Your browser is old and dusty. Try Google Chrome!

Details for sll1173

ORF sll1173
Accession NP_441600.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -365 -379 16.0275 0.0319
NP_441061.1_2 Forward -398 -384 6.78443 0.114
NP_441061.1_2 Forward -223 -209 -0.295402 0.227
NP_441061.1_2 Forward -229 -215 -1.08205 0.249
NP_440557.1_1 Forward -398 -379 2.65439 0.229
NP_440795.1_7 Forward -398 -391 14.6904 0.0123
NP_440795.1_7 Reverse -391 -398 14.6904 0.0123
NP_441418.1_6 Forward -399 -380 -10.227 0.0328
NP_441453.1_4 Reverse -390 -398 16.539 0.00633
NP_441453.1_4 Forward -399 -391 16.539 0.00633
NP_442151.1_6 Forward -283 -269 10.1277 0.13
NP_442151.1_6 Forward -399 -385 7.57108 0.194
NP_442151.1_6 Reverse -228 -242 6.09611 0.248
NP_442151.1_10 Reverse -112 -130 13.4905 0.289
NP_442182.1_3 Reverse -365 -384 1.86774 0.264
NP_441818.1_9 Forward -363 -344 -8.55534 0.277
NP_441818.1_9 Forward -362 -343 -9.93197 0.291
NP_440226.1_1 Forward -399 -380 12.7825 0.0412
NP_440150.1_2 Forward -241 -222 4.62021 0.281
NP_442173.1_1 Forward -398 -390 15.4574 0.00633
NP_442173.1_1 Reverse -391 -399 15.4574 0.00633
NP_442752.1_4 Forward -399 -392 13.8055 0.0199
NP_442752.1_4 Reverse -390 -397 13.8055 0.0199
NP_443027.1_4 Reverse -388 -398 14.828 0.0437
NP_441812.1_3 Forward -400 -386 16.2242 0.0755
NP_442975.1_10 Reverse -386 -400 5.21053 0.228
NP_441225.1_2 Reverse -279 -298 2.3594 0.217
NP_440784.1_7 Forward -398 -391 15.9687 0.0123
NP_440784.1_7 Reverse -391 -398 15.9687 0.0123
NP_442909.1_7 Forward -282 -268 5.80051 0.269
NP_440061.1_9 Reverse -111 -125 10.3237 0.126
NP_440110.1_8 Reverse -374 -393 2.45773 0.211
NP_440878.1_9 Forward -169 -150 7.07928 0.174
NP_442062.1_8 Forward -399 -389 19.4496 0.000558
NP_442062.1_8 Reverse -390 -400 17.3846 0.00193
NP_442062.1_8 Reverse -267 -277 8.63316 0.0733
NP_440304.1_4 Reverse -388 -398 10.8948 0.051
NP_442242.1_4 Forward -398 -391 14.3954 0.0124
NP_442242.1_4 Reverse -391 -398 14.3954 0.0124
NP_441581.1_6 Reverse -242 -261 13.3647 0.283
NP_439918.1_2 Forward -298 -279 2.0644 0.207
NP_441208.1_9 Reverse -219 -233 12.3893 0.138
NP_441594.1_6 Reverse -265 -284 2.26107 0.254
NP_442110.1_7 Reverse -358 -372 9.43936 0.0738
NP_442110.1_7 Forward -399 -385 2.65453 0.222
NP_442726.1_7 Reverse -237 -255 0.609134 0.257
NP_440273.1_3 Forward -363 -344 7.66927 0.222
NP_441083.1_3 Reverse -227 -237 16.5975 0.102
NP_441083.1_5 Reverse -390 -400 20.3345 0.00053
NP_441083.1_5 Forward -399 -389 11.3864 0.0159
NP_441083.1_5 Reverse -358 -368 -0.0199663 0.251
NP_441434.1_1 Reverse -54 -68 6.98253 0.291
NP_441738.1_2 Forward -397 -390 15.28 0.0102
NP_441738.1_2 Reverse -392 -399 15.28 0.0102
NP_440209.1_1 Reverse -390 -398 18.1123 0.00295
NP_440209.1_1 Forward -399 -391 18.1123 0.00295
NP_440209.1_2 Forward -348 -332 19.7247 0.168
NP_442136.1_4 Forward -397 -378 6.88182 0.295
NP_441770.1_10 Forward -232 -213 11.9958 0.226
NP_440178.1_7 Forward -364 -345 -20.0601 0.184
NP_440178.1_7 Forward -400 -381 -21.83 0.241
NP_442570.1_3 Forward -382 -363 -6.29373 0.257
NP_440538.1_10 Forward -233 -214 10.1275 0.279
NP_442111.1_4 Forward -400 -386 10.3243 0.0545
NP_441163.1_1 Forward -284 -267 5.24966 0.277
NP_440906.1_5 Forward -398 -391 15.8704 0.0124
NP_440906.1_5 Reverse -391 -398 15.8704 0.0124
NP_440747.1_10 Reverse -387 -399 7.70879 0.00236
NP_440747.1_10 Forward -162 -150 -12.0557 0.199
NP_441486.1_1 Reverse -225 -239 -6.29359 0.288
NP_442634.1_4 Forward -365 -351 -5.90027 0.284
NP_440403.1_4 Forward -256 -237 -2.16383 0.176
NP_440403.1_4 Forward -373 -354 -8.35868 0.254
NP_441014.1_8 Reverse -377 -396 -8.16202 0.283
NP_441014.1_10 Forward -400 -381 3.04693 0.215
NP_441014.1_10 Forward -225 -206 2.75194 0.216
NP_442848.1_1 Reverse -209 -223 -3.44199 0.267
NP_441012.1_4 Reverse -211 -224 12.999 0.225
NP_443018.1_3 Forward -398 -391 14.8871 0.0123
NP_443018.1_3 Reverse -391 -398 14.8871 0.0123
NP_440376.1_1 Forward -399 -390 19.4693 0.000692
NP_440376.1_1 Reverse -390 -399 19.4693 0.000692
NP_440376.1_1 Forward -237 -228 4.12963 0.173
NP_440376.1_1 Reverse -221 -230 0.688044 0.262
NP_442687.1_7 Reverse -389 -399 15.8113 0.0125
NP_442687.1_7 Forward -258 -248 11.1898 0.0994
NP_442687.1_7 Forward -400 -390 8.92815 0.0994
NP_441077.1_6 Reverse -30 -46 8.20065 0.211
NP_442485.1_3 Reverse -379 -398 -3.24547 0.272
NP_441846.1_10 Forward -400 -381 -22.8133 0.266
NP_441013.1_2 Reverse -360 -378 -0.0791831 0.26
NP_441422.1_7 Forward -164 -147 2.39878 0.113
NP_440533.1_9 Forward -390 -371 9.73422 0.146
NP_440533.1_9 Forward -399 -380 5.01433 0.214
NP_440667.1_2 Forward -363 -344 -2.65548 0.232
NP_441950.1_7 Reverse -144 -163 -8.752 0.287
NP_442658.1_1 Reverse -388 -398 15.9091 0.00966
NP_442658.1_1 Forward -278 -268 9.22267 0.165
NP_442658.1_1 Reverse -207 -217 7.55106 0.214
NP_440141.1_3 Forward -276 -257 1.47442 0.274
NP_442782.1_2 Forward -357 -343 4.71948 0.25
NP_442782.1_2 Forward -345 -331 3.8345 0.261
NP_442782.1_2 Forward -399 -385 0.982901 0.282
NP_440656.1_8 Reverse -379 -398 -6.78538 0.249
NP_441414.1_9 Forward -399 -380 4.916 0.0504
NP_442321.1_4 Reverse -103 -122 -6.09707 0.284
NP_441958.1_5 Forward -400 -390 12.2714 0.00183
NP_441958.1_5 Reverse -389 -399 12.2714 0.00183
NP_441958.1_5 Forward -258 -248 -2.28158 0.27
NP_440984.1_7 Reverse -385 -399 11.6026 0.122
NP_442911.1_2 Reverse -380 -399 12.4875 0.0127
NP_441580.1_6 Reverse -379 -398 -8.26035 0.254
NP_440153.1_8 Reverse -354 -367 14.6706 0.16
NP_443055.1_6 Reverse -221 -239 6.99988 0.164
NP_440993.1_4 Forward -379 -362 3.28376 0.289
NP_440471.1_3 Forward -107 -93 15.1426 0.299
NP_442002.1_9 Reverse -389 -396 10.7572 0.185
NP_440411.1_10 Forward -367 -348 10.1641 0.275
NP_441646.1_1 Reverse -222 -241 -0.4922 0.266
NP_442438.1_10 Reverse -385 -399 12.3893 0.0412
NP_442438.1_10 Reverse -236 -250 -1.18038 0.296
NP_441752.1_6 Reverse -96 -115 2.65439 0.235
NP_441000.1_5 Reverse -230 -249 6.78348 0.248
NP_441000.1_6 Forward -258 -244 -4.91696 0.254
NP_440147.1_4 Forward -259 -246 4.05085 0.173
NP_441295.1_4 Forward -372 -353 -0.0988766 0.29
NP_441550.1_8 Reverse -388 -398 6.0761 0.214
NP_441916.1_7 Forward -399 -389 18.4663 0.00144
NP_441916.1_7 Reverse -390 -400 10.3048 0.0261
NP_441916.1_7 Forward -363 -353 3.22496 0.223
NP_441916.1_10 Forward -387 -368 1.27776 0.268
NP_441041.1_4 Reverse -209 -228 -0.295539 0.0941
NP_441041.1_4 Forward -399 -380 -5.99873 0.162
NP_441041.1_7 Reverse -387 -399 7.61196 0.162
NP_442396.1_5 Reverse -386 -399 6.80412 0.219
NP_442004.1_6 Reverse -325 -339 3.73617 0.232
NP_441725.1_5 Forward -398 -388 11.2881 0.0247
NP_439966.1_7 Reverse -388 -398 18.4657 0.00473
NP_439966.1_7 Reverse -356 -366 4.10949 0.289
NP_439966.1_9 Reverse -388 -397 0.983037 0.253
NP_442941.1_3 Forward -398 -388 11.4848 0.0116
NP_440289.1_2 Reverse -387 -400 11.819 0.0171
NP_440289.1_2 Reverse -110 -123 2.47756 0.096
NP_441678.1_9 Forward -298 -279 5.211 0.183
NP_441678.1_9 Forward -310 -291 -5.11376 0.297
NP_442281.1_1 Reverse -385 -399 19.1735 0.0032
NP_440437.1_1 Reverse -235 -254 -4.52377 0.261
NP_440437.1_1 Reverse -82 -101 -5.9004 0.296
NP_442012.1_5 Forward -364 -345 0.294447 0.288
NP_442049.1_6 Reverse -356 -375 5.50599 0.232
NP_442288.1_3 Forward -335 -318 5.34871 0.284
NP_441556.1_4 Reverse -381 -400 13.1865 0.201
NP_441556.1_10 Forward -282 -268 13.6286 0.178
NP_441556.1_10 Reverse -359 -373 12.7526 0.195
NP_440498.1_1 Reverse -381 -399 17.8171 0.0181
NP_442982.1_5 Reverse -380 -399 -1.7705 0.269
NP_440375.1_8 Reverse -249 -268 12.8808 0.129
NP_441644.1_6 Reverse -390 -400 17.3841 0.00127
NP_441644.1_6 Forward -399 -389 10.1076 0.0628
NP_441644.1_6 Forward -116 -106 3.91283 0.256
NP_442215.1_2 Reverse -356 -372 0.0585348 0.157
NP_442215.1_2 Reverse -239 -255 -2.00642 0.191
NP_442029.1_1 Forward -249 -230 -3.54046 0.188
NP_442029.1_1 Forward -375 -356 -19.8634 0.297
NP_442029.1_6 Reverse -262 -281 7.37428 0.224
NP_442029.1_10 Reverse -240 -259 6.58763 0.284
NP_440929.1_8 Forward -399 -390 19.2726 0.000701
NP_440929.1_8 Reverse -390 -399 19.2726 0.000701
NP_440929.1_8 Reverse -358 -367 5.89959 0.11
NP_442933.1_10 Forward -399 -390 17.601 0.00325
NP_442933.1_10 Reverse -390 -399 17.601 0.00325
NP_440382.1_2 Reverse -31 -50 2.55527 0.284
NP_441751.2_8 Forward -398 -384 -1.77037 0.13
NP_442554.1_8 Forward -398 -388 13.8447 0.0145
NP_441762.1_7 Forward -400 -388 2.89058 0.0676
NP_442142.1_4 Reverse -387 -400 17.1282 0.0264
NP_442142.1_4 Forward -393 -380 2.87033 0.273
NP_442142.1_9 Forward -397 -378 1.47442 0.285
NP_442292.1_1 Reverse -391 -400 18.486 0.00229
NP_442292.1_1 Forward -398 -389 9.63616 0.0183
NP_442292.1_5 Reverse -217 -236 3.14605 0.257
NP_442476.1_6 Forward -398 -384 5.01447 0.139
NP_443009.1_5 Forward -400 -389 18.3477 0.00265
NP_443009.1_5 Forward -123 -112 8.31797 0.112
NP_440125.1_6 Reverse -286 -305 14.3558 0.13
NP_442301.1_2 Reverse -347 -366 4.52188 0.275
NP_442301.1_2 Forward -163 -144 3.73524 0.288
NP_442408.2_1 Forward -399 -380 -3.24547 0.241
NP_441715.1_4 Forward -398 -388 16.303 0.0117
NP_441448.1_1 Forward -255 -236 8.55425 0.206
NP_441448.1_1 Reverse -236 -255 6.29264 0.251
NP_441468.1_1 Forward -398 -391 15.8704 0.0124
NP_441468.1_1 Reverse -391 -398 15.8704 0.0124
NP_441015.1_10 Forward -398 -379 -9.44032 0.282
NP_441015.1_10 Reverse -145 -164 -10.227 0.283
NP_441673.1_1 Forward -399 -390 20.8459 0.000698
NP_441673.1_1 Reverse -390 -399 20.8459 0.000698
NP_441673.1_1 Forward -367 -358 -7.76842 0.168
NP_441673.1_1 Reverse -358 -367 -8.06341 0.254
NP_441673.1_1 Forward -122 -113 -8.06341 0.254
NP_441826.1_2 Reverse -384 -398 4.12949 0.105
NP_441826.1_2 Forward -256 -242 2.06454 0.136
NP_441826.1_2 Forward -122 -108 -1.08205 0.234
NP_441826.1_2 Reverse -358 -372 -1.47537 0.248
NP_441826.1_2 Forward -373 -359 -3.54032 0.286
NP_441330.1_1 Reverse -204 -223 -8.35868 0.183
NP_441393.1_2 Forward -260 -241 11.4117 0.272
NP_441764.1_1 Reverse -38 -57 13.1758 0.127
NP_442868.1_6 Reverse -388 -398 0.963343 0.205
NP_442868.1_6 Forward -365 -355 -0.0199663 0.255
NP_441612.1_2 Reverse -50 -60 11.7441 0.21
NP_441612.1_2 Reverse -390 -400 8.54929 0.21
NP_442361.1_3 Reverse -384 -397 9.16406 0.282
NP_442808.1_1 Reverse -389 -399 18.4657 0.00201
NP_442808.1_1 Forward -400 -390 8.63269 0.0481
NP_442808.1_1 Forward -162 -152 3.02785 0.25
NP_442775.1_6 Reverse -210 -229 15.0441 0.236
NP_442542.1_9 Reverse -383 -397 11.5037 0.111
NP_442050.1_1 Forward -257 -238 7.7676 0.261
NP_442050.1_5 Reverse -388 -398 9.12434 0.193
NP_441114.1_3 Reverse -269 -278 7.37455 0.239
NP_440558.1_2 Reverse -264 -283 9.43923 0.102
NP_440558.1_2 Forward -280 -261 0.786102 0.185
NP_440558.1_2 Reverse -381 -400 -5.60541 0.262
NP_442593.1_9 Forward -350 -331 16.2706 0.257
NP_441518.1_3 Reverse -380 -399 -4.6221 0.12
NP_441878.1_6 Forward -400 -390 10.4031 0.0176
NP_441878.1_6 Reverse -389 -399 10.4031 0.0176
NP_441878.1_6 Forward -238 -228 2.43831 0.0379
NP_441878.1_6 Forward -364 -354 -7.00147 0.201
NP_441878.1_6 Reverse -227 -237 -7.59145 0.245
NP_441036.1_8 Reverse -389 -399 17.7779 0.000554
NP_441036.1_8 Forward -400 -390 8.33817 0.174
NP_441557.1_5 Forward -399 -390 19.9609 0.000699
NP_441557.1_5 Reverse -390 -399 19.9609 0.000699
NP_441445.1_1 Reverse -381 -400 2.0644 0.243
NP_441445.1_1 Forward -246 -227 1.76941 0.247
NP_441433.1_8 Reverse -18 -37 -3.54046 0.283
NP_440084.1_8 Forward -46 -32 18.0596 0.161
NP_441308.1_8 Reverse -388 -398 10.1081 0.22
NP_442183.1_1 Forward -399 -385 11.406 0.0702
NP_442397.1_9 Forward -380 -361 3.6377 0.264
NP_442135.1_3 Reverse -346 -365 14.7491 0.116
NP_441574.1_1 Forward -363 -344 0.294447 0.196
NP_441574.1_1 Reverse -255 -274 -7.57203 0.292
NP_441549.1_9 Forward -368 -350 3.26407 0.0925
NP_442347.1_2 Reverse -391 -400 12.4878 0.056
NP_442347.1_2 Forward -398 -389 11.1111 0.056
NP_442645.1_2 Reverse -66 -85 -18.7818 0.279
NP_442888.1_9 Reverse -348 -367 14.6508 0.206
NP_441037.1_4 Forward -239 -229 9.75413 0.21
NP_441037.1_4 Reverse -388 -398 7.02532 0.237
NP_442014.1_2 Reverse -122 -141 15.2408 0.192
NP_440136.1_2 Forward -398 -391 15.9687 0.0123
NP_440136.1_2 Reverse -391 -398 15.9687 0.0123
NP_442590.1_10 Forward -370 -351 6.58763 0.241
NP_442590.1_10 Reverse -358 -377 5.60432 0.258
NP_442998.1_5 Forward -346 -336 13.7464 0.157
NP_442998.1_5 Reverse -29 -39 12.7631 0.159
NP_442998.1_5 Reverse -28 -38 11.8781 0.176
NP_442998.1_10 Forward -397 -390 15.5754 0.0102
NP_442998.1_10 Reverse -392 -399 15.5754 0.0102
NP_440899.1_1 Forward -363 -344 9.67614 0.21
NP_440899.1_2 Reverse -379 -398 20.0581 0.0311
NP_440299.1_1 Reverse -240 -253 10.9334 0.0529
NP_440299.1_1 Reverse -386 -399 10.4418 0.0573
NP_440299.1_1 Forward -222 -209 4.05029 0.221
NP_441799.1_1 Reverse -386 -400 12.8803 0.0385
NP_441007.1_10 Reverse -385 -398 1.9859 0.202
NP_442333.2_1 Forward -85 -66 -10.3253 0.288
NP_441559.1_8 Forward -281 -267 1.17956 0.156
NP_441559.1_8 Reverse -320 -334 0.982901 0.159
NP_441559.1_8 Forward -165 -151 -3.93365 0.213
NP_441559.1_8 Reverse -263 -277 -5.90027 0.271
NP_441559.1_8 Reverse -330 -344 -6.98191 0.281
NP_441559.1_8 Reverse -385 -399 -7.08024 0.283
NP_440915.1_6 Forward -268 -254 0.88457 0.151
NP_440215.1_10 Forward -348 -329 12.5858 0.299
NP_441464.1_8 Reverse -228 -242 7.57108 0.206
NP_442150.1_8 Reverse -41 -60 15.4742 0.272
NP_442993.1_1 Forward -399 -383 -9.18458 0.179
NP_442993.1_1 Reverse -364 -380 -12.9212 0.282
NP_442386.1_9 Reverse -389 -398 15.7322 0.0144
NP_442386.1_9 Forward -400 -391 13.8639 0.0289
NP_442386.1_9 Forward -335 -326 8.06244 0.209
NP_442386.1_9 Forward -277 -268 7.17747 0.219
NP_442386.1_9 Forward -374 -365 6.09583 0.23
NP_440570.1_5 Reverse -205 -224 -2.16383 0.277
NP_441750.1_1 Forward -136 -117 -10.9153 0.3
NP_441750.1_4 Reverse -361 -380 3.34271 0.233
NP_441340.1_5 Forward -398 -391 15.6737 0.0124
NP_441340.1_5 Reverse -391 -398 15.6737 0.0124
NP_441340.1_9 Reverse -28 -38 8.25522 0.256
NP_442484.1_2 Reverse -379 -398 -1.96717 0.3
NP_442791.1_5 Forward -284 -265 0.491109 0.21
NP_442791.1_5 Forward -381 -362 -9.93197 0.279
NP_440327.1_6 Forward -363 -344 2.3594 0.298
NP_442240.1_2 Forward -356 -337 -19.4701 0.295
NP_440586.1_1 Forward -367 -348 -0.983855 0.237
NP_440586.1_8 Forward -398 -391 13.2151 0.026
NP_440586.1_8 Reverse -391 -398 13.2151 0.026
NP_442251.1_6 Forward -398 -391 15.2804 0.0124
NP_442251.1_6 Reverse -391 -398 15.2804 0.0124
NP_440684.1_9 Reverse -268 -282 13.6676 0.155
NP_441262.1_3 Reverse -390 -397 14.7888 0.0223
NP_441262.1_3 Forward -399 -392 14.7888 0.0223
NP_440027.1_3 Reverse -344 -362 11.8181 0.159
NP_440027.1_3 Forward -373 -355 11.0314 0.159
NP_440027.1_3 Reverse -380 -398 3.45998 0.272
NP_440027.1_3 Reverse -348 -366 1.78836 0.295
NP_440027.1_3 Reverse -345 -363 1.78836 0.295
NP_443051.1_1 Reverse -389 -398 10.4228 0.00754
NP_443051.1_1 Forward -400 -391 10.4228 0.00754
NP_439937.1_9 Reverse -333 -350 -13.1381 0.28
NP_439937.1_9 Reverse -266 -283 -13.2365 0.283
NP_442294.1_3 Forward -177 -163 12.782 0.274
NP_440408.1_1 Forward -179 -160 5.40766 0.227
NP_440408.1_3 Forward -256 -237 27.1388 0.00143
NP_440408.1_3 Reverse -235 -254 -3.24547 0.257
NP_440408.1_7 Forward -386 -367 8.25926 0.282
NP_440408.1_10 Forward -282 -263 4.916 0.28
NP_440439.1_1 Reverse -387 -400 8.37742 0.0537
NP_440372.1_2 Forward -398 -391 16.3621 0.0124
NP_440372.1_2 Reverse -391 -398 16.3621 0.0124
NP_440819.1_5 Forward -27 -19 7.8859 0.266
NP_440819.1_5 Reverse -28 -36 7.59091 0.272
NP_442488.1_7 Forward -85 -66 10.8159 0.239
NP_441803.1_2 Reverse -236 -255 -1.27885 0.297
NP_440139.1_1 Reverse -358 -377 5.60352 0.157
NP_441572.1_7 Forward -256 -237 -5.50708 0.263
NP_442384.1_10 Forward -399 -386 13.884 0.018
NP_442384.1_10 Reverse -248 -261 4.64084 0.151
NP_442384.1_10 Reverse -113 -126 1.10092 0.268
NP_442262.1_10 Forward -398 -391 14.1988 0.0123
NP_442262.1_10 Reverse -391 -398 14.1988 0.0123
NP_441689.1_5 Reverse -388 -398 8.53436 0.132
NP_440163.1_10 Reverse -387 -397 16.303 0.0762
NP_440344.1_10 Reverse -106 -123 0.825489 0.0336
NP_440344.1_10 Reverse -383 -400 0.0388413 0.0376
NP_440344.1_10 Reverse -318 -335 -1.0428 0.0491
NP_440282.1_3 Forward -229 -210 -4.52377 0.298
NP_440282.1_10 Reverse -380 -399 -5.70374 0.25
NP_441965.1_10 Reverse -322 -338 12.5466 0.105
NP_440297.1_9 Forward -398 -388 9.32148 0.0917
NP_442187.1_8 Reverse -191 -208 19.5864 0.261
NP_441896.1_5 Reverse -68 -75 12.2322 0.273
NP_440894.1_10 Forward -255 -236 4.03102 0.259
NP_440894.1_10 Forward -235 -216 4.03102 0.259
NP_442067.1_4 Reverse -379 -398 23.0089 0.0107
NP_440999.1_9 Reverse -386 -400 10.1277 0.055
NP_440999.1_9 Forward -163 -149 3.34284 0.131
NP_440999.1_9 Reverse -350 -364 -1.37704 0.236
NP_440888.1_2 Forward -399 -385 13.9619 0.022
NP_440888.1_2 Reverse -358 -372 6.98048 0.212
NP_441543.1_2 Forward -398 -389 18.486 0.00236
NP_441543.1_2 Reverse -391 -400 16.9127 0.00359
NP_442845.1_2 Reverse -319 -333 7.47274 0.195
NP_440380.1_1 Forward -256 -237 -1.57384 0.156
NP_442710.1_6 Reverse -41 -60 5.50599 0.24
NP_441469.1_8 Reverse -389 -398 16.126 0.00797
NP_441469.1_8 Forward -277 -268 12.1928 0.123
NP_441469.1_8 Forward -400 -391 6.48957 0.227
NP_443064.1_6 Reverse -390 -400 12.5669 0.0796
NP_443064.1_6 Reverse -113 -123 10.4338 0.153
NP_442578.1_7 Forward -398 -391 14.5921 0.026
NP_442578.1_7 Reverse -391 -398 14.5921 0.026
NP_441462.1_2 Forward -399 -389 11.5831 0.00406
NP_441462.1_2 Reverse -390 -400 11.5831 0.00406
NP_443062.1_1 Forward -399 -381 10.3986 0.117
NP_443062.1_1 Reverse -364 -382 3.57305 0.293
NP_443062.1_6 Forward -284 -265 8.45592 0.143
NP_440519.1_8 Reverse -147 -163 5.86006 0.21
NP_442204.1_1 Reverse -386 -397 -0.137991 0.286
NP_440516.1_8 Forward -399 -390 16.9127 0.00442
NP_440516.1_8 Reverse -390 -399 16.9127 0.00442
NP_442428.1_5 Forward -398 -391 15.8704 0.0124
NP_442428.1_5 Reverse -391 -398 15.8704 0.0124
NP_442428.1_8 Forward -272 -253 -0.787193 0.274
NP_441790.1_3 Forward -398 -379 -4.6221 0.291
NP_442120.1_10 Forward -363 -344 -8.65367 0.237
NP_442120.1_10 Forward -230 -211 -15.4385 0.294
NP_442120.1_10 Forward -276 -257 -16.3235 0.3
NP_440673.1_2 Forward -247 -228 12.6333 0.142
NP_440673.1_3 Forward -397 -390 12.4288 0.0426
NP_440673.1_3 Reverse -392 -399 12.4288 0.0426
NP_440673.1_7 Reverse -379 -398 0.58944 0.267
NP_440673.1_7 Reverse -360 -379 0.294447 0.271
NP_441714.1_2 Forward -114 -96 12.6055 0.242
NP_441052.1_2 Reverse -390 -400 19.9412 0.00106
NP_441052.1_2 Forward -399 -389 10.5014 0.0285
NP_441052.1_2 Reverse -325 -335 6.07655 0.0943
NP_441052.1_2 Forward -237 -227 4.0116 0.168
NP_441052.1_2 Forward -283 -273 -0.708283 0.294
NP_442219.1_9 Reverse -391 -400 17.7976 0.00718
NP_442219.1_9 Forward -398 -389 8.35786 0.0681
NP_440436.1_4 Forward -398 -389 18.1905 0.00233
NP_440436.1_4 Reverse -391 -400 17.2072 0.00233
NP_440436.1_4 Reverse -114 -123 7.07914 0.142
NP_441884.1_8 Forward -364 -345 -8.65367 0.262
NP_442864.1_7 Forward -263 -245 5.91901 0.274
NP_441719.1_4 Forward -398 -391 16.3621 0.0124
NP_441719.1_4 Reverse -391 -398 16.3621 0.0124
NP_441733.1_10 Reverse -149 -162 3.65753 0.293
NP_441004.1_1 Forward -262 -243 -15.7335 0.277
NP_441004.1_1 Forward -379 -360 -17.3068 0.29
NP_441004.1_1 Forward -385 -366 -18.2901 0.299
NP_441004.1_4 Forward -259 -249 17.4829 0.12
NP_441004.1_5 Forward -260 -246 10.6193 0.244
NP_442813.1_4 Reverse -213 -232 -9.047 0.299
NP_442366.1_3 Forward -219 -201 -2.24246 0.224
NP_442366.1_3 Reverse -363 -381 -4.79907 0.276
NP_442873.1_3 Reverse -380 -399 18.3865 0.0794
NP_442206.1_10 Forward -399 -384 7.15806 0.178
NP_440328.1_4 Reverse -268 -287 -0.983855 0.295
NP_443054.1_2 Forward -124 -110 9.14437 0.102
NP_443054.1_2 Forward -232 -218 8.65272 0.114
NP_441851.1_9 Reverse -154 -173 10.5209 0.234
NP_441851.1_10 Reverse -389 -399 16.008 0.00552
NP_441851.1_10 Forward -400 -390 15.8113 0.00552
NP_441851.1_10 Forward -277 -267 4.10993 0.287
NP_442208.1_5 Reverse -148 -167 -8.85033 0.282
NP_442622.1_1 Forward -400 -381 -12.3902 0.27
NP_442856.1_7 Reverse -381 -400 11.5042 0.0738
NP_441668.1_5 Reverse -28 -47 10.5209 0.225
NP_442515.1_1 Forward -400 -386 4.12949 0.108
NP_442515.1_1 Forward -26 -12 -5.01529 0.298
NP_441683.1_7 Reverse -151 -170 -6.58872 0.272
NP_441349.1_10 Forward -247 -228 -6.78538 0.236
NP_441409.1_6 Reverse -319 -338 -15.5368 0.297
NP_442843.1_1 Forward -115 -96 -4.32711 0.237
NP_439960.1_10 Forward -374 -356 -3.71743 0.279
NP_440474.1_8 Forward -398 -384 5.99717 0.235
NP_440474.1_8 Reverse -216 -230 3.93223 0.296
NP_441124.1_5 Reverse -28 -38 12.7217 0.215
NP_440431.1_4 Reverse -51 -70 -7.01908 0.262
NP_442450.1_5 Reverse -388 -398 9.32148 0.115
NP_440195.1_4 Forward -379 -360 5.11266 0.29
NP_440943.1_6 Forward -347 -328 17.0107 0.202
NP_442006.1_2 Reverse -381 -398 -16.5791 0.256
NP_441570.1_1 Forward -399 -381 1.88744 0.0281
NP_441570.1_1 Forward -379 -361 -14.6322 0.226
NP_440078.1_10 Forward -250 -231 4.12936 0.254
NP_440078.1_10 Forward -283 -264 2.55606 0.269
NP_441078.1_4 Forward -399 -390 19.6659 0.0007
NP_441078.1_4 Reverse -390 -399 19.6659 0.0007
NP_441078.1_4 Forward -237 -228 6.29291 0.079
NP_441078.1_4 Forward -159 -150 -1.18024 0.237
NP_441078.1_4 Reverse -228 -237 -1.6719 0.266
NP_441078.1_4 Reverse -113 -122 -1.77023 0.266
NP_441078.1_4 Reverse -150 -159 -1.96689 0.282
NP_442729.1_8 Reverse -386 -399 9.36073 0.125
NP_442443.1_1 Reverse -260 -279 -5.31042 0.282
NP_441432.1_8 Forward -400 -391 16.8143 0.00595
NP_441432.1_8 Reverse -389 -398 8.25953 0.0755
NP_441432.1_8 Reverse -214 -223 5.80125 0.137
NP_441432.1_8 Reverse -267 -276 2.65466 0.292
NP_441432.1_8 Reverse -220 -229 2.65466 0.292
NP_442320.1_8 Reverse -384 -398 -3.93365 0.136
NP_442320.1_8 Reverse -107 -121 -4.22864 0.151
NP_442344.1_7 Forward -398 -379 0.687771 0.0918
NP_441732.1_2 Forward -163 -147 -16.5594 0.174
NP_442003.1_4 Reverse -249 -268 9.3409 0.3
NP_442003.1_9 Forward -359 -340 6.68596 0.235
NP_440760.1_1 Forward -399 -380 -10.7186 0.0842
NP_440760.1_1 Reverse -113 -132 -23.305 0.293
NP_442797.1_7 Reverse -363 -381 4.14905 0.234
NP_442751.1_2 Reverse -257 -276 7.4718 0.206
NP_440280.1_2 Forward -240 -221 13.1758 0.155
NP_442489.1_7 Forward -399 -390 20.1576 0.000695
NP_442489.1_7 Reverse -390 -399 20.1576 0.000695
NP_442489.1_7 Forward -237 -228 -1.47524 0.203
NP_442489.1_7 Reverse -113 -122 -1.77023 0.247
NP_441706.1_10 Forward -370 -351 7.17762 0.292
NP_441452.1_1 Reverse -379 -398 12.3892 0.292
NP_442079.1_7 Forward -398 -379 14.6508 0.0773
NP_440559.1_1 Reverse -391 -400 17.4043 0.00658
NP_440559.1_1 Forward -398 -389 8.75118 0.0586
NP_441659.2_8 Reverse -390 -400 18.1713 0.00133
NP_441659.2_8 Forward -399 -389 11.9764 0.0147
NP_441659.2_8 Reverse -354 -364 2.63497 0.195
NP_441659.2_8 Reverse -358 -368 2.53664 0.198
NP_442913.1_10 Forward -246 -227 3.53937 0.104
NP_442913.1_10 Reverse -381 -400 -5.21209 0.26
NP_441040.1_2 Forward -272 -253 1.47442 0.119
NP_441040.1_2 Reverse -356 -375 -14.6519 0.286
NP_441040.1_2 Reverse -220 -239 -15.2418 0.286
NP_439956.1_7 Forward -369 -350 1.57275 0.287
NP_442346.1_5 Forward -400 -390 16.6963 0.00248
NP_442346.1_5 Forward -238 -228 9.61647 0.118
NP_442346.1_5 Reverse -389 -399 9.02648 0.118
NP_442346.1_10 Reverse -111 -130 -2.55715 0.294
NP_440545.1_3 Reverse -350 -367 0.628827 0.135
NP_440545.1_3 Forward -367 -350 -3.00942 0.197
NP_440831.1_3 Reverse -381 -400 14.5416 0.113
NP_440831.1_3 Forward -250 -231 5.12514 0.29
NP_440459.1_2 Forward -372 -355 7.80699 0.278
NP_440459.1_7 Forward -392 -378 18.1442 0.0994
NP_440010.1_4 Reverse -234 -253 2.55527 0.222
NP_440010.1_4 Reverse -377 -396 2.16195 0.227
NP_440010.1_10 Reverse -232 -251 2.94938 0.267
NP_442551.1_4 Reverse -226 -241 -1.49507 0.246
NP_442311.1_8 Reverse -205 -224 9.93088 0.278
NP_442603.1_7 Forward -399 -385 8.75042 0.166
NP_442828.1_7 Forward -125 -106 -6.1954 0.296
NP_441585.1_5 Reverse -257 -276 1.08032 0.291
NP_441358.1_2 Forward -363 -344 7.07928 0.275
NP_441833.1_4 Forward -398 -391 15.9687 0.0124
NP_441833.1_4 Reverse -391 -398 15.9687 0.0124
NP_441112.1_6 Reverse -341 -360 10.1275 0.103
NP_442162.1_9 Forward -398 -391 16.2637 0.0124
NP_442162.1_9 Reverse -391 -398 16.2637 0.0124
NP_440671.1_4 Forward -373 -359 6.78443 0.235
NP_442073.1_6 Reverse -316 -335 -0.885524 0.271
NP_442199.1_5 Reverse -259 -278 -3.04881 0.2
NP_442140.1_3 Forward -398 -388 8.33817 0.119
NP_442021.1_3 Forward -363 -344 -5.9004 0.257
NP_440875.1_9 Forward -397 -387 9.05339 0.233
NP_441813.1_3 Reverse -150 -169 13.5586 0.284
NP_441813.1_5 Reverse -388 -398 17.188 0.00979
NP_440594.1_6 Reverse -268 -287 4.42355 0.3
NP_442028.1_1 Forward -68 -55 7.70113 0.289
NP_442254.1_1 Forward -44 -25 1.67108 0.249
NP_440590.1_4 Forward -282 -269 0.0192843 0.173
NP_440590.1_4 Forward -379 -366 -1.35735 0.218
NP_440590.1_4 Forward -398 -385 -4.89726 0.269
NP_440567.1_1 Forward -398 -384 14.0609 0.0191
NP_442497.1_10 Forward -398 -389 10.4228 0.0087
NP_442497.1_10 Reverse -391 -400 10.4228 0.0087
NP_440821.1_4 Reverse -388 -398 19.0562 0.00399
NP_441239.1_9 Reverse -388 -400 13.3137 0.037
NP_441239.1_9 Reverse -246 -258 5.34885 0.223
NP_441239.1_9 Reverse -265 -277 4.75886 0.243
NP_441951.1_4 Reverse -249 -268 10.1275 0.228
NP_440156.1_4 Reverse -335 -345 14.8275 0.176
NP_440400.1_1 Reverse -345 -364 -0.886293 0.285
NP_441769.1_3 Reverse -91 -110 0.785326 0.22
NP_441874.1_1 Forward -133 -119 11.7993 0.24
NP_441541.1_7 Reverse -49 -67 16.0218 0.162
NP_440354.1_7 Reverse -358 -376 12.5072 0.224
NP_440354.1_7 Reverse -261 -279 7.59063 0.26
NP_440546.1_4 Forward -399 -389 11.8882 0.0679
NP_440546.1_4 Reverse -390 -400 10.046 0.109
NP_440546.1_6 Forward -263 -244 10.6192 0.245
NP_441230.1_5 Reverse -359 -378 7.7676 0.163
NP_440462.1_6 Reverse -388 -398 15.418 0.0142
NP_442340.1_3 Reverse -76 -95 -10.9153 0.295
NP_442611.1_1 Forward -399 -380 5.40766 0.179
NP_440868.1_4 Reverse -386 -398 17.7386 0.0124
NP_441474.1_1 Reverse -380 -399 10.1267 0.211
NP_442402.1_1 Forward -44 -25 7.66927 0.289
NP_442402.1_4 Reverse -329 -348 1.86696 0.173
NP_442402.1_4 Reverse -317 -336 -6.19614 0.253
NP_442402.1_4 Forward -44 -25 -8.16275 0.278
NP_442402.1_4 Reverse -232 -251 -10.326 0.299
NP_442402.1_10 Reverse -116 -126 10.9926 0.272
NP_440696.1_3 Forward -363 -345 -1.16082 0.251
NP_440696.1_3 Reverse -354 -372 -1.25915 0.253
NP_442358.1_1 Reverse -382 -400 18.8004 0.0915
NP_442039.1_4 Forward -398 -391 15.1821 0.0124
NP_442039.1_4 Reverse -391 -398 15.1821 0.0124
NP_442039.1_4 Reverse -114 -121 8.69224 0.172
NP_442696.1_2 Forward -400 -382 15.8504 0.111
NP_442837.1_3 Forward -398 -391 15.7721 0.0124
NP_442837.1_3 Reverse -391 -398 15.7721 0.0124
NP_440160.1_2 Reverse -283 -302 11.1109 0.123
NP_440160.1_2 Forward -298 -279 -6.1954 0.28
NP_442053.1_1 Forward -399 -390 18.3876 0.0007
NP_442053.1_1 Reverse -390 -399 18.3876 0.0007
NP_442053.1_1 Forward -122 -113 4.22796 0.261
NP_440505.1_3 Reverse -388 -398 13.8447 0.0247
NP_441102.1_1 Forward -398 -379 10.2259 0.154
NP_441584.1_4 Forward -26 -7 14.0608 0.29
NP_440914.1_1 Reverse -390 -400 17.5935 0.000537
NP_440914.1_1 Reverse -325 -335 9.10306 0.186
NP_440914.1_1 Forward -399 -389 8.6151 0.186
NP_441011.1_8 Forward -398 -389 16.9127 0.00602
NP_441011.1_8 Reverse -391 -400 8.25953 0.144
NP_442533.1_6 Forward -399 -390 17.2076 0.00137
NP_442533.1_6 Reverse -390 -399 17.2076 0.00137
NP_442533.1_6 Reverse -228 -237 5.70292 0.132
NP_442533.1_6 Forward -276 -267 4.91628 0.165
NP_442533.1_6 Forward -367 -358 2.16301 0.27
NP_442533.1_6 Forward -363 -354 2.16301 0.27
NP_442533.1_6 Forward -297 -288 2.16301 0.27
NP_442322.1_4 Reverse -280 -297 -8.90993 0.286
NP_441482.1_7 Forward -128 -114 -4.91696 0.162
NP_441482.1_7 Reverse -384 -398 -9.24352 0.196
NP_439944.1_9 Forward -398 -388 10.3048 0.0887
NP_441697.1_5 Reverse -31 -50 -7.49654 0.246
NP_441028.1_6 Forward -168 -158 13.2542 0.159
NP_441028.1_6 Forward -35 -25 5.48612 0.255
NP_440116.1_8 Forward -398 -379 -8.752 0.26
NP_440007.1_9 Reverse -211 -225 2.35953 0.281
NP_440007.1_9 Reverse -286 -300 2.16287 0.281
NP_440007.1_9 Reverse -386 -400 0.491246 0.297
NP_441170.1_4 Reverse -258 -276 2.37909 0.285
NP_441106.1_1 Reverse -389 -398 18.191 0.0028
NP_441106.1_1 Forward -400 -391 9.63616 0.0311
NP_441815.1_6 Forward -170 -151 -0.00131823 0.291
NP_440480.1_10 Reverse -334 -348 18.1901 0.224
NP_442306.1_10 Forward -281 -262 -4.13045 0.11
NP_441286.1_1 Forward -400 -388 14.4936 0.00418
NP_440670.1_8 Forward -399 -390 18.3876 0.000699
NP_440670.1_8 Reverse -390 -399 18.3876 0.000699
NP_440886.1_7 Reverse -389 -399 17.7774 0.0011
NP_440886.1_7 Forward -400 -390 7.94438 0.0805
NP_440886.1_7 Forward -160 -150 6.46942 0.123
NP_440886.1_7 Reverse -357 -367 5.97777 0.151
NP_440886.1_7 Reverse -273 -283 3.8145 0.265
NP_442614.1_2 Forward -399 -385 10.3243 0.234
NP_442614.1_2 Reverse -161 -175 7.86607 0.262
NP_441399.1_6 Forward -303 -284 15.6332 0.185
NP_440513.1_4 Forward -373 -354 14.6508 0.19
NP_440907.2_8 Forward -398 -388 7.84605 0.117
NP_441463.1_3 Reverse -257 -276 -2.85214 0.162
NP_441626.1_2 Forward -398 -391 15.7721 0.0124
NP_441626.1_2 Reverse -391 -398 15.7721 0.0124
NP_442211.1_3 Forward -379 -360 9.70905 0.257
NP_442209.1_4 Reverse -175 -194 8.16093 0.299
NP_442615.1_1 Reverse -219 -237 -0.275845 0.114
NP_441796.1_8 Forward -263 -245 8.37728 0.297
NP_440387.1_1 Forward -399 -383 3.79511 0.0519
NP_441431.1_2 Reverse -245 -259 5.80051 0.288
NP_441836.1_2 Forward -259 -240 12.9791 0.0686
NP_441993.1_1 Forward -373 -354 7.89159 0.159
NP_441993.1_1 Reverse -215 -234 3.60346 0.231
NP_441993.1_1 Forward -399 -380 3.11618 0.241
NP_440114.1_10 Reverse -364 -378 10.0294 0.155
NP_440114.1_10 Forward -399 -385 6.3911 0.273
NP_441425.1_4 Reverse -27 -41 14.8476 0.282
NP_441206.1_4 Forward -281 -262 -5.80207 0.263
NP_441510.2_7 Reverse -384 -398 10.2254 0.281
NP_440293.1_3 Reverse -213 -232 -7.08038 0.299
NP_440766.1_2 Reverse -22 -38 15.1024 0.295
NP_440766.1_4 Forward -371 -357 1.47456 0.23
NP_440766.1_5 Forward -347 -335 8.03776 0.286
NP_440766.1_5 Reverse -26 -38 7.94227 0.288
NP_440766.1_5 Reverse -48 -60 6.89186 0.291
NP_441979.1_5 Reverse -235 -254 -10.817 0.228
NP_442867.1_8 Forward -359 -340 6.4893 0.26
NP_442867.1_8 Reverse -356 -375 3.83436 0.297
NP_440457.1_1 Forward -367 -355 6.23383 0.125
NP_440457.1_1 Reverse -386 -398 1.21895 0.244
NP_440798.1_6 Forward -398 -385 3.85419 0.147
NP_440798.1_6 Reverse -249 -262 3.26421 0.151
NP_441984.1_3 Reverse -354 -372 21.357 0.0547
NP_441984.1_3 Reverse -284 -302 8.57394 0.224
NP_441332.1_6 Reverse -356 -366 11.0659 0.277
NP_441436.1_8 Forward -364 -345 9.73422 0.262
NP_441436.1_8 Forward -368 -349 9.53756 0.263
NP_442509.1_5 Reverse -343 -360 14.4927 0.231
NP_442509.1_9 Forward -399 -389 16.2041 0.00739
NP_442509.1_9 Reverse -390 -400 8.14104 0.192
NP_442784.1_9 Forward -246 -227 11.9958 0.296
NP_441159.1_7 Forward -335 -316 -9.34199 0.264
NP_440554.1_4 Forward -398 -388 14.6313 0.02
NP_441885.1_2 Forward -125 -106 11.5042 0.281
NP_441885.1_5 Reverse -390 -400 20.9245 0.000538
NP_441885.1_5 Forward -399 -389 11.4848 0.00668
NP_441885.1_5 Forward -237 -227 0.373358 0.164
NP_441885.1_5 Forward -159 -149 0.373358 0.164
NP_442341.1_7 Forward -400 -386 14.0609 0.0326
NP_442341.1_7 Forward -123 -109 4.91614 0.175
NP_442341.1_9 Forward -285 -271 4.71887 0.294
NP_441173.1_9 Reverse -201 -209 12.9004 0.206
NP_441173.1_9 Reverse -339 -347 12.0154 0.214
NP_443000.1_7 Reverse -388 -398 8.73149 0.0437
NP_441842.1_10 Forward -329 -315 6.98109 0.27
NP_441842.1_10 Reverse -383 -397 6.78443 0.272
NP_440275.1_3 Reverse -388 -398 8.4365 0.0602
NP_440091.1_1 Reverse -386 -398 1.41561 0.197
NP_441397.1_8 Reverse -26 -39 17.0593 0.142
NP_440679.1_10 Forward -397 -378 5.30933 0.0812
NP_441359.1_5 Reverse -361 -380 1.0811 0.29
NP_441635.1_1 Forward -73 -54 5.1084 0.27
NP_441207.1_7 Reverse -53 -67 16.0323 0.179
NP_439962.1_4 Reverse -356 -375 2.94938 0.196
NP_439962.1_4 Forward -362 -343 -6.58872 0.283
NP_439962.1_4 Reverse -259 -278 -8.85033 0.298
NP_440149.1_8 Forward -399 -380 11.0125 0.0445
NP_440149.1_8 Forward -276 -257 -5.21209 0.221
NP_441875.1_10 Forward -164 -150 12.1926 0.242
NP_441105.1_3 Reverse -102 -121 2.94938 0.0949
NP_441105.1_3 Reverse -223 -242 -9.14533 0.284
NP_440216.1_1 Forward -399 -385 7.57108 0.00935
NP_440216.1_1 Reverse -150 -164 -11.6035 0.203
NP_440216.1_1 Forward -367 -353 -12.1934 0.247
NP_440216.1_1 Reverse -228 -242 -12.4884 0.274
NP_440216.1_9 Forward -30 -21 5.89959 0.289
NP_440216.1_9 Forward -114 -105 5.80125 0.289
NP_440216.1_9 Reverse -25 -34 5.40793 0.294
NP_440172.1_1 Reverse -390 -400 15.0247 0.00945
NP_440172.1_1 Forward -399 -389 8.73149 0.0586
NP_440172.1_1 Reverse -274 -284 3.22496 0.238
NP_440249.1_2 Reverse -98 -108 15.0242 0.268
NP_442290.1_9 Reverse -355 -374 16.0274 0.198
NP_442015.1_10 Reverse -386 -399 9.36073 0.0503
NP_442015.1_10 Reverse -237 -250 6.70579 0.108
NP_442015.1_10 Forward -384 -371 0.314277 0.231
NP_442015.1_10 Forward -30 -17 -1.06236 0.293
NP_441226.1_7 Forward -398 -391 14.4934 0.0123
NP_441226.1_7 Reverse -391 -398 14.4934 0.0123
NP_441226.1_7 Forward -256 -249 9.47853 0.147
NP_442834.1_10 Forward -328 -309 12.3892 0.203
NP_442222.1_1 Reverse -260 -277 19.0159 0.236
NP_441757.1_3 Forward -400 -381 2.65439 0.155
NP_441111.1_7 Forward -398 -390 18.7023 0.00294
NP_441111.1_7 Reverse -391 -399 18.7023 0.00294
NP_441766.1_2 Forward -399 -390 17.5026 0.00297
NP_441766.1_2 Reverse -390 -399 17.5026 0.00297
NP_441766.1_9 Reverse -356 -375 -0.39387 0.261
NP_441766.1_9 Forward -372 -353 -0.787193 0.261
NP_442417.1_5 Forward -399 -385 9.73436 0.127
NP_440416.1_9 Reverse -106 -125 -14.6519 0.179
NP_440416.1_9 Forward -225 -206 -16.5201 0.216
NP_440416.1_9 Forward -374 -355 -19.2734 0.272
NP_443052.1_9 Forward -163 -144 -3.3438 0.249
NP_442116.1_6 Reverse -91 -108 7.78699 0.254
NP_442154.1_1 Forward -384 -366 -17.3854 0.254
NP_440261.1_5 Forward -398 -385 8.37742 0.0263
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TGGCGATCGCCGTGAGGGCGTGGTAACGCCAATGGCGGGCGGCGGCTTCCGTTTGGGGTAAATCTTGGGCATCCCGTTGGAAATAGGGTAGTTTATAACCTTGGGCTAGGCCTTGTACGTGGTCGGCAATGCCTGCATCGGTGGGCCAACGGTGGTCACAGTGGGCTACGGCCAAATGCCACTGCCATTGTTTGGTTAAATCATTAAGTAGATGCAGTAAACAGAGGGAGTCTTGTCCCCCGGATACCGCCACTAAAATTCGAGTTCCTTGCAACTCGGGGAAGCGCCGTTGCAAATTTTGATGGAGCTTACTGTGCAGTAATGTCCAAGCCATTTATATTATTTTTGTCCACTAAATTTTCAATTTTTCCCACGGGAAACATCAAGATTTAATAATCCC

CDS

ATGGCCCAGGCTCTGTTGAATAACGCTTTTATCCGCCGTTGCAGTGACAATTTTTTTAACTTTGTTGGCAACTTGCTCACCCCTAGTTGGGATGGCAGACTTCTGGGAATTAGGCAATTAAATATTCAAACCATTATTGATATTGGCGCTAATAAGGGACAATTTGCCAAAAAAATGCGCCGCTATTTTCCCCAAGCTCAAATTTTTGCCTTTGAACCCTTGCCCCTACCCTATCAACAACTCCAACAATGGGGCGATCGCCAACAAAACCGTGTTCGTACTTTTAACTTGGCCCTTGGCGATCGGGTGGATGAGTTGGAAATTAATAGCCATGTGCTTTTTACCGCTTCTTCATCCCTCTTACCAACGACGAAACTTTGCGAAAGCTTATATCCCATGGTGCGGGAACAGGAAAAAATTATCGTTCACCAGTCAACCCTTGACCGGGAAATGGAACAATTTGTAGGAAAGCTACTGCCGGAATTACTGGTAAAAATCGACGTACAGGGTTACGAAGACCGGGTGATTCGAGGCGGAGAAAAAATACTAAGGCAAGCTAAGGCCTGTATTTTGGAAATTTCCTTAGATGGACTGTATAAGGGGCAATGCCAATTCCGGGATATTTTTCCCCTATTGGACAATCTCGGACTGCGCTATGCTGGCAATCTGGATCAAGTGGTCGCCGCCGATGGCCATGTGCGCTATCTCAATGCTCTCTTCTTGCGTCCCGATTAA

Protein

MAQALLNNAFIRRCSDNFFNFVGNLLTPSWDGRLLGIRQLNIQTIIDIGANKGQFAKKMRRYFPQAQIFAFEPLPLPYQQLQQWGDRQQNRVRTFNLALGDRVDELEINSHVLFTASSSLLPTTKLCESLYPMVREQEKIIVHQSTLDREMEQFVGKLLPELLVKIDVQGYEDRVIRGGEKILRQAKACILEISLDGLYKGQCQFRDIFPLLDNLGLRYAGNLDQVVAADGHVRYLNALFLRPD