Your browser is old and dusty. Try Google Chrome!

Details for sll1184

ORF sll1184
Accession NP_440184.1
Symbol ho1
Category Cobalamin, heme, phycobilin and porphyrin
Definition heme oxygenase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -222 -236 12.586 0.209
NP_441061.1_2 Forward -256 -242 1.27789 0.192
NP_441061.1_2 Forward -372 -358 0.687908 0.202
NP_441061.1_2 Reverse -358 -372 -1.18038 0.252
NP_440795.1_7 Forward -230 -223 14.6904 0.0123
NP_440795.1_7 Reverse -223 -230 14.6904 0.0123
NP_440694.1_8 Reverse -20 -39 5.60432 0.202
NP_441418.1_6 Forward -231 -212 -18.2901 0.0827
NP_441418.1_6 Reverse -222 -241 -29.2048 0.219
NP_440897.1_6 Forward -231 -212 9.7334 0.0705
NP_440897.1_6 Forward -140 -121 -0.39464 0.182
NP_441453.1_1 Forward -238 -220 5.1316 0.252
NP_441453.1_4 Reverse -222 -230 16.539 0.00633
NP_441453.1_4 Forward -231 -223 16.539 0.00633
NP_442151.1_6 Forward -140 -126 13.9626 0.0421
NP_442151.1_6 Forward -231 -217 12.291 0.0771
NP_442151.1_6 Reverse -131 -145 5.30946 0.284
NP_441818.1_1 Forward -230 -219 9.79292 0.232
NP_441818.1_9 Reverse -338 -357 -1.47551 0.2
NP_441818.1_9 Reverse -355 -374 -10.7186 0.298
NP_440226.1_1 Reverse -222 -241 5.99764 0.139
NP_440226.1_1 Forward -231 -212 3.53937 0.221
NP_442623.1_3 Forward -230 -211 -0.39387 0.0786
NP_440348.1_6 Forward -167 -148 2.85105 0.279
NP_442744.1_8 Forward -140 -121 -5.60541 0.297
NP_442287.1_5 Reverse -274 -284 16.6963 0.218
NP_442655.1_10 Forward -234 -215 -18.7818 0.276
NP_441066.1_10 Forward -129 -113 16.7748 0.224
NP_442173.1_1 Forward -230 -222 15.4574 0.00633
NP_442173.1_1 Reverse -223 -231 15.4574 0.00633
NP_442173.1_1 Forward -159 -151 5.0343 0.24
NP_442173.1_1 Reverse -152 -160 5.0343 0.24
NP_442173.1_5 Reverse -150 -160 15.824 0.287
NP_442752.1_4 Forward -231 -224 13.8055 0.0199
NP_442752.1_4 Reverse -222 -229 13.8055 0.0199
NP_443027.1_4 Forward -233 -223 13.2547 0.0521
NP_443027.1_4 Reverse -220 -230 11.0914 0.107
NP_441812.1_3 Reverse -221 -235 9.83269 0.228
NP_440784.1_7 Forward -230 -223 15.9687 0.0123
NP_440784.1_7 Reverse -223 -230 15.9687 0.0123
NP_440061.1_9 Forward -233 -219 19.3701 0.00586
NP_440061.1_9 Reverse -220 -234 12.3887 0.0971
NP_441054.1_4 Forward -170 -152 -3.22577 0.26
NP_440878.1_9 Reverse -212 -231 14.2574 0.0939
NP_442062.1_8 Forward -231 -221 17.3846 0.00193
NP_442062.1_8 Reverse -222 -232 10.3048 0.0493
NP_442062.1_8 Forward -160 -150 5.38824 0.172
NP_442062.1_8 Reverse -151 -161 3.32329 0.275
NP_440761.1_4 Forward -236 -217 -13.5702 0.257
NP_441859.1_3 Reverse -238 -257 3.9319 0.23
NP_440304.1_4 Forward -233 -223 10.8948 0.051
NP_440304.1_4 Reverse -220 -230 1.84832 0.299
NP_442242.1_4 Forward -230 -223 14.3954 0.0124
NP_442242.1_4 Reverse -223 -230 14.3954 0.0124
NP_440044.1_8 Reverse -223 -242 -1.27885 0.241
NP_441781.1_7 Forward -231 -212 -3.24547 0.295
NP_439918.1_2 Reverse -338 -357 -1.08219 0.236
NP_441208.1_1 Reverse -350 -369 -6.39206 0.287
NP_441208.1_9 Reverse -219 -233 7.86607 0.219
NP_441594.1_6 Reverse -355 -374 1.76941 0.262
NP_440132.1_1 Forward -374 -356 11.6222 0.206
NP_442110.1_7 Forward -231 -217 10.6193 0.0644
NP_442110.1_7 Reverse -222 -236 2.35953 0.222
NP_441925.1_4 Forward -366 -347 -8.94939 0.213
NP_441083.1_5 Forward -231 -221 20.3345 0.00053
NP_441083.1_5 Reverse -222 -232 11.2881 0.0159
NP_442827.1_8 Forward -271 -252 -2.45958 0.278
NP_441738.1_2 Forward -229 -222 15.28 0.0102
NP_441738.1_2 Reverse -224 -231 15.28 0.0102
NP_441558.1_5 Forward -233 -214 9.14423 0.129
NP_441558.1_5 Reverse -220 -239 7.7676 0.17
NP_440209.1_1 Reverse -222 -230 18.1123 0.00295
NP_440209.1_1 Forward -231 -223 18.1123 0.00295
NP_442889.1_8 Forward -313 -299 7.07881 0.163
NP_442889.1_10 Reverse -33 -52 12.0622 0.215
NP_440447.1_5 Reverse -369 -379 11.6814 0.291
NP_441713.1_1 Reverse -216 -235 -7.37537 0.13
NP_441713.1_1 Forward -237 -218 -7.76869 0.137
NP_441713.1_1 Reverse -369 -388 -8.26035 0.147
NP_441713.1_1 Forward -296 -277 -8.65367 0.155
NP_441770.1_4 Forward -250 -231 -10.4236 0.271
NP_441770.1_9 Reverse -345 -359 20.1574 0.242
NP_442570.1_3 Forward -375 -356 -3.44213 0.219
NP_442570.1_3 Reverse -123 -142 -9.047 0.296
NP_442461.1_2 Reverse -38 -57 17.109 0.216
NP_441716.1_1 Forward -231 -217 10.7177 0.0936
NP_442111.1_4 Reverse -221 -235 13.2743 0.0394
NP_442111.1_4 Forward -232 -218 11.6026 0.0488
NP_440906.1_5 Forward -230 -223 15.8704 0.0124
NP_440906.1_5 Reverse -223 -230 15.8704 0.0124
NP_440747.1_10 Reverse -219 -231 26.5883 0.000317
NP_440747.1_10 Forward -234 -222 17.1486 0.000663
NP_441130.1_10 Reverse -220 -234 5.40779 0.231
NP_441486.1_1 Forward -260 -246 -2.26202 0.175
NP_440944.1_2 Reverse -276 -295 -2.45882 0.276
NP_442634.1_4 Reverse -220 -234 8.16106 0.0479
NP_442634.1_4 Forward -233 -219 7.86607 0.0479
NP_442634.1_4 Forward -374 -360 -3.73699 0.164
NP_441265.1_3 Reverse -216 -230 1.57289 0.2
NP_440470.1_5 Reverse -105 -124 6.15881 0.28
NP_442848.1_9 Reverse -132 -151 0.58944 0.266
NP_443018.1_3 Forward -230 -223 14.8871 0.0123
NP_443018.1_3 Reverse -223 -230 14.8871 0.0123
NP_441316.1_7 Reverse -220 -235 -1.49507 0.237
NP_441634.1_8 Forward -369 -355 -1.08205 0.278
NP_441634.1_8 Reverse -220 -234 -3.24533 0.295
NP_440376.1_1 Forward -231 -222 19.4693 0.000692
NP_440376.1_1 Reverse -222 -231 19.4693 0.000692
NP_440376.1_1 Reverse -281 -290 4.52295 0.156
NP_442687.1_7 Forward -232 -222 9.02648 0.0994
NP_442687.1_7 Reverse -221 -231 8.92815 0.0994
NP_442687.1_7 Forward -264 -254 4.69992 0.238
NP_441077.1_6 Reverse -151 -167 2.89827 0.276
NP_442958.1_3 Reverse -347 -366 4.22769 0.252
NP_440642.1_10 Forward -189 -175 12.487 0.134
NP_441013.1_2 Forward -377 -359 -1.25915 0.282
NP_441013.1_2 Reverse -217 -235 -2.43913 0.282
NP_441013.1_2 Reverse -211 -229 -2.93078 0.287
NP_441422.1_7 Reverse -220 -237 -3.10775 0.227
NP_440741.1_4 Reverse -222 -241 12.6841 0.271
NP_440533.1_9 Reverse -222 -241 11.7008 0.112
NP_440667.1_2 Reverse -355 -374 -6.58872 0.273
NP_442658.1_1 Forward -233 -223 14.2375 0.0237
NP_442658.1_1 Reverse -356 -366 12.0743 0.0643
NP_442658.1_1 Reverse -220 -230 7.94438 0.199
NP_442658.1_1 Reverse -149 -159 5.38779 0.269
NP_442658.1_1 Forward -374 -364 4.89613 0.292
NP_442782.1_2 Reverse -222 -236 4.52282 0.252
NP_442782.1_2 Forward -372 -358 2.75286 0.274
NP_442782.1_2 Reverse -275 -289 2.5562 0.275
NP_442782.1_2 Reverse -344 -358 2.35953 0.275
NP_442782.1_2 Reverse -276 -290 0.491246 0.289
NP_442205.1_9 Reverse -275 -291 5.36841 0.136
NP_442205.1_9 Forward -221 -205 3.40179 0.188
NP_442205.1_9 Forward -237 -221 -3.18639 0.28
NP_442544.1_2 Reverse -123 -137 9.2427 0.089
NP_442544.1_6 Forward -238 -219 -8.26035 0.298
NP_441414.1_9 Forward -231 -212 -9.24366 0.256
NP_440184.1_1 Forward -119 -100 21.3469 0.0317
NP_440184.1_7 Forward -64 -45 15.7062 0.222
NP_442321.1_1 Forward -142 -123 -8.16202 0.284
NP_441958.1_5 Forward -232 -222 21.2195 0.000805
NP_441958.1_5 Reverse -221 -231 12.2714 0.00183
NP_441127.1_1 Reverse -176 -190 7.76774 0.3
NP_440203.1_5 Forward -382 -372 8.63269 0.29
NP_439905.1_1 Forward -366 -353 11.0324 0.204
NP_439905.1_1 Reverse -223 -236 10.7374 0.213
NP_440984.1_7 Forward -236 -222 9.73436 0.127
NP_440984.1_7 Reverse -217 -231 9.63603 0.127
NP_439990.1_5 Reverse -217 -230 13.7856 0.0889
NP_439990.1_5 Forward -236 -223 7.39411 0.198
NP_439990.1_5 Forward -165 -152 7.39411 0.198
NP_442911.1_1 Reverse -103 -116 14.9585 0.275
NP_442911.1_2 Forward -241 -222 -2.75381 0.102
NP_442911.1_2 Reverse -212 -231 -3.63879 0.115
NP_440153.1_5 Forward -230 -216 2.75286 0.219
NP_442064.1_4 Reverse -121 -140 5.40686 0.269
NP_442064.1_4 Reverse -113 -132 4.42355 0.287
NP_443055.1_6 Reverse -234 -252 -2.04653 0.287
NP_440993.1_3 Reverse -212 -231 14.5516 0.0527
NP_440993.1_4 Forward -140 -123 3.28376 0.289
NP_440602.1_2 Reverse -217 -236 0.687771 0.285
NP_441099.1_5 Reverse -212 -231 9.3409 0.0328
NP_440809.1_9 Forward -240 -222 1.59244 0.121
NP_441294.1_7 Forward -294 -280 10.6905 0.177
NP_441646.1_1 Reverse -124 -143 0.491109 0.251
NP_441646.1_7 Forward -366 -352 14.5526 0.256
NP_442438.1_10 Reverse -217 -231 9.04604 0.0692
NP_442431.1_10 Reverse -341 -359 1.19912 0.259
NP_442431.1_10 Reverse -346 -364 0.707465 0.267
NP_441110.1_1 Forward -312 -293 7.47261 0.224
NP_440147.1_4 Forward -233 -220 17.9155 0.00539
NP_440147.1_4 Reverse -220 -233 15.7522 0.0148
NP_440147.1_4 Reverse -149 -162 1.10092 0.239
NP_441295.1_4 Reverse -217 -236 -4.52377 0.29
NP_441550.1_8 Forward -233 -223 15.8108 0.0132
NP_441550.1_8 Reverse -220 -230 15.1225 0.0132
NP_441916.1_7 Reverse -222 -232 18.9579 0.00144
NP_441916.1_7 Forward -231 -221 10.3048 0.0261
NP_441916.1_7 Forward -263 -253 2.83163 0.239
NP_441041.1_4 Forward -231 -212 -8.45701 0.203
NP_441041.1_4 Reverse -222 -241 -9.53865 0.218
NP_441041.1_7 Forward -234 -222 13.3454 0.0485
NP_441041.1_7 Reverse -219 -231 7.51478 0.162
NP_441041.1_9 Forward -47 -33 13.1753 0.275
NP_440569.1_10 Forward -179 -160 2.33913 0.293
NP_442004.1_6 Reverse -222 -236 5.99778 0.181
NP_441725.1_4 Forward -236 -222 12.192 0.0693
NP_441725.1_4 Forward -26 -12 6.29216 0.278
NP_441725.1_4 Reverse -217 -231 4.42388 0.278
NP_441725.1_5 Forward -230 -220 2.04498 0.115
NP_441725.1_5 Reverse -223 -233 1.94665 0.115
NP_439966.1_7 Reverse -220 -230 15.3192 0.0152
NP_439966.1_7 Forward -233 -223 14.3359 0.0203
NP_442941.1_3 Forward -230 -220 19.2529 0.00262
NP_442941.1_3 Reverse -223 -233 19.2529 0.00262
NP_440289.1_2 Forward -234 -221 3.16588 0.0811
NP_440289.1_2 Reverse -219 -232 -3.71729 0.267
NP_440983.1_5 Forward -364 -345 -7.57203 0.291
NP_440983.1_5 Forward -361 -342 -7.57203 0.291
NP_440983.1_5 Forward -231 -212 -7.86702 0.294
NP_440260.1_8 Reverse -354 -372 -4.99573 0.273
NP_442281.1_1 Reverse -217 -231 16.5185 0.00772
NP_442281.1_1 Forward -236 -222 14.6503 0.0168
NP_442281.1_1 Reverse -146 -160 4.62054 0.187
NP_442281.1_1 Forward -377 -363 1.96562 0.282
NP_441334.1_7 Forward -233 -214 -20.4534 0.276
NP_440437.1_1 Forward -373 -354 -3.04881 0.232
NP_442012.1_1 Reverse -370 -389 1.17943 0.222
NP_441087.1_6 Forward -202 -184 7.29487 0.233
NP_441556.1_10 Reverse -217 -231 13.0446 0.182
NP_440498.1_1 Forward -240 -222 0.805796 0.212
NP_441644.1_6 Reverse -222 -232 19.0557 0.000803
NP_441644.1_6 Forward -231 -221 17.3841 0.00127
NP_441644.1_6 Reverse -131 -141 12.3692 0.0339
NP_441644.1_6 Forward -140 -130 4.10949 0.249
NP_440867.1_10 Reverse -116 -135 7.86593 0.251
NP_442215.1_2 Forward -142 -126 -1.21977 0.181
NP_442215.1_2 Forward -233 -217 -1.51476 0.186
NP_442215.1_2 Reverse -207 -223 -6.92296 0.281
NP_442029.1_6 Forward -236 -217 3.73603 0.277
NP_440929.1_8 Forward -231 -222 19.2726 0.000701
NP_440929.1_8 Reverse -222 -231 19.2726 0.000701
NP_442933.1_10 Forward -231 -222 17.601 0.00325
NP_442933.1_10 Reverse -222 -231 17.601 0.00325
NP_441751.2_8 Reverse -223 -237 12.3893 0.0193
NP_441751.2_8 Forward -230 -216 -2.16369 0.132
NP_441751.2_8 Forward -256 -242 -4.22864 0.166
NP_442926.1_3 Forward -242 -223 5.50599 0.226
NP_442926.1_3 Reverse -347 -366 4.52268 0.254
NP_442554.1_8 Reverse -223 -233 17.2863 0.00543
NP_442554.1_8 Forward -230 -220 16.2046 0.0065
NP_442554.1_8 Reverse -132 -142 4.50326 0.184
NP_442554.1_8 Forward -139 -129 3.61828 0.218
NP_441762.1_7 Forward -232 -220 -6.64753 0.284
NP_441762.1_7 Reverse -221 -233 -6.84419 0.284
NP_442142.1_4 Reverse -219 -232 14.08 0.0317
NP_442142.1_4 Forward -234 -221 12.9 0.0406
NP_442142.1_4 Forward -356 -343 7.2952 0.143
NP_442292.1_1 Forward -230 -221 18.486 0.00229
NP_442292.1_1 Reverse -223 -232 17.5026 0.00435
NP_442143.1_10 Reverse -152 -171 15.6341 0.183
NP_442476.1_3 Forward -213 -194 11.2092 0.214
NP_442476.1_6 Reverse -223 -237 11.701 0.0552
NP_442476.1_6 Forward -230 -216 11.3077 0.056
NP_442476.1_6 Forward -366 -352 3.44117 0.156
NP_440895.1_6 Forward -237 -224 9.55739 0.22
NP_440895.1_6 Reverse -216 -229 9.45906 0.22
NP_441523.1_6 Reverse -218 -237 7.86593 0.19
NP_441523.1_6 Forward -235 -216 6.29264 0.216
NP_443009.1_5 Reverse -221 -232 14.5128 0.02
NP_443009.1_5 Forward -232 -221 10.1862 0.0792
NP_443009.1_5 Forward -161 -150 8.21964 0.114
NP_442301.1_2 Reverse -201 -220 3.44025 0.294
NP_441715.1_4 Forward -230 -220 17.3846 0.0106
NP_441715.1_4 Reverse -223 -233 16.7946 0.0106
NP_441715.1_4 Forward -159 -149 5.28991 0.216
NP_440881.1_7 Reverse -22 -41 21.5339 0.0368
NP_440379.1_5 Forward -235 -216 -8.85033 0.256
NP_441468.1_1 Forward -230 -223 15.8704 0.0124
NP_441468.1_1 Reverse -223 -230 15.8704 0.0124
NP_439939.1_4 Reverse -30 -49 7.66927 0.158
NP_441015.1_10 Forward -145 -126 14.1591 0.0564
NP_441015.1_10 Forward -236 -217 11.7008 0.0657
NP_441015.1_10 Forward -230 -211 -8.65367 0.276
NP_441673.1_1 Forward -231 -222 20.8459 0.000698
NP_441673.1_1 Reverse -222 -231 20.8459 0.000698
NP_441673.1_1 Forward -290 -281 -8.06341 0.254
NP_441826.1_2 Reverse -216 -230 6.98109 0.0899
NP_441330.1_1 Reverse -217 -236 -13.9635 0.209
NP_441330.1_1 Forward -236 -217 -14.0619 0.212
NP_441379.1_2 Reverse -77 -96 3.83436 0.263
NP_442868.1_6 Reverse -220 -230 19.2529 0.00563
NP_442868.1_6 Forward -233 -223 10.4031 0.038
NP_441056.1_1 Forward -231 -212 -6.98204 0.271
NP_441612.1_2 Forward -231 -221 8.54929 0.21
NP_442227.1_2 Forward -288 -269 -3.73712 0.295
NP_442808.1_1 Forward -232 -222 8.73102 0.0481
NP_442808.1_1 Reverse -221 -231 8.63269 0.0481
NP_440145.1_3 Reverse -168 -187 -0.590531 0.142
NP_440145.1_3 Forward -241 -222 -5.11376 0.258
NP_442542.1_2 Forward -233 -220 7.88576 0.168
NP_442050.1_1 Reverse -345 -364 10.9142 0.233
NP_442050.1_5 Forward -233 -223 15.9091 0.0091
NP_442050.1_5 Reverse -220 -230 14.3359 0.0206
NP_440558.1_2 Reverse -354 -373 9.53756 0.102
NP_440558.1_2 Forward -240 -221 1.0811 0.185
NP_440558.1_2 Reverse -213 -232 -7.17871 0.289
NP_440558.1_2 Reverse -224 -243 -7.4737 0.294
NP_441878.1_6 Forward -232 -222 10.5014 0.0176
NP_441878.1_6 Reverse -221 -231 10.4031 0.0176
NP_441878.1_6 Forward -141 -131 0.668351 0.139
NP_441878.1_6 Reverse -130 -140 0.668351 0.139
NP_441878.1_6 Forward -264 -254 -7.59145 0.245
NP_441036.1_8 Forward -232 -222 15.713 0.00724
NP_441036.1_8 Reverse -221 -231 8.33817 0.174
NP_441557.1_5 Forward -231 -222 19.9609 0.000699
NP_441557.1_5 Reverse -222 -231 19.9609 0.000699
NP_441557.1_8 Forward -283 -273 11.1893 0.26
NP_441445.1_1 Forward -240 -221 5.11266 0.178
NP_441445.1_1 Forward -149 -130 4.42435 0.195
NP_441590.1_4 Forward -357 -338 6.98015 0.254
NP_442066.2_9 Forward -235 -222 12.6056 0.154
NP_442419.1_2 Reverse -217 -236 -2.45882 0.247
NP_440101.1_3 Forward -236 -217 20.059 0.0299
NP_440101.1_3 Reverse -217 -236 4.12936 0.224
NP_442183.1_1 Reverse -222 -236 8.65272 0.112
NP_442135.1_8 Forward -242 -224 12.9988 0.207
NP_441549.1_9 Reverse -218 -236 -4.01242 0.198
NP_442347.1_2 Forward -230 -221 12.4878 0.056
NP_442347.1_2 Reverse -223 -232 3.34298 0.284
NP_442347.1_10 Reverse -132 -146 16.0269 0.213
NP_442645.1_2 Reverse -273 -292 -18.8801 0.28
NP_441037.1_4 Forward -233 -223 7.22024 0.237
NP_442508.1_8 Forward -279 -262 11.1502 0.256
NP_440690.1_1 Forward -149 -130 9.43923 0.249
NP_441633.1_3 Reverse -220 -233 3.36254 0.0699
NP_441633.1_3 Forward -233 -220 -3.71729 0.177
NP_440136.1_2 Forward -230 -223 15.9687 0.0123
NP_440136.1_2 Reverse -223 -230 15.9687 0.0123
NP_441728.2_4 Forward -123 -104 19.8142 0.0402
NP_442998.1_5 Reverse -305 -315 14.828 0.149
NP_442998.1_10 Forward -229 -222 15.5754 0.0102
NP_442998.1_10 Reverse -224 -231 15.5754 0.0102
NP_440299.1_1 Reverse -218 -231 20.2748 0.00128
NP_440299.1_1 Reverse -127 -140 2.37867 0.291
NP_441799.1_1 Forward -235 -221 16.6169 0.0138
NP_441799.1_1 Reverse -218 -232 7.57046 0.138
NP_441007.1_10 Forward -236 -223 12.8023 0.0499
NP_441007.1_10 Reverse -217 -230 -0.669033 0.287
NP_442334.1_2 Forward -221 -204 -4.58271 0.2
NP_440256.1_1 Forward -234 -215 13.2741 0.0103
NP_440256.1_1 Reverse -219 -238 6.88262 0.0282
NP_440256.1_1 Reverse -360 -379 -6.29373 0.207
NP_441559.1_8 Reverse -217 -231 2.94952 0.143
NP_441559.1_8 Forward -236 -222 1.47456 0.155
NP_441559.1_8 Reverse -276 -290 -2.75368 0.193
NP_441559.1_8 Forward -377 -363 -7.17857 0.287
NP_440915.1_6 Reverse -218 -232 19.6658 0.00738
NP_440915.1_6 Forward -235 -221 0.982901 0.148
NP_440997.1_6 Reverse -249 -268 12.2908 0.228
NP_442158.1_4 Reverse -298 -308 16.008 0.129
NP_442158.1_4 Reverse -367 -377 12.2714 0.253
NP_441179.1_9 Reverse -240 -250 12.9592 0.272
NP_440717.1_3 Reverse -212 -226 7.57046 0.28
NP_442785.1_7 Forward -233 -219 11.2093 0.228
NP_441704.1_8 Reverse -211 -230 11.3067 0.142
NP_442866.1_1 Forward -236 -217 -9.047 0.288
NP_440695.1_5 Reverse -222 -241 9.83255 0.15
NP_441494.1_6 Forward -236 -223 8.47575 0.23
NP_442993.1_1 Reverse -248 -264 -9.28291 0.181
NP_442993.1_1 Reverse -222 -238 -12.7245 0.278
NP_442386.1_9 Reverse -221 -230 13.8639 0.0289
NP_442386.1_9 Reverse -357 -366 7.17747 0.219
NP_442386.1_9 Forward -232 -223 6.39082 0.219
NP_441340.1_5 Forward -230 -223 15.6737 0.0124
NP_441340.1_5 Reverse -223 -230 15.6737 0.0124
NP_441340.1_9 Forward -117 -107 13.7504 0.199
NP_441340.1_9 Reverse -29 -39 8.06241 0.256
NP_443028.1_4 Forward -354 -335 11.9031 0.263
NP_442484.1_2 Reverse -211 -230 25.5655 0.00387
NP_442484.1_2 Reverse -120 -139 0.196116 0.25
NP_442484.1_2 Forward -242 -223 -0.39387 0.262
NP_439976.1_5 Reverse -34 -48 11.897 0.268
NP_440161.1_3 Forward -162 -143 11.7008 0.206
NP_440586.1_1 Reverse -339 -358 -4.42544 0.278
NP_440586.1_8 Forward -230 -223 13.2151 0.026
NP_440586.1_8 Reverse -223 -230 13.2151 0.026
NP_440586.1_8 Reverse -240 -247 5.64364 0.297
NP_442251.1_6 Forward -230 -223 15.2804 0.0124
NP_442251.1_6 Reverse -223 -230 15.2804 0.0124
NP_442959.1_7 Forward -347 -328 -5.11376 0.296
NP_441262.1_3 Reverse -222 -229 14.7888 0.0223
NP_441262.1_3 Forward -231 -224 14.7888 0.0223
NP_440027.1_8 Reverse -219 -238 5.60352 0.279
NP_443051.1_1 Forward -232 -223 19.5676 0.00335
NP_443051.1_1 Reverse -221 -230 10.4228 0.00754
NP_439937.1_9 Forward -357 -340 -10.6799 0.232
NP_440398.1_6 Reverse -140 -159 3.73603 0.294
NP_440408.1_7 Forward -231 -212 15.6341 0.149
NP_440408.1_7 Reverse -222 -241 10.7175 0.246
NP_440439.1_1 Forward -234 -221 10.934 0.0339
NP_440439.1_1 Reverse -219 -232 8.86907 0.0488
NP_440439.1_1 Forward -218 -205 3.5592 0.112
NP_440439.1_1 Forward -223 -210 -1.75067 0.281
NP_442239.1_8 Reverse -346 -365 5.30933 0.28
NP_439943.1_1 Forward -315 -296 -8.752 0.28
NP_439943.1_7 Reverse -217 -236 10.7175 0.161
NP_440372.1_2 Forward -230 -223 16.3621 0.0124
NP_440372.1_2 Reverse -223 -230 16.3621 0.0124
NP_441803.1_2 Forward -236 -217 -0.688862 0.284
NP_439977.1_5 Forward -237 -218 11.5042 0.067
NP_441572.1_7 Reverse -216 -235 8.25926 0.0743
NP_441572.1_7 Forward -237 -218 2.55606 0.131
NP_441572.1_7 Forward -378 -359 1.86774 0.142
NP_440267.1_2 Reverse -201 -215 7.17714 0.207
NP_442384.1_10 Forward -231 -218 20.8655 0.00194
NP_442384.1_10 Reverse -222 -235 17.0305 0.0065
NP_442384.1_10 Forward -140 -127 6.01747 0.113
NP_442384.1_10 Reverse -131 -144 1.29759 0.263
NP_441380.1_8 Reverse -252 -271 -1.96717 0.232
NP_441877.1_7 Reverse -237 -256 1.47364 0.242
NP_441877.1_9 Reverse -101 -118 3.87375 0.284
NP_441018.1_7 Forward -235 -216 9.83255 0.218
NP_442790.1_4 Reverse -213 -232 -7.4737 0.153
NP_442262.1_10 Forward -230 -223 14.1988 0.0123
NP_442262.1_10 Reverse -223 -230 14.1988 0.0123
NP_441689.1_5 Forward -233 -223 8.3377 0.132
NP_441689.1_5 Reverse -220 -230 5.78111 0.197
NP_440344.1_10 Forward -238 -221 -6.15601 0.112
NP_440282.1_10 Forward -241 -222 -0.590531 0.21
NP_440282.1_10 Forward -267 -248 -4.81876 0.25
NP_440282.1_10 Forward -150 -131 -9.14533 0.272
NP_440531.1_6 Reverse -240 -259 -1.27885 0.231
NP_440531.1_6 Reverse -214 -233 -4.13045 0.276
NP_442910.1_1 Reverse -215 -234 -5.21209 0.254
NP_441965.1_3 Reverse -212 -231 1.27776 0.223
NP_441965.1_10 Reverse -219 -235 9.20332 0.123
NP_441965.1_10 Forward -234 -218 2.12349 0.289
NP_442693.1_6 Reverse -357 -376 3.04771 0.278
NP_442693.1_7 Forward -141 -122 11.5042 0.227
NP_440297.1_9 Forward -230 -220 -0.118297 0.282
NP_440297.1_9 Reverse -223 -233 -0.216628 0.282
NP_442280.1_10 Reverse -121 -139 16.6555 0.1
NP_442280.1_10 Reverse -212 -230 12.5647 0.177
NP_441896.1_3 Reverse -349 -368 4.71934 0.14
NP_441103.1_9 Reverse -213 -223 13.0755 0.27
NP_440894.1_10 Forward -268 -249 8.06259 0.185
NP_443036.1_1 Forward -189 -170 8.75009 0.291
NP_440999.1_2 Reverse -364 -383 9.83255 0.275
NP_440999.1_9 Reverse -218 -232 7.57108 0.0846
NP_440999.1_9 Forward -235 -221 7.17775 0.0896
NP_440999.1_9 Reverse -130 -144 -2.26202 0.264
NP_440888.1_2 Forward -231 -217 17.7968 0.00308
NP_440888.1_2 Reverse -222 -236 10.5204 0.0919
NP_440052.1_5 Reverse -211 -230 -2.26216 0.212
NP_442948.1_2 Forward -232 -213 8.84924 0.188
NP_442033.1_10 Forward -233 -214 -10.7186 0.243
NP_441543.1_2 Forward -230 -221 16.9127 0.00359
NP_441543.1_2 Reverse -223 -232 15.9293 0.00518
NP_442845.1_2 Forward -237 -223 7.57108 0.195
NP_442845.1_2 Forward -231 -217 7.37441 0.195
NP_442845.1_2 Reverse -216 -230 5.70279 0.225
NP_442845.1_2 Forward -146 -132 5.1128 0.243
NP_441551.1_5 Reverse -218 -234 6.74435 0.258
NP_441469.1_8 Reverse -357 -366 12.1928 0.123
NP_441469.1_8 Forward -373 -364 10.5211 0.212
NP_441469.1_8 Forward -232 -223 6.5879 0.227
NP_441469.1_8 Reverse -221 -230 6.48957 0.227
NP_443064.1_6 Forward -231 -221 12.5669 0.0796
NP_443064.1_6 Reverse -222 -232 10.8217 0.13
NP_442578.1_7 Forward -230 -223 14.5921 0.026
NP_442578.1_7 Reverse -223 -230 14.5921 0.026
NP_441462.1_2 Reverse -222 -232 20.2362 0.000805
NP_441462.1_2 Forward -231 -221 11.5831 0.00406
NP_441621.1_7 Reverse -220 -234 -5.21195 0.248
NP_441621.1_7 Forward -360 -346 -6.49025 0.295
NP_443062.1_1 Reverse -222 -240 14.3964 0.048
NP_443062.1_1 Forward -231 -213 4.93815 0.244
NP_443062.1_1 Forward -248 -230 4.06059 0.276
NP_443062.1_6 Forward -168 -149 0.786102 0.288
NP_442204.1_1 Reverse -218 -229 11.5634 0.0565
NP_442204.1_1 Forward -235 -224 11.2684 0.0565
NP_442204.1_1 Forward -376 -365 -0.0396598 0.285
NP_442204.1_2 Forward -241 -222 10.6192 0.223
NP_440516.1_8 Forward -231 -222 16.9127 0.00442
NP_440516.1_8 Reverse -222 -231 16.9127 0.00442
NP_442428.1_5 Forward -230 -223 15.8704 0.0124
NP_442428.1_5 Reverse -223 -230 15.8704 0.0124
NP_442120.1_10 Reverse -358 -377 -16.0285 0.296
NP_440673.1_3 Forward -229 -222 12.4288 0.0426
NP_440673.1_3 Reverse -224 -231 12.4288 0.0426
NP_440865.1_9 Forward -237 -218 0.294447 0.143
NP_441052.1_2 Forward -231 -221 19.9412 0.00106
NP_441052.1_2 Forward -140 -130 11.4848 0.0285
NP_441052.1_2 Reverse -222 -232 10.4031 0.0285
NP_441052.1_2 Reverse -131 -141 1.16001 0.25
NP_441052.1_2 Reverse -254 -264 0.766681 0.256
NP_442219.1_9 Forward -230 -221 17.7976 0.00718
NP_442219.1_9 Reverse -223 -232 8.25953 0.0681
NP_440436.1_4 Forward -230 -221 17.2072 0.00233
NP_440436.1_4 Reverse -223 -232 9.24241 0.0871
NP_440436.1_4 Forward -159 -150 4.12922 0.288
NP_441884.1_9 Forward -234 -215 -22.5183 0.281
NP_440314.1_9 Reverse -223 -242 -7.27704 0.238
NP_442907.1_7 Reverse -241 -260 12.0942 0.287
NP_441719.1_4 Forward -230 -223 16.3621 0.0124
NP_441719.1_4 Reverse -223 -230 16.3621 0.0124
NP_441004.1_1 Reverse -346 -365 -16.8151 0.287
NP_441004.1_1 Reverse -288 -307 -17.9951 0.296
NP_442206.1_4 Reverse -223 -242 7.37428 0.259
NP_442206.1_10 Reverse -222 -237 5.19144 0.178
NP_442206.1_10 Forward -231 -216 2.43817 0.201
NP_440328.1_4 Reverse -216 -235 17.109 0.0249
NP_441851.1_10 Reverse -221 -231 15.8113 0.00552
NP_441851.1_10 Reverse -374 -384 9.91146 0.109
NP_441851.1_10 Forward -232 -222 8.53483 0.114
NP_442622.1_1 Reverse -206 -225 -5.60541 0.257
NP_442700.1_2 Reverse -303 -322 17.3057 0.223
NP_442856.1_7 Reverse -213 -232 3.04771 0.153
NP_442515.1_1 Reverse -221 -235 4.32615 0.107
NP_440593.1_3 Reverse -126 -145 4.12936 0.143
NP_441349.1_10 Forward -241 -222 8.94757 0.0254
NP_441349.1_10 Reverse -212 -231 0.982764 0.0852
NP_441409.1_6 Forward -237 -218 2.94938 0.0543
NP_441409.1_6 Reverse -216 -235 0.687771 0.0648
NP_440432.1_9 Forward -230 -215 -3.95334 0.194
NP_439960.1_6 Forward -359 -340 13.7658 0.176
NP_439960.1_10 Reverse -215 -233 13.7855 0.0769
NP_440474.1_8 Reverse -359 -373 5.40719 0.25
NP_440431.1_3 Reverse -221 -240 -8.752 0.236
NP_440431.1_3 Reverse -150 -169 -9.24366 0.242
NP_442450.1_3 Forward -124 -106 9.6548 0.207
NP_442450.1_5 Forward -265 -255 5.28991 0.251
NP_440588.1_2 Reverse -213 -232 4.81767 0.0762
NP_440588.1_2 Forward -240 -221 -3.63879 0.191
NP_440588.1_2 Forward -272 -253 -5.21209 0.243
NP_441031.1_1 Forward -124 -105 10.679 0.193
NP_440040.1_8 Reverse -45 -64 7.78217 0.203
NP_442006.1_2 Forward -225 -208 -8.81095 0.197
NP_441003.1_9 Reverse -122 -141 11.1109 0.213
NP_441003.1_9 Reverse -239 -258 5.99764 0.255
NP_442243.1_1 Reverse -216 -234 -2.24319 0.288
NP_441570.1_1 Forward -231 -213 1.00246 0.034
NP_441570.1_1 Reverse -358 -376 -0.964162 0.0525
NP_441078.1_4 Forward -231 -222 19.6659 0.0007
NP_441078.1_4 Reverse -222 -231 19.6659 0.0007
NP_441078.1_4 Reverse -254 -263 -1.18024 0.237
NP_441078.1_4 Reverse -131 -140 -1.47524 0.266
NP_441078.1_4 Forward -140 -131 -1.77023 0.266
NP_442729.1_5 Reverse -274 -284 7.84651 0.261
NP_441663.1_8 Reverse -216 -235 1.17943 0.212
NP_441663.1_8 Forward -237 -218 -3.14714 0.276
NP_440526.1_3 Forward -230 -219 8.02298 0.126
NP_440526.1_3 Forward -283 -272 7.23633 0.156
NP_441432.1_8 Reverse -221 -230 16.8143 0.00595
NP_441432.1_8 Forward -232 -223 16.8143 0.00595
NP_441432.1_8 Forward -291 -282 5.3096 0.17
NP_441432.1_8 Reverse -247 -256 3.34298 0.248
NP_441432.1_8 Reverse -130 -139 3.14632 0.259
NP_441432.1_8 Reverse -253 -262 2.94966 0.28
NP_441432.1_8 Forward -367 -358 2.65466 0.292
NP_441432.1_9 Forward -46 -33 10.7314 0.245
NP_442320.1_8 Reverse -216 -230 5.21113 0.0401
NP_442344.1_7 Reverse -223 -242 -8.65367 0.222
NP_441732.1_2 Forward -235 -219 -6.82463 0.0533
NP_441732.1_2 Reverse -218 -234 -16.0677 0.164
NP_440629.1_4 Reverse -148 -167 9.43923 0.252
NP_440685.1_6 Reverse -219 -238 16.4199 0.217
NP_440760.1_1 Forward -231 -212 -6.98204 0.0668
NP_442353.1_4 Reverse -125 -144 2.16195 0.236
NP_442510.1_5 Reverse -213 -232 13.8641 0.223
NP_440913.1_1 Forward -233 -215 9.36059 0.179
NP_442400.1_10 Forward -169 -156 8.65605 0.278
NP_440713.1_4 Forward -225 -206 15.1424 0.0793
NP_440713.1_4 Reverse -212 -231 11.7992 0.113
NP_440713.1_4 Forward -138 -119 4.22769 0.231
NP_442489.1_7 Forward -231 -222 20.1576 0.000695
NP_442489.1_7 Reverse -222 -231 20.1576 0.000695
NP_442489.1_7 Reverse -131 -140 -1.6719 0.235
NP_442489.1_7 Forward -263 -254 -1.77023 0.247
NP_442489.1_7 Forward -140 -131 -1.77023 0.247
NP_442489.1_7 Reverse -281 -290 -1.77023 0.247
NP_440559.1_1 Forward -230 -221 17.4043 0.00658
NP_440559.1_1 Reverse -223 -232 8.65285 0.0586
NP_440559.1_1 Reverse -152 -161 4.42462 0.277
NP_441659.2_8 Reverse -222 -232 20.9245 0.000805
NP_441659.2_8 Forward -231 -221 18.1713 0.00133
NP_442913.1_10 Reverse -213 -232 -1.47551 0.171
NP_442913.1_10 Reverse -266 -285 -2.95047 0.195
NP_442008.1_2 Forward -234 -215 4.62101 0.234
NP_442776.1_1 Reverse -211 -230 4.03102 0.278
NP_442346.1_5 Reverse -221 -231 16.6963 0.00248
NP_442346.1_5 Forward -232 -222 16.303 0.00248
NP_442346.1_5 Reverse -130 -140 11.3864 0.0681
NP_442346.1_5 Forward -141 -131 9.91146 0.114
NP_442346.1_5 Forward -252 -242 7.84651 0.156
NP_440545.1_3 Reverse -218 -235 12.8219 0.0194
NP_440545.1_3 Forward -235 -218 -0.649475 0.157
NP_441856.1_3 Reverse -219 -238 1.37609 0.213
NP_441710.1_9 Reverse -215 -234 16.5182 0.0992
NP_441923.1_6 Forward -224 -210 10.816 0.252
NP_440486.1_9 Reverse -212 -226 13.3726 0.246
NP_440459.1_2 Forward -233 -216 15.7718 0.106
NP_441653.1_2 Reverse -223 -242 6.9118 0.225
NP_441653.1_2 Reverse -211 -230 4.49595 0.257
NP_440010.1_3 Reverse -365 -384 -8.45701 0.297
NP_442551.1_4 Reverse -129 -144 4.99478 0.242
NP_442900.1_2 Forward -58 -39 5.70265 0.179
NP_442603.1_7 Forward -231 -217 19.7634 0.00895
NP_441888.1_7 Reverse -146 -160 12.4876 0.0743
NP_441888.1_7 Reverse -217 -231 3.73617 0.225
NP_440170.1_6 Forward -236 -217 11.5042 0.285
NP_441833.1_4 Forward -230 -223 15.9687 0.0124
NP_441833.1_4 Reverse -223 -230 15.9687 0.0124
NP_441895.1_10 Reverse -154 -173 -19.1751 0.282
NP_442162.1_9 Forward -230 -223 16.2637 0.0124
NP_442162.1_9 Reverse -223 -230 16.2637 0.0124
NP_440671.1_4 Reverse -216 -230 9.14437 0.184
NP_440224.1_1 Reverse -211 -230 3.14605 0.132
NP_442045.1_5 Reverse -213 -232 -1.86883 0.29
NP_442199.1_5 Forward -239 -220 8.35759 0.0712
NP_442140.1_3 Forward -230 -220 10.3048 0.0902
NP_442140.1_3 Reverse -240 -250 5.97822 0.189
NP_442140.1_3 Reverse -223 -233 4.69992 0.238
NP_440875.1_9 Reverse -224 -234 16.5483 0.0145
NP_440875.1_9 Forward -229 -219 8.37203 0.233
NP_441813.1_3 Reverse -158 -177 14.2373 0.248
NP_441813.1_5 Reverse -220 -230 18.1713 0.00743
NP_441813.1_5 Forward -233 -223 18.1713 0.00743
NP_440590.1_4 Forward -230 -217 12.8023 0.013
NP_440590.1_4 Reverse -223 -236 -5.29059 0.277
NP_440567.1_1 Reverse -223 -237 9.2427 0.0471
NP_440567.1_1 Forward -230 -216 8.35772 0.0584
NP_442497.1_10 Reverse -223 -232 17.601 0.00813
NP_442497.1_10 Forward -230 -221 10.4228 0.0087
NP_440821.1_4 Reverse -220 -230 9.41981 0.0286
NP_440821.1_4 Forward -233 -223 2.24165 0.131
NP_440927.1_4 Forward -46 -27 13.2741 0.247
NP_441239.1_9 Forward -233 -221 13.0187 0.0389
NP_441239.1_9 Reverse -220 -232 5.25052 0.223
NP_441239.1_9 Forward -374 -362 3.57889 0.283
NP_441727.1_3 Forward -238 -219 5.89931 0.248
NP_442044.1_1 Forward -372 -353 -14.5535 0.291
NP_441541.1_1 Reverse -102 -120 -0.379982 0.237
NP_441541.1_1 Forward -61 -43 -1.04843 0.237
NP_441936.1_9 Forward -245 -226 13.8641 0.26
NP_440546.1_4 Reverse -222 -232 13.5365 0.0459
NP_440546.1_4 Forward -231 -221 10.046 0.109
NP_441230.1_5 Forward -212 -193 3.53937 0.198
NP_440462.1_6 Forward -233 -223 18.7612 0.00454
NP_440462.1_6 Reverse -220 -230 9.61647 0.0429
NP_442340.1_3 Forward -365 -346 -5.50708 0.223
NP_440868.1_4 Forward -235 -223 17.0502 0.0124
NP_440868.1_4 Reverse -218 -230 8.00379 0.0602
NP_442402.1_4 Forward -239 -220 -7.86776 0.278
NP_442402.1_4 Forward -392 -373 -7.96609 0.278
NP_442402.1_10 Reverse -388 -398 11.6809 0.241
NP_441084.1_6 Reverse -176 -190 10.5076 0.238
NP_440653.1_10 Forward -139 -120 2.65439 0.288
NP_441843.2_9 Reverse -236 -254 13.2154 0.205
NP_442039.1_3 Forward -314 -295 15.4374 0.277
NP_442039.1_4 Forward -230 -223 15.1821 0.0124
NP_442039.1_4 Reverse -223 -230 15.1821 0.0124
NP_441811.1_8 Forward -269 -255 7.9644 0.241
NP_442829.1_1 Reverse -25 -44 15.9291 0.125
NP_440825.1_6 Reverse -267 -286 12.2908 0.252
NP_442837.1_3 Forward -230 -223 15.7721 0.0124
NP_442837.1_3 Reverse -223 -230 15.7721 0.0124
NP_439994.1_3 Reverse -253 -272 9.99938 0.225
NP_442053.1_1 Forward -231 -222 18.3876 0.0007
NP_442053.1_1 Reverse -222 -231 18.3876 0.0007
NP_440505.1_3 Reverse -220 -230 18.3679 0.00213
NP_440505.1_3 Forward -233 -223 17.188 0.00332
NP_441203.1_1 Forward -230 -211 -18.8801 0.297
NP_441203.1_1 Reverse -364 -383 -20.5517 0.297
NP_442532.1_4 Forward -169 -151 11.5524 0.234
NP_441408.2_7 Forward -233 -214 5.80098 0.172
NP_441408.2_7 Reverse -170 -189 -5.50708 0.295
NP_441408.2_7 Forward -142 -123 -5.50708 0.295
NP_440914.1_1 Forward -231 -221 17.5935 0.000537
NP_440914.1_1 Reverse -222 -232 16.3248 0.00196
NP_440914.1_1 Reverse -358 -368 10.3717 0.142
NP_440914.1_1 Forward -290 -280 9.39583 0.186
NP_441011.1_8 Reverse -223 -232 16.6177 0.00602
NP_441011.1_8 Forward -230 -221 8.25953 0.144
NP_442533.1_6 Forward -231 -222 17.2076 0.00137
NP_442533.1_6 Reverse -222 -231 17.2076 0.00137
NP_442533.1_6 Reverse -131 -140 13.9627 0.0155
NP_442533.1_6 Forward -140 -131 6.68623 0.105
NP_442322.1_3 Reverse -175 -189 18.1908 0.282
NP_442322.1_4 Forward -361 -344 -9.89323 0.297
NP_441482.1_7 Forward -237 -223 6.48943 0.0279
NP_441482.1_7 Reverse -216 -230 -0.688726 0.0612
NP_439944.1_9 Forward -230 -220 10.5014 0.0887
NP_439944.1_9 Reverse -223 -233 9.12481 0.1
NP_441028.1_6 Forward -381 -371 4.40448 0.278
NP_440116.1_8 Reverse -223 -242 1.17943 0.0926
NP_440116.1_8 Forward -230 -211 -1.08219 0.116
NP_440115.1_6 Reverse -219 -229 16.008 0.0325
NP_440115.1_6 Forward -234 -224 14.0414 0.0615
NP_440115.1_6 Reverse -373 -383 4.89658 0.28
NP_440007.1_9 Reverse -218 -232 8.84938 0.171
NP_440007.1_9 Forward -235 -221 6.98109 0.213
NP_439965.1_1 Reverse -213 -232 -6.39206 0.213
NP_441347.1_5 Forward -237 -223 20.0584 0.0567
NP_441170.1_4 Reverse -122 -140 8.27895 0.194
NP_441972.1_5 Forward -230 -211 9.43923 0.065
NP_441972.1_5 Forward -139 -120 -7.96535 0.256
NP_441972.1_5 Forward -383 -364 -9.34199 0.283
NP_441106.1_1 Forward -232 -223 18.486 0.0028
NP_441106.1_1 Reverse -221 -230 9.63616 0.0311
NP_441286.1_1 Reverse -221 -233 5.93884 0.0258
NP_441286.1_1 Forward -232 -220 3.48056 0.0467
NP_442674.1_3 Reverse -240 -259 6.09517 0.246
NP_440670.1_8 Forward -231 -222 18.3876 0.000699
NP_440670.1_8 Reverse -222 -231 18.3876 0.000699
NP_441479.1_1 Reverse -341 -360 8.06259 0.263
NP_441886.1_6 Reverse -168 -187 20.354 0.105
NP_440886.1_5 Forward -241 -222 17.2074 0.226
NP_440886.1_7 Forward -232 -222 8.04271 0.0805
NP_440886.1_7 Reverse -221 -231 7.94438 0.0805
NP_440828.1_4 Forward -368 -349 -4.32786 0.246
NP_442614.1_2 Forward -134 -120 12.1926 0.166
NP_442614.1_2 Reverse -222 -236 9.14437 0.242
NP_442614.1_2 Forward -231 -217 9.04604 0.242
NP_440460.1_9 Reverse -23 -36 16.6372 0.268
NP_442072.1_9 Forward -219 -201 -13.1572 0.102
NP_440907.2_8 Reverse -223 -233 9.616 0.103
NP_441463.1_3 Forward -377 -358 -1.96717 0.147
NP_441463.1_3 Forward -241 -222 -2.26216 0.152
NP_441463.1_6 Forward -369 -355 7.38227 0.261
NP_441626.1_2 Forward -230 -223 15.7721 0.0124
NP_441626.1_2 Reverse -223 -230 15.7721 0.0124
NP_442211.1_3 Forward -378 -359 8.63916 0.275
NP_442365.1_7 Reverse -218 -237 -2.0655 0.199
NP_442794.1_1 Reverse -218 -230 20.0002 0.00523
NP_442794.1_1 Forward -376 -364 4.07055 0.279
NP_442615.1_1 Forward -240 -222 18.407 0.00553
NP_440387.1_1 Reverse -222 -238 -3.18639 0.156
NP_440387.1_1 Forward -263 -247 -4.26803 0.181
NP_441431.1_2 Forward -234 -220 6.68548 0.263
NP_441488.1_8 Reverse -217 -231 10.717 0.146
NP_441836.1_2 Forward -237 -218 16.9124 0.0403
NP_441836.1_2 Forward -146 -127 4.03102 0.147
NP_441836.1_2 Reverse -236 -255 -3.14714 0.234
NP_441993.1_1 Reverse -216 -235 2.33652 0.26
NP_440143.1_1 Forward -149 -130 12.3892 0.284
NP_440467.1_3 Forward -242 -223 14.9673 0.154
NP_440114.1_10 Reverse -222 -236 11.6026 0.107
NP_440114.1_10 Reverse -358 -372 5.60446 0.3
NP_440935.1_6 Reverse -101 -118 8.45543 0.179
NP_442323.1_7 Reverse -217 -236 14.4533 0.076
NP_439988.1_3 Reverse -120 -134 5.89945 0.278
NP_442743.1_4 Reverse -364 -383 8.25926 0.0724
NP_442743.1_4 Forward -230 -211 -6.78538 0.279
NP_440457.1_1 Reverse -218 -230 7.61046 0.101
NP_440457.1_1 Forward -235 -223 0.628964 0.25
NP_442940.1_2 Reverse -222 -241 -1.08219 0.296
NP_442130.1_8 Reverse -369 -388 6.29183 0.264
NP_442040.1_5 Reverse -123 -142 17.8948 0.206
NP_440473.1_1 Forward -234 -215 11.5466 0.273
NP_442509.1_9 Forward -231 -221 8.14104 0.192
NP_442509.1_9 Reverse -222 -232 8.04271 0.192
NP_443037.1_7 Forward -165 -146 -11.4069 0.289
NP_442439.1_8 Forward -141 -122 7.7676 0.273
NP_441765.1_4 Forward -310 -291 18.9773 0.0921
NP_440185.1_2 Reverse -86 -105 18.1907 0.113
NP_440554.1_4 Reverse -223 -233 17.9746 0.0131
NP_440554.1_4 Forward -230 -220 8.92815 0.0646
NP_442862.1_3 Reverse -339 -356 10.4619 0.206
NP_441885.1_5 Forward -231 -221 20.9245 0.000538
NP_441885.1_5 Reverse -222 -232 11.3864 0.00668
NP_441885.1_5 Reverse -248 -258 -0.806614 0.228
NP_440478.1_4 Forward -235 -216 14.3558 0.168
NP_440478.1_10 Forward -233 -219 5.99778 0.3
NP_441428.1_8 Reverse -350 -369 3.14605 0.251
NP_442341.1_9 Forward -233 -219 13.372 0.083
NP_441756.1_5 Reverse -218 -237 0.0977854 0.242
NP_441173.1_9 Forward -30 -22 10.5404 0.261
NP_442395.2_4 Forward -232 -213 6.98015 0.141
NP_443000.1_7 Forward -233 -223 20.3345 0.00223
NP_443000.1_7 Reverse -220 -230 19.9412 0.00223
NP_443000.1_7 Reverse -279 -289 2.24165 0.226
NP_440076.1_5 Reverse -215 -234 12.4867 0.266
NP_441842.1_1 Forward -383 -370 10.2451 0.3
NP_440275.1_3 Forward -233 -223 16.1063 0.0155
NP_440275.1_3 Reverse -220 -230 15.123 0.0182
NP_443060.1_5 Reverse -214 -233 9.93006 0.191
NP_442451.1_2 Reverse -214 -233 -9.24366 0.259
NP_440175.1_4 Reverse -355 -374 -12.6852 0.235
NP_440175.1_4 Forward -142 -123 -14.5535 0.277
NP_440149.1_8 Forward -231 -212 6.88262 0.0635
NP_441105.1_3 Forward -242 -223 16.7157 0.0133
NP_441105.1_3 Reverse -243 -262 -6.98204 0.243
NP_440216.1_1 Forward -231 -217 9.2427 0.00589
NP_440216.1_1 Reverse -222 -236 7.27608 0.00942
NP_440216.1_7 Forward -281 -263 12.4089 0.248
NP_440216.1_9 Forward -308 -299 10.3245 0.286
NP_440172.1_1 Reverse -222 -232 17.5813 0.00421
NP_440172.1_1 Forward -231 -221 15.0247 0.00945
NP_440172.1_1 Reverse -131 -141 2.33998 0.279
NP_440172.1_1 Forward -290 -280 2.04498 0.286
NP_442015.1_10 Reverse -218 -231 21.1604 0.00329
NP_442015.1_10 Forward -235 -222 3.65753 0.178
NP_441226.1_7 Forward -230 -223 14.4934 0.0123
NP_441226.1_7 Reverse -223 -230 14.4934 0.0123
NP_440198.1_10 Forward -396 -377 7.86593 0.296
NP_441111.1_7 Forward -230 -222 18.7023 0.00294
NP_441111.1_7 Reverse -223 -231 18.7023 0.00294
NP_441766.1_2 Forward -231 -222 17.5026 0.00297
NP_441766.1_2 Reverse -222 -231 17.5026 0.00297
NP_442417.1_5 Forward -231 -217 7.37441 0.19
NP_440416.1_9 Reverse -215 -234 0.687771 0.051
NP_440416.1_9 Forward -238 -219 -5.01543 0.0791
NP_440416.1_9 Reverse -356 -375 -7.86702 0.108
NP_440416.1_9 Reverse -124 -143 -18.8801 0.266
NP_440072.1_5 Reverse -266 -284 -3.12744 0.277
NP_442116.1_6 Forward -167 -150 5.97264 0.289
NP_442154.1_1 Reverse -341 -359 -9.42063 0.179
NP_440261.1_5 Forward -230 -217 6.80412 0.0316
NP_440261.1_5 Reverse -223 -236 6.70579 0.0318
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AACTCGGGAAACTGAATGGATTCCCCCCGGAAATGGCATTGCCGCCACACCAGCCCCGAAACGTTATGTTGCCTTTGATATTCATGGATCTGCCCACGAAAATCTTGATAGGCAAACACCTTCCCCACTTGGTCGAGGTTGATAGCCTTAGCCATGATCGGATTGTCCAGGCGATCGCCAGGGGAGAGGAGCACTCGTTTACCCTGACAAGTTGCCCTTAGCTCCTGCTCCAAAATTTCTAGCAATTGCTGGGTTGTGTAGGTCATGGCCAAAGGGAGGACGTTAAAAAAACTTAATGGTACGACTCAACGAATCCGTTTAGGCTAATAAACTAGGCGTATTTTTATCTTCGTTAAAAGCCAATTTTTCATTCAACCCAAGATATACAGGTATTTTTAGC

CDS

ATGAGTGTCAACTTAGCTTCCCAGTTGCGGGAAGGGACGAAAAAATCCCACTCCATGGCGGAGAACGTCGGCTTTGTCAAATGCTTCCTCAAGGGCGTTGTCGAGAAAAATTCCTACCGTAAGCTGGTTGGCAATCTCTACTTTGTCTACAGTGCCATGGAAGAGGAAATGGCAAAATTTAAGGACCATCCCATCCTCAGCCACATTTACTTCCCCGAACTCAACCGCAAACAAAGCCTAGAGCAAGACCTGCAATTCTATTACGGCTCCAACTGGCGGCAAGAAGTGAAAATTTCTGCCGCTGGCCAAGCCTATGTGGACCGAGTCCGGCAAGTGGCCGCTACGGCCCCTGAATTGTTGGTGGCCCATTCCTACACCCGTTACCTGGGGGATCTTTCCGGCGGTCAAATTCTCAAGAAAATTGCCCAAAATGCCATGAATCTCCACGATGGTGGCACAGCTTTCTATGAATTTGCCGACATTGATGACGAAAAGGCTTTTAAAAATACCTACCGTCAAGCTATGAATGATCTGCCCATTGACCAAGCCACCGCCGAACGGATTGTGGATGAAGCCAATGACGCCTTTGCCATGAACATGAAAATGTTCAACGAACTTGAAGGCAACCTGATCAAGGCGATCGGCATTATGGTGTTCAACAGCCTCACCCGTCGCCGCAGTCAAGGCAGCACCGAAGTTGGCCTCGCCACCTCCGAAGGCTAG

Protein

MSVNLASQLREGTKKSHSMAENVGFVKCFLKGVVEKNSYRKLVGNLYFVYSAMEEEMAKFKDHPILSHIYFPELNRKQSLEQDLQFYYGSNWRQEVKISAAGQAYVDRVRQVAATAPELLVAHSYTRYLGDLSGGQILKKIAQNAMNLHDGGTAFYEFADIDDEKAFKNTYRQAMNDLPIDQATAERIVDEANDAFAMNMKMFNELEGNLIKAIGIMVFNSLTRRRSQGSTEVGLATSEG