.206
NP_440526.1_3 Forward -310 -299 8.02298 0.126
NP_440526.1_3 Reverse -303 -314 1.6315 0.267
NP_441432.1_8 Reverse -301 -310 16.8143 0.00595
NP_441432.1_8 Forward -312 -303 8.35786 0.0755
NP_442320.1_4 Forward -137 -118 14.6499 0.267
NP_442320.1_8 Forward -317 -303 4.03116 0.0559
NP_442320.1_8 Reverse -296 -310 -4.32697 0.159
NP_442344.1_7 Forward -310 -291 -7.37537 0.182
NP_441732.1_2 Forward -315 -299 -6.7263 0.0495
NP_441732.1_2 Reverse -298 -314 -7.61128 0.0861
NP_440760.1_1 Forward -311 -292 -12.4886 0.0931
NP_440760.1_1 Reverse -302 -321 -18.5851 0.215
NP_442797.1_7 Reverse -295 -313 10.6389 0.167
NP_442797.1_7 Reverse -281 -299 2.77242 0.238
NP_441945.1_10 Reverse -301 -320 9.73422 0.258
NP_442510.1_5 Forward -58 -39 14.1591 0.22
NP_440713.1_4 Forward -49 -30 1.96607 0.273
NP_442489.1_7 Forward -311 -302 20.1576 0.000695
NP_442489.1_7 Reverse -302 -311 20.1576 0.000695
NP_442489.1_7 Reverse -390 -399 -1.57357 0.213
NP_442489.1_7 Forward -399 -390 -1.6719 0.235
NP_440565.1_7 Reverse -285 -304 -0.0988766 0.25
NP_442079.1_7 Reverse -303 -322 9.14423 0.113
NP_440559.1_1 Forward -310 -301 17.4043 0.00658
NP_440559.1_1 Reverse -303 -312 17.306 0.00658
NP_441659.2_8 Reverse -302 -312 19.3512 0.000966
NP_441659.2_8 Forward -311 -301 18.1713 0.00133
NP_442913.1_10 Reverse -293 -312 11.7992 0.0414
NP_442913.1_10 Reverse -326 -345 -3.54046 0.212
NP_442913.1_10 Forward -51 -32 -5.99873 0.287
NP_441040.1_2 Forward -65 -46 -12.8819 0.264
NP_441800.1_3 Reverse -321 -339 7.39397 0.286
NP_441800.1_7 Reverse -43 -61 -3.91409 0.283
NP_442346.1_5 Forward -312 -302 17.9746 0.00128
NP_442346.1_5 Reverse -301 -311 16.6963 0.00248
NP_442346.1_5 Reverse -313 -323 4.60159 0.281
NP_440545.1_3 Reverse -298 -315 12.3302 0.0212
NP_440831.1_3 Reverse -293 -312 18.3276 0.0578
NP_440486.1_4 Reverse -41 -59 -3.81576 0.231
NP_440459.1_2 Reverse -31 -48 10.3636 0.2
NP_440459.1_2 Forward -302 -285 10.0686 0.21
NP_440010.1_4 Reverse -334 -353 1.17865 0.24
NP_440010.1_10 Forward -54 -35 10.0292 0.209
NP_442311.1_8 Reverse -45 -64 8.35759 0.294
NP_442603.1_7 Reverse -302 -316 16.8135 0.0284
NP_442603.1_7 Forward -311 -297 12.2903 0.1
NP_442603.1_9 Forward -306 -288 0.412472 0.293
NP_441585.1_5 Reverse -251 -270 -0.787962 0.298
NP_441888.1_7 Forward -316 -302 2.94952 0.225
NP_440449.1_6 Reverse -282 -300 6.31057 0.255
NP_441948.1_4 Reverse -264 -282 -4.79907 0.242
NP_441833.1_4 Forward -310 -303 15.9687 0.0124
NP_441833.1_4 Reverse -303 -310 15.9687 0.0124
NP_440912.1_2 Forward -147 -132 19.6461 0.0513
NP_441895.1_3 Reverse -45 -64 -16.8151 0.277
NP_442162.1_9 Forward -310 -303 16.2637 0.0124
NP_442162.1_9 Reverse -303 -310 16.2637 0.0124
NP_440788.1_8 Reverse -51 -70 7.96426 0.286
NP_441915.1_4 Reverse -340 -359 10.1267 0.28
NP_442199.1_5 Forward -319 -300 -2.45882 0.185
NP_442140.1_3 Forward -310 -300 12.2714 0.0632
NP_442140.1_3 Reverse -303 -313 5.68323 0.198
NP_442914.1_8 Forward -60 -41 6.88262 0.237
NP_440875.1_2 Reverse -135 -154 24.6805 0.00505
NP_440875.1_9 Reverse -323 -333 8.5667 0.233
NP_442547.1_7 Reverse -334 -353 16.3545 0.141
NP_441813.1_5 Forward -313 -303 16.1063 0.01
NP_441813.1_5 Reverse -300 -310 8.63316 0.0367
NP_441259.1_3 Reverse -44 -63 9.0459 0.251
NP_440590.1_4 Forward -310 -297 10.934 0.0235
NP_440590.1_4 Reverse -303 -316 -4.60227 0.263
NP_440567.1_1 Forward -310 -296 12.9793 0.0213
NP_440567.1_1 Reverse -303 -317 10.226 0.0385
NP_442497.1_10 Reverse -303 -312 19.8626 0.00532
NP_442497.1_10 Forward -310 -301 10.4228 0.0087
NP_440821.1_4 Forward -313 -303 19.8429 0.00399
NP_440821.1_4 Reverse -300 -310 9.41981 0.0286
NP_441239.1_9 Forward -313 -301 11.7404 0.0551
NP_441239.1_9 Reverse -300 -312 6.92215 0.173
NP_441239.1_9 Forward -286 -274 4.46387 0.253
NP_441727.1_3 Forward -318 -299 3.14605 0.292
NP_440400.1_1 Reverse -79 -98 -0.00131823 0.277
NP_441892.1_1 Forward -320 -303 -2.3211 0.22
NP_440665.1_1 Forward -323 -304 -15.8318 0.275
NP_440604.1_6 Reverse -302 -321 7.07928 0.106
NP_442044.1_9 Reverse -302 -321 2.3594 0.283
NP_440796.1_3 Forward -318 -300 9.75313 0.217
NP_442270.1_9 Reverse -291 -310 -10.4236 0.258
NP_441017.1_6 Forward -315 -301 15.4369 0.103
NP_442138.1_10 Forward -273 -254 -6.78538 0.286
NP_441782.1_5 Forward -57 -38 8.06259 0.278
NP_440546.1_4 Reverse -302 -312 12.8578 0.0572
NP_440546.1_4 Forward -311 -301 10.046 0.109
NP_440546.1_6 Forward -65 -46 7.96426 0.265
NP_440462.1_6 Forward -313 -303 7.84651 0.0699
NP_440462.1_6 Reverse -300 -310 1.35667 0.294
NP_442340.1_3 Forward -56 -37 -4.42544 0.217
NP_442611.1_1 Forward -311 -292 1.76941 0.234
NP_440868.1_4 Reverse -298 -310 6.1355 0.0878
NP_441204.1_1 Forward -320 -301 6.39097 0.263
NP_442499.1_1 Reverse -303 -322 3.53937 0.252
NP_441474.1_1 Reverse -292 -311 5.80018 0.212
NP_442402.1_4 Reverse -109 -128 -6.3928 0.257
NP_442460.1_7 Reverse -34 -53 3.73603 0.22
NP_442039.1_4 Forward -310 -303 15.1821 0.0124
NP_442039.1_4 Reverse -303 -310 15.1821 0.0124
NP_442039.1_7 Reverse -54 -64 8.04317 0.267
NP_440008.1_9 Reverse -296 -315 11.0125 0.21
NP_440825.1_7 Forward -310 -300 12.9096 0.152
NP_442696.1_6 Reverse -244 -263 -2.55715 0.147
NP_442837.1_3 Forward -310 -303 15.7721 0.0124
NP_442837.1_3 Reverse -303 -310 15.7721 0.0124
NP_440160.1_2 Forward -298 -279 -8.35868 0.286
NP_442053.1_1 Forward -311 -302 18.3876 0.0007
NP_442053.1_1 Reverse -302 -311 18.3876 0.0007
NP_440505.1_3 Reverse -300 -310 9.22315 0.122
NP_440505.1_3 Forward -313 -303 7.55152 0.151
NP_440505.1_7 Forward -49 -30 1.47442 0.249
NP_441203.1_1 Forward -310 -291 -9.73531 0.137
NP_440914.1_1 Forward -311 -301 17.5935 0.000537
NP_440914.1_1 Reverse -302 -312 8.51751 0.186
NP_440914.1_1 Reverse -249 -259 7.44401 0.237
NP_442470.1_4 Forward -88 -69 14.5516 0.284
NP_441011.1_8 Reverse -303 -312 14.356 0.0249
NP_441011.1_8 Forward -310 -301 8.25953 0.144
NP_442101.1_10 Reverse -294 -313 19.2723 0.0136
NP_442533.1_6 Forward -311 -302 17.2076 0.00137
NP_442533.1_6 Reverse -302 -311 17.2076 0.00137
NP_442533.1_6 Reverse -290 -299 11.5045 0.0432
NP_442533.1_6 Reverse -33 -42 2.55633 0.25
NP_442533.1_6 Forward -297 -288 2.16301 0.27
NP_442533.1_6 Forward -284 -275 2.16301 0.27
NP_442533.1_6 Forward -49 -40 1.96635 0.28
NP_442232.1_3 Reverse -272 -291 -14.0619 0.287
NP_442232.1_5 Reverse -312 -331 7.96426 0.286
NP_441482.1_7 Forward -317 -303 15.7325 0.00937
NP_441482.1_7 Reverse -296 -310 -8.5552 0.193
NP_441482.1_7 Reverse -40 -54 -9.44018 0.202
NP_439944.1_9 Reverse -303 -313 17.3846 0.00516
NP_439944.1_9 Forward -310 -300 10.5014 0.0887
NP_441697.1_5 Forward -88 -69 -11.6982 0.298
NP_440116.1_5 Reverse -299 -316 23.6383 0.0128
NP_440116.1_8 Forward -310 -291 18.9773 0.00742
NP_440116.1_8 Reverse -303 -322 -7.08038 0.222
NP_441527.1_4 Reverse -62 -81 -0.907597 0.146
NP_441527.1_4 Reverse -61 -80 -3.86785 0.175
NP_441527.1_4 Forward -112 -93 -11.9847 0.285
NP_441527.1_4 Forward -120 -101 -12.1756 0.285
NP_441527.1_4 Reverse -64 -83 -12.9396 0.296
NP_440115.1_6 Reverse -299 -309 9.32148 0.115
NP_440007.1_9 Forward -315 -301 4.03116 0.267
NP_439965.1_1 Reverse -37 -56 -5.99873 0.211
NP_440608.1_6 Forward -310 -291 5.70185 0.242
NP_440572.1_9 Forward -149 -130 13.5691 0.276
NP_441602.1_3 Forward -54 -35 -4.52377 0.268
NP_441972.1_5 Forward -310 -291 8.16093 0.0748
NP_441106.1_1 Forward -312 -303 9.73449 0.0311
NP_441106.1_1 Reverse -301 -310 9.63616 0.0311
NP_439903.1_6 Reverse -299 -318 2.45694 0.226
NP_442588.1_8 Reverse -124 -143 13.3725 0.238
NP_441439.1_7 Forward -95 -76 13.8641 0.139
NP_441286.1_1 Reverse -301 -313 23.9334 0.000767
NP_441286.1_1 Forward -312 -300 3.48056 0.0467
NP_440670.1_8 Forward -311 -302 18.3876 0.000699
NP_440670.1_8 Reverse -302 -311 18.3876 0.000699
NP_440886.1_7 Forward -312 -302 8.04271 0.0805
NP_440886.1_7 Reverse -301 -311 7.94438 0.0805
NP_440886.1_7 Reverse -340 -350 5.48612 0.181
NP_440886.1_7 Reverse -45 -55 5.19112 0.194
NP_440828.1_1 Forward -175 -156 -1.47628 0.287
NP_442614.1_2 Forward -277 -263 11.996 0.172
NP_442614.1_2 Forward -311 -297 8.16106 0.255
NP_440404.1_9 Reverse -224 -243 8.35512 0.25
NP_442072.1_9 Forward -312 -294 -21.2203 0.206
NP_440513.1_7 Reverse -127 -146 14.5524 0.206
NP_441753.1_10 Forward -320 -301 5.50599 0.186
NP_441808.1_8 Forward -54 -35 13.3725 0.201
NP_441808.1_8 Reverse -34 -53 10.5209 0.236
NP_440907.2_8 Reverse -303 -313 9.81266 0.103
NP_440907.2_8 Forward -310 -300 7.64939 0.117
NP_442264.1_2 Reverse -316 -333 8.7903 0.208
NP_441021.1_1 Forward -310 -291 -6.1954 0.177
NP_441021.1_1 Reverse -303 -322 -10.817 0.248
NP_441021.1_4 Reverse -256 -275 9.0459 0.28
NP_440326.1_5 Reverse -300 -313 15.2606 0.179
NP_441463.1_3 Forward -321 -302 12.0942 0.0421
NP_441626.1_2 Forward -310 -303 15.7721 0.0124
NP_441626.1_2 Reverse -303 -310 15.7721 0.0124
NP_442365.1_7 Reverse -298 -317 -1.7705 0.196
NP_442209.1_4 Reverse -92 -111 8.35759 0.299
NP_442794.1_1 Reverse -298 -310 21.9668 0.00123
NP_442794.1_1 Forward -315 -303 7.4138 0.138
NP_442615.1_1 Reverse -293 -311 -0.964162 0.123
NP_442615.1_1 Forward -320 -302 -7.45401 0.291
NP_441962.1_4 Reverse -297 -316 -9.63698 0.218
NP_441962.1_4 Reverse -336 -355 -13.2752 0.271
NP_440387.1_1 Forward -311 -295 13.3332 0.00865
NP_440387.1_1 Reverse -302 -318 8.22001 0.0282
NP_440387.1_1 Reverse -271 -287 -6.62797 0.298
NP_440855.1_1 Reverse -46 -65 0.687771 0.229
NP_441431.1_2 Reverse -338 -352 9.6354 0.181
NP_441431.1_2 Reverse -37 -51 8.3571 0.218
NP_441431.1_2 Reverse -292 -306 6.48882 0.269
NP_441488.1_8 Reverse -297 -311 13.7653 0.146
NP_441836.1_2 Reverse -329 -348 3.44104 0.153
NP_441993.1_1 Forward -311 -292 1.75177 0.27
NP_441174.1_4 Forward -128 -118 14.1397 0.267
NP_440467.1_3 Reverse -291 -310 11.8422 0.265
NP_442323.1_7 Reverse -297 -316 6.88182 0.19
NP_440293.1_3 Reverse -281 -300 -6.68705 0.291
NP_440293.1_9 Reverse -283 -297 12.3106 0.243
NP_440766.1_4 Reverse -298 -312 6.19444 0.104
NP_440766.1_4 Forward -315 -301 0.196253 0.298
NP_439988.1_3 Forward -309 -295 6.3911 0.278
NP_441237.1_9 Forward -310 -300 14.828 0.0242
NP_441311.1_2 Reverse -296 -310 14.5519 0.229
NP_441311.1_2 Reverse -147 -161 11.5037 0.248
NP_440457.1_1 Forward -315 -303 16.8536 0.0455
NP_440457.1_1 Reverse -298 -310 -0.452677 0.263
NP_440457.1_1 Reverse -271 -283 -0.74767 0.273
NP_440798.1_6 Forward -310 -297 4.34585 0.145
NP_442680.1_5 Forward -128 -109 8.18053 0.171
NP_440801.1_8 Forward -312 -293 1.27776 0.246
NP_440142.1_7 Forward -310 -291 10.1275 0.203
NP_441984.1_3 Reverse -331 -349 10.3439 0.187
NP_441889.1_4 Reverse -293 -312 12.4875 0.0842
NP_441436.1_8 Forward -345 -326 10.2259 0.262
NP_440473.1_3 Forward -60 -41 15.3391 0.248
NP_442509.1_4 Forward -283 -264 14.8474 0.237
NP_442509.1_4 Forward -49 -30 13.7658 0.26
NP_442509.1_9 Reverse -302 -312 17.3841 0.00128
NP_442509.1_9 Forward -311 -301 8.14104 0.192
NP_442784.1_9 Forward -51 -32 17.2074 0.0977
NP_442514.1_5 Forward -319 -300 -1.67294 0.202
NP_441159.1_8 Forward -84 -65 0.981987 0.236
NP_440554.1_1 Reverse -134 -148 22.714 0.0133
NP_440554.1_4 Reverse -303 -313 6.96153 0.107
NP_441761.1_7 Forward -93 -74 19.0748 0.145
NP_442737.1_5 Reverse -301 -320 11.3277 0.293
NP_441885.1_5 Forward -311 -301 20.9245 0.000538
NP_441885.1_5 Reverse -302 -312 11.3864 0.00668
NP_440628.1_1 Forward -363 -353 13.1012 0.29
NP_440478.1_4 Reverse -298 -317 13.0775 0.206
NP_442341.1_7 Reverse -301 -315 16.1259 0.0186
NP_442341.1_7 Forward -312 -298 13.8643 0.0334
NP_442341.1_7 Reverse -32 -46 2.35953 0.259
NP_442341.1_9 Forward -313 -299 9.24208 0.155
NP_442395.2_4 Forward -305 -286 1.6703 0.235
NP_440750.1_2 Reverse -221 -240 11.7008 0.112
NP_443000.1_7 Reverse -300 -310 10.3048 0.0345
NP_443000.1_7 Forward -313 -303 8.82982 0.0437
NP_440076.1_5 Reverse -39 -58 23.598 0.00613
NP_440507.2_3 Forward -320 -301 13.2733 0.145
NP_440507.2_3 Reverse -293 -312 7.96345 0.263
NP_441842.1_10 Forward -318 -304 16.3225 0.0311
NP_441842.1_10 Reverse -295 -309 7.37441 0.258
NP_440275.1_3 Forward -313 -303 10.0098 0.0454
NP_440275.1_3 Reverse -300 -310 8.04317 0.0602
NP_442932.1_9 Forward -127 -108 4.71934 0.277
NP_439962.1_4 Reverse -44 -63 -1.18052 0.211
NP_439962.1_4 Reverse -32 -51 -1.57384 0.216
NP_442495.1_3 Forward -56 -38 12.1139 0.259
NP_440149.1_8 Forward -311 -292 4.52268 0.0824
NP_440149.1_8 Forward -55 -36 -5.11376 0.219
NP_441875.1_3 Forward -293 -274 16.5182 0.252
NP_441105.1_3 Forward -322 -303 1.17943 0.117
NP_441105.1_3 Reverse -284 -303 -8.35868 0.272
NP_440216.1_1 Forward -311 -297 -0.492064 0.0284
NP_440216.1_1 Reverse -302 -316 -2.55701 0.0521
NP_440216.1_1 Forward -284 -270 -5.01529 0.118
NP_440216.1_9 Forward -118 -109 6.39124 0.289
NP_440172.1_1 Reverse -302 -312 16.303 0.00854
NP_440172.1_1 Forward -311 -301 15.0247 0.00945
NP_440172.1_2 Forward -266 -247 23.4022 0.0488
NP_442015.1_10 Reverse -298 -311 19.8821 0.00366
NP_442015.1_10 Forward -315 -302 11.1307 0.0375
NP_442015.1_10 Forward -46 -33 4.14919 0.178
NP_442015.1_10 Reverse -310 -323 3.36254 0.183
NP_442015.1_10 Forward -333 -320 -0.767364 0.281
NP_441226.1_7 Forward -310 -303 14.4934 0.0123
NP_441226.1_7 Reverse -303 -310 14.4934 0.0123
NP_441111.1_7 Forward -310 -302 18.7023 0.00294
NP_441111.1_7 Reverse -303 -311 18.7023 0.00294
NP_442379.1_10 Reverse -295 -312 0.432165 0.223
NP_441766.1_2 Forward -311 -302 17.5026 0.00297
NP_441766.1_2 Reverse -302 -311 17.5026 0.00297
NP_442417.1_5 Reverse -302 -316 12.8809 0.0901
NP_442417.1_5 Forward -311 -297 8.06273 0.164
NP_440416.1_9 Reverse -295 -314 2.16274 0.0412
NP_440416.1_9 Forward -318 -299 -13.9635 0.173
NP_443052.1_8 Forward -321 -302 -12.2919 0.252
NP_442403.1_8 Reverse -304 -323 0.392778 0.241
NP_442154.1_1 Forward -57 -39 -14.1405 0.217
NP_442154.1_1 Forward -260 -242 -18.7621 0.285
NP_440261.1_5 Forward -310 -297 -0.964025 0.0655
NP_440261.1_5 Reverse -303 -316 -10.1088 0.201
NP_440988.1_10 Forward -313 -299 6.2542 0.232
NP_440988.1_10 Forward -51 -37 3.34982 0.296
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGGCATTTGCCGTTATAAACAACGGTATGTTCCTCGAGACTAGAAAAAGCCGCTGTGGCCGCCGTTTCCAGGCCAATGATCATCACTAGGGCGATCGCCAAGGGGCCGGCCCAAGAGCGCAGCGCCCGACGGACAGAATTGTGGGGTTTGGGATGCTGTAATTTCATCAGCTTCTCTCCTTGACACGTCCTAACACACCGAGACCAAATTAGAGCTTTGACTGCTCTACTACCACCATAGGGCTCTCTTCAGGGCATGTCAGTCCCATCTTTGGGGGGATGAACATGGAAAAAAGTGGAATAGGGCAAGTCCACTGGTGTTGTTTTTTATTACTCTTGCTGCCACCGTTGTCGCCGTGGCTGACGGCCAACTATTTTAACCGTAATCCTCATAATCCAGA

CDS

ATGCTCGATTTTTTCTGCAGTGGCAAGGGTTGGTGGTTTCAGCTTGGGGGTAATGGGAACGGCTTGGGCTGGCTTTTGAGCTATCCTTGGGGAGTGGAGCCGACCGCAGAGGGGAGTTTTCGTTGGATGCTACGTCGCATGAGTCAATTGGCGATCGCCATGGTTTTAGCTTTGGGGTTAATATCCCTGGCATTATTGACTATCCAAAATGTCACCCCTGTGGCCCTGAGTTTTTTGACATTGCAGTCTATTGAGATGCCGGTGGGTCTGCTGTTGGTATTTTCCTTGGCCGGGGGACTGGTGGTAGGTAGTTTGTTGGCCCCGTTACCCGGTGGTAATCGTCGGCGGGGAGTCCCTTCCCAACAACAATTAGACCGGGAATTCGATTTTGACGATCTTGTATGA

Protein

MLDFFCSGKGWWFQLGGNGNGLGWLLSYPWGVEPTAEGSFRWMLRRMSQLAIAMVLALGLISLALLTIQNVTPVALSFLTLQSIEMPVGLLLVFSLAGGLVVGSLLAPLPGGNRRRGVPSQQQLDREFDFDDLV