Your browser is old and dusty. Try Google Chrome!

Details for sll1187

ORF sll1187
Accession NP_440181.1
Symbol
Category Membranes, lipoproteins, and porins
Definition prolipoprotein diacylglyceryl transferase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -312 -326 12.1926 0.222
NP_441061.1_2 Reverse -14 -28 3.44117 0.164
NP_440795.1_7 Forward -21 -14 14.6904 0.0123
NP_440795.1_7 Reverse -14 -21 14.6904 0.0123
NP_442291.1_5 Reverse -12 -28 20.5114 0.0165
NP_442272.1_2 Reverse -145 -164 9.50102 0.29
NP_440897.1_6 Forward -22 -3 3.04693 0.154
NP_441453.1_4 Reverse -13 -21 16.539 0.00633
NP_441453.1_4 Forward -22 -14 16.539 0.00633
NP_442151.1_6 Forward -22 -8 11.7993 0.091
NP_441818.1_1 Reverse -14 -25 9.79292 0.232
NP_441818.1_9 Reverse -73 -92 4.916 0.153
NP_442173.1_1 Forward -21 -13 15.4574 0.00633
NP_442173.1_1 Reverse -14 -22 15.4574 0.00633
NP_442752.1_4 Forward -22 -15 13.8055 0.0199
NP_442752.1_4 Reverse -13 -20 13.8055 0.0199
NP_443027.1_4 Reverse -11 -21 5.87989 0.294
NP_442975.1_10 Reverse -9 -23 19.3701 0.00397
NP_440784.1_7 Forward -21 -14 15.9687 0.0123
NP_440784.1_7 Reverse -14 -21 15.9687 0.0123
NP_442909.1_7 Reverse -14 -28 16.7152 0.0821
NP_441250.1_3 Reverse -195 -214 2.45773 0.274
NP_440061.1_9 Reverse -11 -25 12.192 0.0999
NP_440110.1_4 Forward -33 -14 7.47261 0.142
NP_442062.1_8 Forward -22 -12 19.4496 0.000558
NP_442062.1_8 Reverse -13 -23 17.3846 0.00193
NP_440304.1_4 Forward -24 -14 1.84832 0.299
NP_440304.1_4 Reverse -11 -21 1.84832 0.299
NP_442242.1_4 Forward -21 -14 14.3954 0.0124
NP_442242.1_4 Reverse -14 -21 14.3954 0.0124
NP_441781.1_7 Reverse -13 -32 2.3594 0.209
NP_441781.1_7 Reverse -176 -195 -2.36049 0.289
NP_440916.1_1 Reverse -125 -139 7.9644 0.284
NP_439918.1_2 Forward -307 -288 3.93269 0.178
NP_441619.1_8 Forward -28 -14 13.7653 0.114
NP_440893.1_3 Reverse -205 -224 -0.689632 0.282
NP_441208.1_9 Forward -25 -11 6.78443 0.229
NP_441083.1_5 Reverse -13 -23 20.3345 0.00053
NP_441083.1_5 Forward -22 -12 11.3864 0.0159
NP_439957.1_6 Forward -369 -350 7.7676 0.281
NP_441738.1_2 Forward -20 -13 15.28 0.0102
NP_441738.1_2 Reverse -15 -22 15.28 0.0102
NP_440209.1_1 Reverse -13 -21 18.1123 0.00295
NP_440209.1_1 Forward -22 -14 18.1123 0.00295
NP_442889.1_8 Reverse -10 -24 20.8451 0.00339
NP_441713.1_1 Reverse -7 -26 -6.1954 0.118
NP_441716.1_1 Reverse -13 -27 13.5693 0.0689
NP_442111.1_4 Forward -23 -9 18.6825 0.00603
NP_440851.1_1 Reverse -17 -36 14.2566 0.257
NP_440851.1_6 Reverse -172 -189 1.21881 0.288
NP_440906.1_5 Forward -21 -14 15.8704 0.0124
NP_440906.1_5 Reverse -14 -21 15.8704 0.0124
NP_440747.1_10 Forward -25 -13 14.9853 0.00221
NP_440747.1_10 Reverse -10 -22 5.34885 0.0141
NP_441486.1_1 Forward -25 -11 22.5174 0.00162
NP_441486.1_1 Reverse -10 -24 14.1593 0.00654
NP_442848.1_1 Forward -28 -14 6.58777 0.0791
NP_443018.1_3 Forward -21 -14 14.8871 0.0123
NP_443018.1_3 Reverse -14 -21 14.8871 0.0123
NP_441634.1_8 Forward -24 -10 -3.04867 0.295
NP_440376.1_1 Forward -22 -13 19.4693 0.000692
NP_440376.1_1 Reverse -13 -22 19.4693 0.000692
NP_441588.1_4 Forward -20 -10 14.238 0.0773
NP_441588.1_4 Reverse -15 -25 8.92815 0.14
NP_441588.1_4 Reverse -294 -304 5.78156 0.235
NP_442687.1_7 Reverse -12 -22 15.8113 0.0125
NP_442687.1_7 Forward -23 -13 8.92815 0.0994
NP_440642.1_10 Reverse -165 -179 1.5723 0.29
NP_441422.1_7 Reverse -11 -28 -5.86102 0.247
NP_440181.1_2 Forward -362 -344 19.7837 0.0812
NP_442658.1_1 Reverse -11 -21 15.9091 0.00966
NP_442658.1_1 Forward -24 -14 6.76441 0.214
NP_442782.1_2 Forward -241 -227 2.16287 0.277
NP_441414.1_9 Reverse -13 -32 3.44104 0.0588
NP_441414.1_9 Forward -22 -3 2.55606 0.0654
NP_441317.1_4 Forward -158 -144 9.55945 0.29
NP_441958.1_5 Forward -23 -13 12.2714 0.00183
NP_441958.1_5 Reverse -12 -22 12.2714 0.00183
NP_440203.1_5 Forward -106 -96 11.1893 0.202
NP_440203.1_5 Reverse -16 -26 9.71433 0.245
NP_440203.1_5 Reverse -285 -295 8.73102 0.288
NP_442816.1_7 Forward -155 -136 7.97315 0.238
NP_440984.1_7 Reverse -8 -22 11.6026 0.122
NP_442911.1_2 Forward -32 -13 3.24438 0.045
NP_442911.1_2 Reverse -3 -22 -4.52377 0.136
NP_440153.1_5 Reverse -14 -28 9.2427 0.127
NP_442064.1_4 Reverse -337 -356 4.42355 0.287
NP_442536.1_4 Reverse -44 -62 9.26226 0.299
NP_442536.1_7 Forward -28 -9 8.65258 0.273
NP_443055.1_6 Reverse -160 -178 -0.571569 0.263
NP_442002.1_9 Reverse -12 -19 10.7572 0.185
NP_441294.1_7 Forward -26 -12 11.2664 0.15
NP_441294.1_7 Reverse -9 -23 10.8824 0.167
NP_441646.1_1 Reverse -6 -25 0.58944 0.247
NP_442438.1_10 Forward -27 -13 3.14618 0.166
NP_442438.1_10 Reverse -8 -22 2.16287 0.185
NP_441000.1_6 Reverse -12 -26 3.24451 0.116
NP_440147.1_4 Reverse -11 -24 12.704 0.0326
NP_440147.1_4 Forward -24 -11 10.1474 0.0355
NP_441295.1_4 Reverse -169 -188 -2.45882 0.29
NP_441550.1_8 Forward -24 -14 14.6309 0.0132
NP_441550.1_8 Reverse -11 -21 8.3377 0.124
NP_441916.1_7 Forward -22 -12 18.4663 0.00144
NP_441916.1_7 Reverse -13 -23 10.3048 0.0261
NP_441041.1_4 Forward -120 -101 -10.3253 0.231
NP_441041.1_7 Reverse -10 -22 9.55551 0.109
NP_442396.1_5 Forward -26 -13 10.7374 0.106
NP_442396.1_5 Reverse -9 -22 9.85238 0.128
NP_442004.1_6 Reverse -13 -27 8.25939 0.145
NP_441725.1_5 Forward -21 -11 2.04498 0.115
NP_441725.1_5 Reverse -14 -24 2.04498 0.115
NP_439966.1_7 Reverse -11 -21 9.91099 0.0968
NP_439966.1_7 Forward -24 -14 7.25606 0.15
NP_439966.1_9 Reverse -11 -20 0.884706 0.253
NP_440202.1_8 Forward -107 -88 10.9735 0.284
NP_442941.1_3 Reverse -14 -24 11.0914 0.0116
NP_442941.1_3 Forward -21 -11 2.63497 0.14
NP_440289.1_2 Reverse -10 -23 3.06754 0.0811
NP_440260.1_7 Reverse -169 -188 1.27776 0.241
NP_440260.1_8 Reverse -173 -191 -7.15901 0.295
NP_441514.1_6 Forward -187 -180 12.8221 0.252
NP_442281.1_1 Reverse -8 -22 11.7003 0.0438
NP_442281.1_1 Forward -27 -13 1.67063 0.293
NP_441079.1_7 Reverse -255 -274 -1.37794 0.202
NP_442012.1_1 Forward -28 -9 7.37428 0.111
NP_441860.1_1 Forward -85 -71 13.7072 0.294
NP_441860.1_6 Reverse -358 -377 17.9281 0.228
NP_441556.1_4 Forward -102 -83 11.8368 0.244
NP_442982.1_5 Forward -196 -177 -2.26216 0.286
NP_441644.1_6 Reverse -13 -23 17.3841 0.00127
NP_441644.1_6 Forward -22 -12 10.1076 0.0628
NP_442215.1_2 Forward -24 -8 10.3833 0.0501
NP_442215.1_2 Reverse -11 -27 4.87675 0.0815
NP_442029.1_6 Forward -306 -287 3.34271 0.282
NP_442247.1_8 Forward -24 -10 8.65272 0.266
NP_440253.1_2 Forward -387 -369 13.0972 0.0244
NP_440253.1_2 Forward -22 -4 -3.12744 0.286
NP_440929.1_1 Reverse -145 -155 15.8188 0.27
NP_440929.1_8 Forward -22 -13 19.2726 0.000701
NP_440929.1_8 Reverse -13 -22 19.2726 0.000701
NP_441346.1_7 Reverse -171 -190 11.9958 0.209
NP_441346.1_7 Forward -137 -118 11.6025 0.227
NP_442933.1_10 Forward -22 -13 17.601 0.00325
NP_442933.1_10 Reverse -13 -22 17.601 0.00325
NP_442671.1_2 Reverse -141 -160 4.22167 0.182
NP_440382.1_2 Forward -216 -197 5.40686 0.264
NP_441751.2_8 Reverse -14 -28 8.84938 0.0325
NP_442554.1_8 Reverse -14 -24 15.3197 0.00882
NP_442554.1_8 Forward -21 -11 13.2547 0.0187
NP_441762.1_7 Forward -23 -11 10.1671 0.0142
NP_441762.1_7 Reverse -12 -24 9.57708 0.0142
NP_442142.1_4 Forward -25 -12 5.62358 0.187
NP_442142.1_4 Reverse -10 -23 4.64028 0.214
NP_442292.1_1 Reverse -14 -23 18.486 0.00229
NP_442292.1_1 Forward -21 -12 9.63616 0.0183
NP_442476.1_6 Forward -21 -7 5.80112 0.131
NP_442476.1_6 Reverse -14 -28 0.687908 0.247
NP_443009.1_5 Forward -23 -12 18.3477 0.00265
NP_443009.1_10 Reverse -141 -159 20.0787 0.0251
NP_440947.1_7 Reverse -66 -85 13.3725 0.118
NP_441715.1_4 Forward -21 -11 9.41981 0.097
NP_441715.1_4 Reverse -14 -24 7.94484 0.107
NP_440158.1_8 Reverse -174 -193 12.6841 0.222
NP_441198.1_5 Reverse -15 -28 12.2117 0.228
NP_441198.1_8 Reverse -322 -332 12.0017 0.167
NP_441198.1_8 Forward -187 -177 10.4392 0.271
NP_440464.1_10 Reverse -14 -24 13.0082 0.169
NP_441468.1_1 Forward -21 -14 15.8704 0.0124
NP_441468.1_1 Reverse -14 -21 15.8704 0.0124
NP_441015.1_10 Forward -27 -8 -2.45882 0.178
NP_441673.1_1 Forward -22 -13 20.8459 0.000698
NP_441673.1_1 Reverse -13 -22 20.8459 0.000698
NP_441826.1_2 Forward -28 -14 10.226 0.0498
NP_441826.1_2 Reverse -7 -21 -3.44199 0.285
NP_442868.1_6 Forward -24 -14 9.81313 0.038
NP_442868.1_6 Reverse -11 -21 0.865012 0.205
NP_442719.1_2 Reverse -168 -186 -3.81647 0.203
NP_442719.1_2 Forward -167 -149 -10.8963 0.284
NP_440051.1_5 Forward -166 -152 14.4488 0.285
NP_441612.1_2 Reverse -252 -262 11.1632 0.21
NP_441612.1_2 Reverse -13 -23 8.54929 0.21
NP_442808.1_1 Reverse -12 -22 18.4657 0.00201
NP_442808.1_1 Forward -23 -13 8.63269 0.0481
NP_442808.1_1 Forward -100 -90 4.50281 0.197
NP_440145.1_3 Forward -32 -13 -0.885524 0.144
NP_442050.1_5 Forward -24 -14 7.64939 0.243
NP_440346.1_7 Reverse -135 -154 7.07928 0.29
NP_441114.1_3 Forward -107 -98 7.66954 0.231
NP_442789.1_3 Forward -316 -297 18.5831 0.177
NP_441878.1_6 Forward -23 -13 10.4031 0.0176
NP_441878.1_6 Reverse -12 -22 10.4031 0.0176
NP_441036.1_8 Reverse -12 -22 17.7779 0.000554
NP_441036.1_8 Forward -23 -13 8.33817 0.174
NP_441557.1_5 Forward -22 -13 19.9609 0.000699
NP_441557.1_5 Reverse -13 -22 19.9609 0.000699
NP_442066.2_4 Forward -22 -3 -8.55534 0.294
NP_441458.1_10 Reverse -4 -23 5.211 0.222
NP_441458.1_10 Forward -129 -110 4.03102 0.236
NP_442347.1_2 Reverse -14 -23 12.4878 0.056
NP_442347.1_2 Forward -21 -12 11.1111 0.056
NP_442347.1_2 Forward -143 -134 4.32629 0.284
NP_442645.1_2 Forward -30 -11 14.1591 0.00712
NP_441037.1_4 Reverse -11 -21 14.7245 0.028
NP_441037.1_4 Forward -24 -14 7.9999 0.237
NP_442594.1_7 Forward -33 -14 9.7334 0.186
NP_441633.1_3 Forward -24 -11 8.57408 0.0377
NP_441633.1_3 Reverse -11 -24 3.46087 0.0699
NP_440136.1_2 Forward -21 -14 15.9687 0.0123
NP_440136.1_2 Reverse -14 -21 15.9687 0.0123
NP_442998.1_5 Reverse -148 -158 10.5014 0.212
NP_442998.1_5 Forward -60 -50 10.2065 0.222
NP_442998.1_10 Forward -20 -13 15.5754 0.0102
NP_442998.1_10 Reverse -15 -22 15.5754 0.0102
NP_440299.1_1 Reverse -9 -22 20.5698 0.00128
NP_440299.1_1 Forward -26 -13 16.2433 0.0109
NP_440299.1_1 Reverse -170 -183 3.7553 0.232
NP_441799.1_1 Forward -26 -12 21.1401 0.0036
NP_441799.1_1 Reverse -9 -23 5.70218 0.197
NP_442802.1_2 Forward -112 -93 13.47 0.235
NP_441007.1_10 Forward -27 -14 -0.865694 0.295
NP_442201.1_10 Reverse -2 -21 12.1925 0.0471
NP_440256.1_1 Forward -25 -6 6.58763 0.0296
NP_440087.1_1 Forward -31 -12 -3.04881 0.219
NP_441559.1_8 Reverse -172 -186 4.52282 0.117
NP_441559.1_8 Reverse -8 -22 -6.49025 0.279
NP_440915.1_6 Reverse -9 -23 5.30946 0.091
NP_441464.1_8 Reverse -174 -188 6.48943 0.232
NP_441464.1_8 Reverse -13 -27 4.52282 0.269
NP_440306.1_5 Reverse -136 -155 2.26107 0.189
NP_441494.1_6 Reverse -119 -132 13.589 0.207
NP_442386.1_9 Reverse -12 -21 15.7322 0.0144
NP_442386.1_9 Forward -23 -14 13.8639 0.0289
NP_442054.1_3 Reverse -151 -170 -2.75381 0.274
NP_441340.1_5 Forward -21 -14 15.6737 0.0124
NP_441340.1_5 Reverse -14 -21 15.6737 0.0124
NP_441297.1_8 Forward -162 -144 10.8348 0.245
NP_442240.1_2 Forward -21 -2 -11.0136 0.137
NP_440586.1_8 Forward -21 -14 13.2151 0.026
NP_440586.1_8 Reverse -14 -21 13.2151 0.026
NP_442251.1_6 Forward -21 -14 15.2804 0.0124
NP_442251.1_6 Reverse -14 -21 15.2804 0.0124
NP_440192.1_5 Forward -248 -229 5.211 0.239
NP_442959.1_5 Forward -169 -150 5.11266 0.289
NP_440684.1_9 Forward -28 -14 18.3875 0.0378
NP_441262.1_3 Reverse -13 -20 14.7888 0.0223
NP_441262.1_3 Forward -22 -15 14.7888 0.0223
NP_443051.1_1 Reverse -12 -21 10.4228 0.00754
NP_443051.1_1 Forward -23 -14 10.4228 0.00754
NP_439984.1_3 Forward -29 -15 16.1252 0.13
NP_439937.1_9 Forward -23 -6 -8.51661 0.176
NP_439937.1_9 Reverse -12 -29 -16.2847 0.287
NP_441595.1_2 Forward -140 -127 11.0433 0.277
NP_440439.1_1 Forward -25 -12 2.57589 0.131
NP_440372.1_2 Forward -21 -14 16.3621 0.0124
NP_440372.1_2 Reverse -14 -21 16.3621 0.0124
NP_440819.1_5 Reverse -147 -155 8.08256 0.185
NP_440819.1_5 Reverse -120 -128 7.8859 0.266
NP_441572.1_7 Reverse -7 -26 8.55425 0.074
NP_442384.1_10 Reverse -13 -26 18.0139 0.00545
NP_442384.1_10 Forward -22 -9 16.0472 0.00946
NP_442262.1_10 Forward -21 -14 14.1988 0.0123
NP_442262.1_10 Reverse -14 -21 14.1988 0.0123
NP_441689.1_5 Forward -24 -14 5.78111 0.197
NP_440344.1_10 Reverse -6 -23 11.8386 0.006
NP_440531.1_6 Forward -30 -11 -5.40875 0.297
NP_442910.1_1 Reverse -6 -25 -5.40875 0.254
NP_442910.1_1 Forward -29 -10 -6.98204 0.254
NP_441965.1_3 Forward -32 -13 10.7175 0.0966
NP_441965.1_10 Reverse -10 -26 3.99177 0.252
NP_442556.1_10 Reverse -171 -190 9.21277 0.279
NP_440297.1_9 Forward -21 -11 -0.118297 0.282
NP_440297.1_9 Reverse -14 -24 -0.118297 0.282
NP_441592.1_4 Reverse -13 -32 5.30933 0.135
NP_440894.1_10 Reverse -172 -191 3.73603 0.266
NP_440894.1_10 Forward -77 -58 2.0644 0.298
NP_442553.1_9 Reverse -253 -272 12.3892 0.211
NP_440999.1_9 Reverse -9 -23 5.21113 0.113
NP_440999.1_9 Reverse -173 -187 -3.34366 0.291
NP_440888.1_2 Forward -22 -8 12.487 0.0442
NP_440888.1_2 Reverse -13 -27 9.24208 0.134
NP_442454.1_5 Forward -240 -221 13.6666 0.227
NP_440600.1_4 Reverse -5 -23 2.77242 0.121
NP_440491.1_1 Forward -186 -167 11.2051 0.173
NP_440052.1_5 Reverse -2 -21 11.2092 0.0714
NP_439969.1_3 Reverse -8 -27 4.42435 0.214
NP_441543.1_2 Forward -21 -12 18.486 0.00236
NP_441543.1_2 Reverse -14 -23 16.9127 0.00359
NP_442845.1_2 Forward -28 -14 14.8476 0.0774
NP_442845.1_2 Reverse -7 -21 4.52282 0.258
NP_441469.1_8 Reverse -12 -21 16.126 0.00797
NP_441469.1_8 Forward -23 -14 6.48957 0.227
NP_442315.1_5 Forward -102 -92 16.6963 0.3
NP_443064.1_6 Reverse -13 -23 12.5669 0.0796
NP_442578.1_7 Forward -21 -14 14.5921 0.026
NP_442578.1_7 Reverse -14 -21 14.5921 0.026
NP_441462.1_2 Forward -22 -12 11.5831 0.00406
NP_441462.1_2 Reverse -13 -23 11.5831 0.00406
NP_443062.1_1 Forward -22 -4 6.30325 0.204
NP_443062.1_6 Forward -30 -11 7.07928 0.176
NP_442204.1_5 Reverse -3 -22 1.96607 0.221
NP_440516.1_2 Reverse -7 -25 4.05072 0.142
NP_440516.1_8 Forward -22 -13 16.9127 0.00442
NP_440516.1_8 Reverse -13 -22 16.9127 0.00442
NP_442428.1_5 Forward -21 -14 15.8704 0.0124
NP_442428.1_5 Reverse -14 -21 15.8704 0.0124
NP_440673.1_3 Forward -20 -13 12.4288 0.0426
NP_440673.1_3 Reverse -15 -22 12.4288 0.0426
NP_441714.1_3 Forward -29 -11 18.6029 0.0592
NP_441052.1_2 Reverse -13 -23 19.9412 0.00106
NP_441052.1_2 Forward -22 -12 10.5014 0.0285
NP_442219.1_9 Reverse -14 -23 17.7976 0.00718
NP_442219.1_9 Forward -21 -12 8.35786 0.0681
NP_440436.1_4 Forward -21 -12 18.1905 0.00233
NP_440436.1_4 Reverse -14 -23 17.2072 0.00233
NP_441884.1_9 Reverse -10 -29 -24.0916 0.284
NP_442907.1_2 Reverse -160 -178 11.2289 0.181
NP_441086.1_3 Forward -352 -333 8.44315 0.231
NP_441719.1_4 Forward -21 -14 16.3621 0.0124
NP_441719.1_4 Reverse -14 -21 16.3621 0.0124
NP_441004.1_5 Reverse -312 -326 8.16106 0.276
NP_442366.1_3 Reverse -12 -30 7.19731 0.0762
NP_442366.1_3 Reverse -5 -23 -1.65248 0.216
NP_442366.1_5 Forward -25 -15 17.2858 0.0141
NP_442366.1_5 Reverse -10 -20 13.3526 0.0775
NP_441115.1_4 Forward -23 -5 11.4247 0.14
NP_443054.1_2 Forward -24 -10 1.76955 0.245
NP_442430.1_7 Reverse -65 -84 17.6346 0.228
NP_441851.1_10 Reverse -12 -22 16.008 0.00552
NP_441851.1_10 Forward -23 -13 15.8113 0.00552
NP_442011.1_1 Forward -23 -4 -1.27885 0.268
NP_442515.1_1 Forward -23 -9 -2.26202 0.271
NP_440593.1_3 Reverse -8 -27 -4.42544 0.248
NP_440593.1_3 Forward -27 -8 -4.6221 0.251
NP_442689.1_8 Reverse -350 -367 7.41366 0.155
NP_441349.1_10 Forward -32 -13 11.1109 0.0232
NP_441349.1_10 Reverse -3 -22 -5.40875 0.201
NP_440432.1_9 Reverse -350 -365 -0.708419 0.167
NP_442450.1_5 Reverse -11 -21 7.55152 0.13
NP_442450.1_5 Forward -24 -14 7.55152 0.13
NP_440588.1_2 Forward -31 -12 18.879 0.0104
NP_440588.1_2 Reverse -4 -23 -3.83545 0.197
NP_442006.1_2 Forward -177 -160 -18.3491 0.29
NP_441570.1_1 Reverse -13 -31 -15.6155 0.231
NP_441078.1_4 Forward -22 -13 19.6659 0.0007
NP_441078.1_4 Reverse -13 -22 19.6659 0.0007
NP_442729.1_8 Reverse -9 -22 9.06573 0.125
NP_442443.1_1 Forward -246 -227 -3.04881 0.264
NP_442443.1_4 Reverse -60 -70 16.3025 0.155
NP_440526.1_3 Reverse -14 -25 0.943182 0.267
NP_441432.1_8 Forward -23 -14 16.8143 0.00595
NP_441432.1_8 Reverse -12 -21 8.25953 0.0755
NP_442320.1_8 Reverse -7 -21 15.0442 0.011
NP_441732.1_2 Reverse -9 -25 2.91013 0.0145
NP_441732.1_2 Forward -26 -10 -17.1494 0.24
NP_440759.1_9 Reverse -138 -157 5.70265 0.292
NP_440760.1_1 Reverse -13 -32 -6.09707 0.0549
NP_440760.1_1 Forward -22 -3 -19.8634 0.22
NP_439900.1_9 Reverse -133 -152 14.2566 0.248
NP_442353.1_4 Reverse -7 -26 12.1917 0.0821
NP_442489.1_7 Forward -22 -13 20.1576 0.000695
NP_442489.1_7 Reverse -13 -22 20.1576 0.000695
NP_440559.1_1 Reverse -14 -23 17.4043 0.00658
NP_440559.1_1 Forward -21 -12 8.75118 0.0586
NP_441659.2_8 Reverse -13 -23 18.1713 0.00133
NP_441659.2_8 Forward -22 -12 11.9764 0.0147
NP_440860.1_8 Reverse -79 -98 14.9458 0.286
NP_441040.1_2 Reverse -166 -185 -11.9969 0.255
NP_441040.1_5 Reverse -8 -27 5.80098 0.229
NP_441968.1_1 Reverse -147 -155 14.1787 0.286
NP_440779.1_5 Reverse -159 -176 -14.9075 0.287
NP_442346.1_5 Forward -23 -13 16.6963 0.00248
NP_442346.1_5 Reverse -12 -22 9.02648 0.118
NP_440545.1_3 Forward -26 -9 5.44704 0.0616
NP_440025.1_3 Forward -61 -47 9.64265 0.294
NP_440459.1_2 Forward -24 -7 13.6085 0.128
NP_441943.1_2 Reverse -153 -172 15.9291 0.203
NP_441888.1_7 Reverse -342 -356 3.73617 0.225
NP_441888.1_7 Reverse -8 -22 3.04785 0.225
NP_440449.1_6 Reverse -5 -23 7.47773 0.222
NP_441502.1_3 Forward -24 -5 11.2092 0.21
NP_441833.1_4 Forward -21 -14 15.9687 0.0124
NP_441833.1_4 Reverse -14 -21 15.9687 0.0124
NP_441329.1_6 Reverse -138 -157 -2.81744 0.294
NP_442162.1_9 Forward -21 -14 16.2637 0.0124
NP_442162.1_9 Reverse -14 -21 16.2637 0.0124
NP_440204.1_4 Reverse -73 -92 3.04771 0.238
NP_442140.1_3 Forward -21 -11 16.2046 0.0255
NP_442140.1_3 Reverse -14 -24 12.2714 0.0632
NP_441813.1_5 Reverse -11 -21 9.91146 0.021
NP_441813.1_5 Forward -24 -14 8.63316 0.0367
NP_440590.1_4 Forward -21 -8 18.3088 0.00811
NP_440590.1_4 Reverse -14 -27 2.57589 0.0845
NP_440567.1_1 Forward -21 -7 14.6509 0.0187
NP_440567.1_1 Reverse -14 -28 14.6509 0.0187
NP_442497.1_10 Forward -21 -12 10.4228 0.0087
NP_442497.1_10 Reverse -14 -23 10.4228 0.0087
NP_440821.1_4 Reverse -11 -21 10.2065 0.0163
NP_440821.1_4 Forward -24 -14 9.41981 0.0286
NP_441239.1_9 Reverse -11 -23 12.3303 0.0477
NP_441239.1_9 Forward -24 -12 5.93884 0.202
NP_440400.1_1 Reverse -229 -248 -1.67294 0.285
NP_441874.1_1 Forward -145 -131 8.94771 0.285
NP_440546.1_4 Forward -22 -12 11.8882 0.0679
NP_440546.1_4 Reverse -13 -23 10.046 0.109
NP_440546.1_4 Reverse -378 -388 8.97947 0.16
NP_441603.1_5 Reverse -328 -347 14.4533 0.212
NP_440462.1_6 Reverse -11 -21 9.02648 0.0498
NP_440462.1_6 Forward -24 -14 1.35667 0.294
NP_440868.1_4 Forward -26 -14 15.7719 0.0164
NP_440868.1_4 Reverse -9 -21 1.61227 0.177
NP_441497.1_2 Forward -156 -137 8.06259 0.233
NP_441582.1_5 Reverse -11 -30 6.58682 0.193
NP_441848.1_4 Forward -65 -49 8.3146 0.288
NP_442039.1_4 Forward -21 -14 15.1821 0.0124
NP_442039.1_4 Reverse -14 -21 15.1821 0.0124
NP_441811.1_8 Forward -28 -14 7.17775 0.257
NP_440825.1_7 Reverse -14 -24 12.9096 0.152
NP_440825.1_7 Forward -21 -11 12.4217 0.155
NP_442837.1_3 Forward -21 -14 15.7721 0.0124
NP_442837.1_3 Reverse -14 -21 15.7721 0.0124
NP_442053.1_1 Forward -22 -13 18.3876 0.0007
NP_442053.1_1 Reverse -13 -22 18.3876 0.0007
NP_440505.1_3 Forward -24 -14 9.22315 0.122
NP_440505.1_3 Reverse -11 -21 6.76487 0.169
NP_440914.1_1 Reverse -13 -23 17.5935 0.000537
NP_440914.1_1 Forward -22 -12 8.6151 0.186
NP_441011.1_8 Forward -21 -12 16.9127 0.00602
NP_441011.1_8 Reverse -14 -23 8.25953 0.144
NP_442101.1_10 Reverse -5 -24 -7.96535 0.224
NP_442533.1_6 Forward -22 -13 17.2076 0.00137
NP_442533.1_6 Reverse -13 -22 17.2076 0.00137
NP_442232.1_3 Forward -30 -11 -13.3736 0.282
NP_442229.1_1 Forward -24 -10 8.84875 0.184
NP_441482.1_7 Reverse -7 -21 -10.4235 0.209
NP_439944.1_9 Reverse -14 -24 10.5014 0.0887
NP_440816.1_7 Reverse -9 -28 9.0459 0.258
NP_440116.1_5 Forward -25 -8 3.0871 0.249
NP_441527.1_7 Reverse -172 -191 8.4551 0.282
NP_440115.1_6 Forward -25 -15 8.33817 0.13
NP_440007.1_9 Forward -76 -62 6.88276 0.216
NP_441972.1_5 Forward -21 -2 -5.70374 0.224
NP_441106.1_1 Reverse -12 -21 18.191 0.0028
NP_441106.1_1 Forward -23 -14 9.63616 0.0311
NP_442306.1_10 Forward -27 -8 -20.5517 0.213
NP_441286.1_1 Forward -23 -11 6.03717 0.0258
NP_441286.1_1 Reverse -12 -24 3.38223 0.0467
NP_440670.1_8 Forward -22 -13 18.3876 0.000699
NP_440670.1_8 Reverse -13 -22 18.3876 0.000699
NP_440886.1_7 Reverse -12 -22 17.7774 0.0011
NP_440886.1_7 Forward -23 -13 7.94438 0.0805
NP_440886.1_7 Forward -121 -111 4.40448 0.237
NP_442072.1_9 Reverse -12 -30 -21.2203 0.206
NP_442072.1_9 Forward -23 -5 -22.6953 0.253
NP_441808.1_8 Reverse -99 -118 6.88262 0.283
NP_440907.2_8 Forward -21 -11 14.2375 0.0312
NP_440907.2_8 Reverse -14 -24 7.64939 0.117
NP_440907.2_8 Forward -332 -322 3.91283 0.289
NP_441021.1_1 Reverse -14 -33 -11.4069 0.262
NP_441626.1_2 Forward -21 -14 15.7721 0.0124
NP_441626.1_2 Reverse -14 -21 15.7721 0.0124
NP_442365.1_7 Reverse -9 -28 -6.39206 0.292
NP_442238.1_7 Forward -158 -139 8.75009 0.239
NP_442238.1_8 Forward -63 -44 14.5524 0.248
NP_442794.1_1 Reverse -9 -21 9.57708 0.0795
NP_442794.1_1 Forward -26 -14 2.69391 0.286
NP_442615.1_1 Reverse -4 -22 5.42735 0.0386
NP_442615.1_1 Forward -31 -13 -0.964162 0.123
NP_441962.1_4 Forward -27 -8 -10.0303 0.223
NP_440387.1_1 Reverse -13 -29 23.5596 0.00159
NP_440387.1_1 Forward -22 -6 -0.629782 0.14
NP_441431.1_2 Reverse -10 -24 8.16044 0.222
NP_441431.1_2 Forward -25 -11 7.86545 0.231
NP_440143.1_1 Reverse -271 -290 12.6841 0.284
NP_440114.1_10 Reverse -13 -27 6.3911 0.273
NP_440287.1_6 Forward -132 -113 2.85105 0.226
NP_440766.1_5 Reverse -250 -262 8.51522 0.277
NP_441237.1_9 Reverse -14 -24 14.828 0.0242
NP_442743.1_5 Forward -27 -8 7.86593 0.162
NP_442930.1_1 Forward -131 -121 13.3526 0.239
NP_441133.1_1 Reverse -76 -95 12.7825 0.253
NP_440457.1_1 Forward -26 -14 2.69391 0.205
NP_440798.1_6 Forward -21 -8 5.91914 0.14
NP_440798.1_6 Reverse -14 -27 5.52582 0.14
NP_441984.1_3 Forward -187 -169 11.4255 0.177
NP_441436.1_8 Forward -23 -4 8.35759 0.283
NP_442509.1_9 Forward -22 -12 16.2041 0.00739
NP_442509.1_9 Reverse -13 -23 8.14104 0.192
NP_440554.1_4 Forward -21 -11 7.35486 0.103
NP_441885.1_5 Reverse -13 -23 20.9245 0.000538
NP_441885.1_5 Forward -22 -12 11.4848 0.00668
NP_440478.1_10 Reverse -11 -25 10.6193 0.193
NP_442341.1_7 Forward -23 -9 19.0758 0.00893
NP_442341.1_7 Reverse -12 -26 7.9644 0.0956
NP_442341.1_7 Forward -121 -107 3.63784 0.217
NP_442341.1_9 Reverse -11 -25 14.7486 0.062
NP_441173.1_9 Reverse -53 -61 13.1954 0.184
NP_441173.1_9 Reverse -52 -60 12.9004 0.206
NP_442395.2_4 Forward -23 -4 -0.591301 0.298
NP_443000.1_7 Forward -24 -14 10.3048 0.0345
NP_443000.1_7 Reverse -11 -21 1.94665 0.226
NP_441842.1_10 Reverse -6 -20 15.7325 0.0381
NP_440275.1_3 Reverse -11 -21 8.33817 0.0602
NP_440275.1_3 Forward -24 -14 8.04317 0.0602
NP_440091.1_1 Forward -26 -14 8.29878 0.0653
NP_441122.1_1 Forward -26 -11 4.89645 0.28
NP_439962.1_8 Reverse -172 -191 14.6508 0.21
NP_441105.1_3 Reverse -2 -21 5.89931 0.0643
NP_441105.1_3 Forward -33 -14 -7.27704 0.25
NP_442373.1_2 Forward -247 -228 6.29264 0.148
NP_440216.1_1 Forward -22 -8 7.37441 0.00942
NP_440216.1_1 Reverse -13 -27 -0.197071 0.0284
NP_440172.1_1 Reverse -13 -23 15.0247 0.00945
NP_440172.1_1 Forward -22 -12 8.73149 0.0586
NP_442015.1_10 Reverse -9 -22 11.524 0.0372
NP_442015.1_10 Forward -26 -13 10.5407 0.0391
NP_441226.1_7 Forward -21 -14 14.4934 0.0123
NP_441226.1_7 Reverse -14 -21 14.4934 0.0123
NP_441111.1_7 Forward -21 -13 18.7023 0.00294
NP_441111.1_7 Reverse -14 -22 18.7023 0.00294
NP_442379.1_10 Forward -29 -12 8.7903 0.102
NP_441766.1_2 Forward -22 -13 17.5026 0.00297
NP_441766.1_2 Reverse -13 -22 17.5026 0.00297
NP_442417.1_5 Forward -22 -8 18.5841 0.0203
NP_440416.1_9 Reverse -6 -25 -6.09707 0.0854
NP_442154.1_1 Forward -255 -237 -17.0904 0.249
NP_440261.1_5 Forward -21 -8 -10.3055 0.201
NP_440261.1_5 Reverse -14 -27 -12.0754 0.27
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TCTGGGTTTAGAGCCAGATAGCTGTTTTTATATTCAAAATGAAGCGAAAGTGCGGGGTTTAAAACGTTGGGATACCACCATTGATCCTCCACCGGATTTAGCTCTCGAAGTGGATCTAACTTCCCGTACCCATTTAGATATTTATGCCCAATTAGGGGTGCCGGAAGTGTGGCGTTTTAAACGCAGACAATTGGAAATTCACTGCCTAGAACAAGGGGAATACCGCCAAAGGGAAGTTAGCTCGATTTTTCCTGATTTTGATCTCAGGGAAATTATTCCCGCCTATCTACAACGCATTGACCAGGAAGGCCGCAACAAAACCATCAAGGCTTTTCGCATTTGGGTAAAATCCCACATTGATGCTAAGAATTAGAGGTTGGCGATCGCCGAAGGAAGATTA

CDS

ATGATTGAGCAAATATTTTTCGGACAATTTCAGTCCCCCGGGCCGGTGATGTTCCAGATAGGGGGTTTTGCCCTGCGTTGGTACGGATTTTTGATTGCCAGTGCTGTCATTATTGGTTTGAATCTCTGTCAATGGTTGGGGCAAAAACGGGGCATTAACCCGGATTTATTCAACGATTTAGTCATTTGGTTAGTGGTGGCGGCCATCCCTTCTGCTCGCCTATATTACGTCGCCTTTGAGTGGCCCCGCTATGCCCAGCATTGGTTAAATATTTTTGCCATTTGGCAAGGGGGCATTGCTATCCATGGGGCCTTGATTGGGGGAACGATCGCCATTCTTGTTTTCAGTCGCTACCATCAGTTATCTTTCTGGAATTTGCTGGATGTACTCACCCCGGCGGTTATTCTCGGCCAGGCGATCGGTCGGTGGGGCAACTTTTTTAACTCCGAAGCTTTTGGTGCCCCCACTAATTTGCCTTGGAAGCTCTATATTCCCTTTGCTAATCGTCCGCTAAATCTGACCAGCTATGCCTATTTCCATCCTACTTTTTTATACGAATCAGTCTGGAACCTAGGAATTTTTGCAATCTTGATAGCCCTATTTTTTTATGGACTAAGAAATCCAGAAAAAATCAAAACTGGGACCATAACCTGTGTTTATTTGATTGGTTATAGCCTCGGTCGAGTGTGGATTGAAGGTTTAAGATTAGATAGTTTGATGCTTGGTCCTCTGAGAATAGCTCAGGTTGTTAGCATCACCCTAGTTTTATTGGGAACAGCGGGAATTGTCTGGTTATATCTTCTGCAGAAAAATTTACCGGACTGGTCGGAGCGAAAATTGGTAAAAAATTAA

Protein

MIEQIFFGQFQSPGPVMFQIGGFALRWYGFLIASAVIIGLNLCQWLGQKRGINPDLFNDLVIWLVVAAIPSARLYYVAFEWPRYAQHWLNIFAIWQGGIAIHGALIGGTIAILVFSRYHQLSFWNLLDVLTPAVILGQAIGRWGNFFNSEAFGAPTNLPWKLYIPFANRPLNLTSYAYFHPTFLYESVWNLGIFAILIALFFYGLRNPEKIKTGTITCVYLIGYSLGRVWIEGLRLDSLMLGPLRIAQVVSITLVLLGTAGIVWLYLLQKNLPDWSERKLVKN