Your browser is old and dusty. Try Google Chrome!

Details for sll1156

ORF sll1156
Accession NP_441154.1
Symbol
Category Transposon-related functions
Definition putative transposase [ISY120b: 1385747 - 1386548]
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441418.1_6 Reverse -349 -368 -19.4701 0.0888
NP_441418.1_6 Forward -367 -348 -30.5815 0.286
NP_441453.1_1 Forward -365 -347 9.45814 0.163
NP_441453.1_4 Forward -297 -289 4.24765 0.259
NP_442877.1_6 Forward -305 -286 22.3206 0.0942
NP_440561.1_9 Reverse -75 -88 17.7189 0.258
NP_441818.1_1 Forward -296 -285 11.1696 0.199
NP_440226.1_1 Forward -358 -339 3.73603 0.215
NP_440996.1_2 Forward -103 -94 14.8477 0.248
NP_442744.1_8 Forward -235 -216 -6.88371 0.297
NP_442752.1_4 Forward -196 -189 7.6106 0.151
NP_441812.1_3 Reverse -147 -161 17.9942 0.0479
NP_441812.1_3 Forward -368 -354 10.3243 0.222
NP_440784.1_7 Forward -296 -289 10.2655 0.0801
NP_442062.1_8 Forward -367 -357 3.02829 0.289
NP_440839.1_4 Forward -323 -304 15.1416 0.186
NP_441859.1_5 Forward -180 -161 6.4893 0.295
NP_440304.1_4 Reverse -347 -357 8.23984 0.0845
NP_440304.1_4 Reverse -286 -296 4.50326 0.261
NP_441925.1_4 Forward -299 -280 -15.8325 0.274
NP_440856.1_7 Forward -319 -300 -6.09707 0.235
NP_441558.1_5 Reverse -259 -278 4.03102 0.293
NP_441645.1_6 Forward -287 -273 14.9452 0.193
NP_440209.1_2 Reverse -200 -216 12.4482 0.189
NP_441713.1_1 Forward -364 -345 -13.3736 0.255
NP_440178.1_7 Reverse -147 -166 -22.6167 0.268
NP_441716.1_1 Reverse -219 -233 8.55439 0.138
NP_441163.1_1 Forward -125 -108 4.75801 0.285
NP_440012.1_6 Reverse -214 -233 9.93088 0.247
NP_440747.1_10 Reverse -222 -234 -12.5474 0.297
NP_442634.1_4 Reverse -241 -255 -4.62196 0.211
NP_440403.1_10 Reverse -252 -271 0.58944 0.3
NP_440057.1_8 Forward -171 -152 13.2741 0.266
NP_441014.1_10 Forward -142 -123 0.588665 0.241
NP_441014.1_10 Forward -368 -349 -2.06626 0.27
NP_442848.1_1 Reverse -343 -357 -3.73699 0.27
NP_442848.1_9 Forward -306 -287 7.07928 0.182
NP_441012.1_4 Forward -226 -213 15.3589 0.178
NP_441012.1_4 Forward -256 -243 12.9006 0.234
NP_443018.1_3 Reverse -289 -296 4.26735 0.267
NP_443018.1_3 Forward -296 -289 4.16902 0.278
NP_442687.1_7 Reverse -242 -252 4.69992 0.238
NP_442485.1_3 Forward -369 -350 -1.27885 0.256
NP_442485.1_3 Reverse -214 -233 -3.14714 0.272
NP_440642.1_10 Reverse -98 -112 6.19383 0.237
NP_441013.1_3 Reverse -282 -301 18.6823 0.201
NP_440042.1_2 Reverse -247 -266 -0.688862 0.231
NP_441682.1_2 Reverse -289 -308 2.94938 0.241
NP_441950.1_8 Reverse -293 -307 5.21113 0.281
NP_441763.1_10 Reverse -256 -275 11.2084 0.143
NP_442658.1_1 Reverse -286 -296 9.81266 0.145
NP_440493.1_2 Forward -27 -8 32.4487 0.00000125
NP_441855.2_4 Forward -299 -280 9.81228 0.275
NP_441855.2_4 Forward -260 -241 9.04103 0.291
NP_440656.1_8 Reverse -338 -357 -0.0988766 0.144
NP_442300.1_1 Reverse -331 -350 5.89931 0.269
NP_441256.1_1 Forward -361 -342 -8.06369 0.241
NP_442937.1_5 Forward -263 -244 16.4207 0.0429
NP_442937.1_5 Reverse -250 -269 5.89931 0.295
NP_442321.1_9 Forward -270 -251 11.5042 0.278
NP_440203.1_5 Forward -355 -345 8.43603 0.299
NP_439990.1_5 Reverse -220 -233 5.62415 0.283
NP_441338.2_5 Forward -172 -153 3.14605 0.299
NP_442690.1_1 Forward -76 -57 -14.7502 0.273
NP_440153.1_5 Forward -357 -343 8.45605 0.144
NP_442064.1_1 Forward -363 -344 -4.72043 0.208
NP_442064.1_4 Forward -274 -255 9.7334 0.204
NP_442064.1_4 Reverse -245 -264 7.27514 0.242
NP_443055.1_6 Reverse -208 -226 -0.0799167 0.252
NP_440377.1_1 Forward -74 -57 19.1976 0.0753
NP_440377.1_1 Reverse -55 -72 13.3996 0.241
NP_441000.1_6 Reverse -287 -301 -5.01529 0.257
NP_440206.1_9 Forward -285 -266 7.37428 0.292
NP_441041.1_4 Reverse -349 -368 -12.9802 0.278
NP_440569.1_10 Reverse -56 -75 6.92274 0.231
NP_441725.1_5 Forward -296 -286 7.74818 0.0843
NP_441725.1_5 Forward -357 -347 -0.216628 0.241
NP_440202.1_8 Reverse -350 -369 10.4872 0.297
NP_442941.1_3 Forward -357 -347 0.57002 0.199
NP_441514.1_6 Reverse -130 -137 14.2971 0.248
NP_441079.1_7 Forward -74 -55 -2.75457 0.222
NP_441079.1_7 Reverse -55 -74 -7.57277 0.295
NP_440498.1_1 Forward -166 -148 2.96908 0.169
NP_442215.1_2 Forward -237 -221 -5.54633 0.251
NP_442933.1_10 Reverse -288 -297 3.7363 0.284
NP_441751.2_8 Forward -233 -219 -5.40861 0.206
NP_442926.1_3 Reverse -250 -269 2.55606 0.295
NP_442142.1_4 Forward -361 -348 7.00021 0.151
NP_441525.1_1 Reverse -294 -307 15.4572 0.21
NP_442476.1_1 Forward -85 -66 14.2756 0.225
NP_440895.1_10 Forward -226 -209 3.77542 0.149
NP_442999.1_3 Reverse -142 -156 16.1556 0.298
NP_442301.1_2 Forward -298 -279 3.53858 0.293
NP_442338.1_3 Reverse -157 -176 18.3812 0.201
NP_441715.1_4 Reverse -285 -295 4.79825 0.248
NP_441198.1_8 Reverse -347 -357 11.0251 0.228
NP_440379.1_5 Reverse -349 -368 -6.78538 0.238
NP_440379.1_6 Forward -210 -191 8.84924 0.208
NP_441468.1_1 Reverse -289 -296 10.2655 0.0906
NP_441015.1_8 Reverse -352 -371 8.55425 0.258
NP_441015.1_8 Forward -117 -98 4.52268 0.258
NP_441015.1_10 Reverse -250 -269 -8.06369 0.272
NP_441826.1_2 Reverse -219 -233 1.76955 0.142
NP_441764.1_8 Forward -165 -155 13.5119 0.284
NP_442868.1_6 Reverse -214 -224 4.60159 0.171
NP_442719.1_2 Reverse -12 -30 -9.12632 0.259
NP_442719.1_3 Forward -399 -386 19.3898 0.292
NP_442719.1_3 Reverse -66 -79 16.1449 0.292
NP_441612.1_2 Forward -105 -95 11.5505 0.21
NP_442808.1_1 Forward -226 -216 5.58445 0.146
NP_441101.1_10 Reverse -221 -240 -5.9004 0.285
NP_440558.1_2 Reverse -294 -313 -4.72043 0.248
NP_440558.1_2 Reverse -216 -235 -5.70374 0.264
NP_442789.1_4 Reverse -250 -269 0.392778 0.192
NP_440093.1_9 Forward -240 -221 22.3206 0.103
NP_441878.1_6 Reverse -287 -297 0.865012 0.132
NP_441878.1_6 Reverse -357 -367 -7.88644 0.278
NP_441036.1_8 Forward -226 -216 11.5831 0.114
NP_441445.1_1 Forward -367 -348 0.196116 0.281
NP_441590.1_4 Forward -221 -202 2.75194 0.293
NP_440084.1_8 Forward -399 -385 14.1444 0.218
NP_441739.1_2 Reverse -55 -71 11.2676 0.152
NP_440979.1_3 Forward -357 -339 10.9339 0.235
NP_442444.1_6 Reverse -211 -229 14.3715 0.215
NP_442347.1_2 Forward -156 -147 10.3245 0.058
NP_442645.1_2 Forward -225 -206 -18.9784 0.282
NP_441037.1_4 Reverse -214 -224 13.555 0.06
NP_442764.1_8 Forward -269 -250 20.8456 0.0772
NP_440136.1_3 Reverse -130 -143 20.5705 0.26
NP_442590.1_10 Reverse -291 -310 6.29264 0.246
NP_440899.1_8 Forward -274 -255 -9.73531 0.268
NP_441799.1_1 Reverse -345 -359 11.602 0.0558
NP_441799.1_1 Forward -371 -357 10.6187 0.0702
NP_442334.1_2 Reverse -215 -232 2.59545 0.2
NP_440256.1_1 Forward -361 -342 -5.01543 0.171
NP_440087.1_1 Reverse -216 -235 -4.13045 0.246
NP_442007.1_3 Reverse -140 -159 9.34008 0.296
NP_441559.1_8 Forward -362 -348 -4.91696 0.241
NP_441559.1_8 Forward -229 -215 -7.47356 0.294
NP_442069.1_4 Forward -308 -289 3.34271 0.269
NP_440243.1_4 Reverse -9 -28 17.4274 0.278
NP_440695.1_5 Reverse -349 -368 -1.27885 0.284
NP_441199.1_6 Forward -229 -210 6.19431 0.138
NP_441494.1_6 Reverse -238 -251 8.08242 0.242
NP_439985.1_7 Reverse -282 -301 11.2092 0.18
NP_442993.1_1 Reverse -148 -164 -1.41643 0.0906
NP_442386.1_9 Forward -298 -289 6.09583 0.23
NP_441340.1_5 Forward -296 -289 4.07068 0.239
NP_441340.1_9 Forward -165 -155 7.00193 0.297
NP_441947.1_10 Forward -360 -342 0.609134 0.276
NP_442484.1_2 Forward -269 -250 15.1424 0.0393
NP_442484.1_2 Forward -281 -262 1.0811 0.238
NP_442484.1_2 Reverse -244 -263 -1.18052 0.287
NP_440168.1_8 Forward -270 -251 12.5858 0.158
NP_442240.1_2 Forward -251 -232 -19.7651 0.295
NP_440586.1_9 Reverse -238 -257 6.4893 0.285
NP_440192.1_5 Reverse -276 -295 13.6675 0.116
NP_442959.1_7 Forward -185 -166 0.196116 0.235
NP_440684.1_9 Forward -373 -359 6.88276 0.288
NP_440027.1_3 Forward -307 -289 14.9646 0.101
NP_440027.1_3 Reverse -348 -366 1.98502 0.295
NP_443051.1_1 Reverse -348 -357 0.0980582 0.226
NP_439937.1_8 Reverse -250 -269 2.55606 0.216
NP_441657.1_5 Forward -227 -208 7.66927 0.133
NP_440408.1_7 Forward -117 -98 7.17762 0.291
NP_439943.1_2 Reverse -261 -280 9.43923 0.276
NP_440171.1_3 Reverse -201 -220 1.47442 0.294
NP_441138.1_5 Reverse -71 -84 10.2794 0.233
NP_441181.1_2 Forward -217 -198 2.85105 0.256
NP_440819.1_5 Reverse -266 -274 17.424 0.185
NP_439977.1_5 Forward -303 -284 -1.7705 0.26
NP_439977.1_5 Reverse -249 -268 -2.45882 0.282
NP_440139.1_1 Forward -223 -204 6.09517 0.145
NP_441572.1_7 Forward -364 -345 -6.09707 0.281
NP_442384.1_10 Reverse -358 -371 10.639 0.0428
NP_442384.1_10 Forward -174 -161 1.39592 0.26
NP_441018.1_7 Forward -274 -255 6.58763 0.285
NP_441018.1_7 Forward -371 -352 6.19431 0.297
NP_441689.1_5 Reverse -347 -357 5.48612 0.251
NP_440189.1_10 Forward -245 -226 2.45773 0.293
NP_440297.1_9 Forward -296 -286 10.3048 0.0917
NP_440350.1_5 Reverse -94 -113 -6.09707 0.296
NP_442280.1_10 Forward -268 -250 15.5841 0.109
NP_442280.1_10 Forward -352 -334 6.81803 0.268
NP_440999.1_2 Reverse -256 -275 21.3373 0.0434
NP_440999.1_2 Reverse -298 -317 12.4875 0.191
NP_440999.1_9 Forward -362 -348 -0.983719 0.223
NP_440888.1_2 Forward -358 -344 8.55376 0.156
NP_440888.1_2 Reverse -102 -116 5.30886 0.284
NP_440600.1_5 Reverse -157 -176 18.6815 0.162
NP_441759.1_2 Reverse -341 -360 0.687771 0.22
NP_442845.1_2 Reverse -255 -269 8.45605 0.195
NP_442845.1_8 Reverse -346 -365 12.4875 0.291
NP_441551.1_5 Forward -301 -285 11.4642 0.173
NP_440148.1_8 Forward -21 -11 16.7946 0.28
NP_440668.1_3 Reverse -225 -244 3.44104 0.267
NP_440519.1_3 Forward -275 -256 7.66927 0.285
NP_440519.1_6 Reverse -97 -111 16.6175 0.29
NP_442204.1_1 Reverse -257 -268 1.14031 0.28
NP_442204.1_1 Reverse -221 -232 -0.137991 0.286
NP_440255.1_3 Reverse -67 -77 16.6368 0.298
NP_440255.1_7 Forward -38 -21 6.62702 0.299
NP_440516.1_8 Reverse -349 -358 -0.491928 0.262
NP_442428.1_5 Reverse -289 -296 4.66067 0.244
NP_442428.1_5 Forward -357 -350 3.67736 0.298
NP_442859.1_2 Reverse -209 -228 7.7676 0.199
NP_442120.1_10 Reverse -166 -185 -14.2585 0.288
NP_440673.1_3 Forward -268 -261 10.4622 0.139
NP_440673.1_3 Forward -356 -349 7.51227 0.252
NP_440865.1_9 Forward -258 -239 -8.55534 0.264
NP_441052.1_2 Reverse -358 -368 5.09324 0.132
NP_441052.1_2 Forward -264 -254 4.60159 0.154
NP_442219.1_8 Reverse -245 -264 10.0031 0.218
NP_440592.1_8 Reverse -130 -149 14.0608 0.248
NP_440436.1_4 Reverse -289 -298 4.7192 0.244
NP_442412.1_1 Forward -236 -217 15.8823 0.279
NP_442412.1_3 Forward -311 -292 11.7992 0.248
NP_442813.1_4 Forward -272 -253 4.32602 0.197
NP_442206.1_7 Forward -308 -289 9.0459 0.295
NP_441966.1_7 Forward -262 -243 7.76679 0.192
NP_441851.1_10 Reverse -287 -297 6.07655 0.187
NP_442856.1_7 Reverse -216 -235 -4.42544 0.26
NP_440593.1_3 Forward -269 -250 -2.16383 0.223
NP_441982.1_6 Reverse -60 -69 11.8169 0.288
NP_440432.1_9 Forward -224 -209 -4.64166 0.216
NP_442843.1_1 Reverse -262 -281 -0.4922 0.186
NP_442843.1_1 Forward -233 -214 -9.047 0.264
NP_439960.1_10 Reverse -248 -266 4.34571 0.161
NP_440726.1_2 Forward -167 -148 -0.000545616 0.288
NP_441124.1_5 Forward -67 -57 12.0532 0.239
NP_440588.1_2 Reverse -292 -311 0.982764 0.141
NP_440588.1_2 Forward -261 -242 -5.01543 0.236
NP_442006.1_2 Reverse -255 -272 -15.4975 0.227
NP_441003.1_9 Forward -273 -254 9.53756 0.213
NP_441570.1_1 Forward -358 -340 -8.92897 0.124
NP_441570.1_1 Forward -157 -139 -10.9939 0.184
NP_441570.1_1 Forward -37 -19 -17.6804 0.287
NP_441078.1_4 Reverse -358 -367 -1.86856 0.272
NP_441528.1_2 Reverse -246 -265 9.04509 0.269
NP_441432.1_8 Reverse -348 -357 14.7494 0.0218
NP_441432.1_8 Forward -368 -359 3.14632 0.259
NP_441732.1_2 Forward -346 -330 -16.7561 0.195
NP_440629.1_6 Reverse -343 -362 13.6765 0.22
NP_440760.1_7 Reverse -92 -111 5.89851 0.211
NP_442797.1_6 Reverse -150 -169 9.97026 0.243
NP_443011.1_6 Reverse -281 -300 18.584 0.209
NP_442489.1_7 Reverse -358 -367 -1.37691 0.195
NP_442489.1_7 Forward -157 -148 -1.96689 0.28
NP_442489.1_7 Forward -358 -349 -2.06522 0.288
NP_442079.1_6 Forward -260 -241 16.3224 0.268
NP_441659.2_8 Forward -297 -287 2.33998 0.205
NP_439956.1_7 Reverse -277 -296 0.982764 0.292
NP_442346.1_10 Reverse -286 -305 2.26107 0.203
NP_440545.1_3 Forward -301 -284 -5.27103 0.245
NP_440545.1_3 Forward -262 -245 -5.27103 0.245
NP_440545.1_3 Reverse -284 -301 -6.84433 0.289
NP_440250.1_1 Forward -262 -244 10.2456 0.273
NP_440847.1_3 Reverse -153 -167 10.5204 0.291
NP_440671.1_4 Reverse -255 -269 14.2576 0.0654
NP_440671.1_4 Reverse -298 -312 6.48943 0.245
NP_442943.1_1 Reverse -57 -72 19.0882 0.0725
NP_442073.1_6 Forward -273 -254 -3.54046 0.291
NP_442140.1_3 Reverse -289 -299 6.66654 0.159
NP_440875.1_9 Forward -172 -162 11.7788 0.152
NP_440821.1_4 Reverse -286 -296 -0.0199663 0.217
NP_442707.1_4 Forward -224 -206 23.5203 0.0323
NP_441239.1_9 Reverse -286 -298 8.6921 0.125
NP_441239.1_9 Forward -299 -287 5.05386 0.231
NP_441239.1_9 Reverse -247 -259 3.48056 0.285
NP_441727.1_3 Forward -277 -258 2.75272 0.299
NP_440624.1_5 Reverse -57 -75 7.37817 0.298
NP_442044.1_1 Reverse -182 -201 -5.21209 0.187
NP_442193.1_8 Forward -361 -342 11.7983 0.256
NP_440740.1_6 Forward -119 -100 18.7807 0.204
NP_442270.1_9 Forward -185 -166 -0.39387 0.142
NP_442270.1_9 Forward -311 -292 -4.81876 0.203
NP_441526.1_3 Reverse -296 -315 22.5164 0.0572
NP_441617.1_9 Reverse -63 -81 13.6872 0.287
NP_442809.1_6 Reverse -255 -274 4.12936 0.256
NP_442284.1_5 Reverse -386 -400 16.2235 0.294
NP_441154.1_1 Forward -64 -50 24.5823 0.00176
NP_440705.1_4 Reverse -265 -284 6.4893 0.296
NP_440868.1_4 Forward -362 -350 -0.649339 0.28
NP_442402.1_4 Forward -272 -253 -5.80282 0.248
NP_441848.1_4 Reverse -57 -73 7.35968 0.29
NP_441848.1_4 Forward -108 -92 7.07321 0.297
NP_441848.1_7 Forward -280 -261 -4.03287 0.287
NP_441084.1_6 Forward -113 -99 9.63499 0.273
NP_442039.1_7 Reverse -290 -300 7.15819 0.279
NP_442039.1_7 Forward -304 -294 6.96153 0.286
NP_441811.1_8 Forward -180 -166 5.99778 0.289
NP_442532.1_4 Reverse -55 -73 14.3641 0.203
NP_441153.1_4 Forward -49 -30 35.6936 0.00000331
NP_441153.1_6 Forward -95 -77 24.2086 0.00194
NP_441011.1_8 Reverse -289 -298 5.11294 0.283
NP_442533.1_1 Reverse -346 -365 -17.0118 0.279
NP_442533.1_6 Forward -367 -358 5.60459 0.137
NP_442533.1_6 Reverse -187 -196 2.26134 0.266
NP_443016.1_1 Forward -298 -279 -3.83545 0.225
NP_443016.1_1 Forward -307 -288 -6.88371 0.265
NP_441697.1_1 Forward -226 -208 18.6037 0.0649
NP_441028.1_6 Reverse -157 -167 8.14104 0.217
NP_441527.1_4 Forward -116 -97 7.20922 0.0947
NP_441527.1_4 Forward -114 -95 -7.78302 0.237
NP_440115.1_6 Reverse -213 -223 5.78156 0.221
NP_440007.1_9 Reverse -257 -271 1.17956 0.29
NP_442728.1_4 Reverse -288 -305 22.1633 0.119
NP_439965.1_7 Forward -356 -337 9.93029 0.294
NP_441059.1_10 Forward -113 -100 10.4424 0.281
NP_440608.1_3 Forward -233 -214 20.944 0.0238
NP_441602.1_3 Forward -357 -338 -4.13045 0.261
NP_441972.1_5 Reverse -250 -269 -6.88371 0.238
NP_441972.1_5 Forward -263 -244 -9.34199 0.283
NP_441106.1_1 Forward -298 -289 4.71961 0.21
NP_440429.1_2 Reverse -289 -308 12.8808 0.194
NP_440429.1_2 Reverse -250 -269 8.65258 0.272
NP_439903.1_6 Forward -361 -342 3.14526 0.213
NP_441186.1_5 Forward -99 -80 14.9441 0.287
NP_442674.1_3 Reverse -296 -315 4.42355 0.291
NP_440886.1_7 Reverse -348 -358 3.61784 0.272
NP_442459.1_7 Reverse -65 -84 8.94757 0.197
NP_441463.1_3 Reverse -60 -79 -9.93197 0.287
NP_441431.1_2 Forward -296 -282 7.57046 0.238
NP_440293.1_3 Forward -266 -247 -3.14714 0.244
NP_439988.1_3 Forward -269 -255 5.70279 0.278
NP_440422.1_10 Reverse -67 -86 9.62978 0.203
NP_441237.1_9 Reverse -166 -176 9.81313 0.265
NP_442246.1_1 Forward -316 -297 21.0414 0.0658
NP_440457.1_1 Reverse -284 -296 6.52882 0.119
NP_440142.1_7 Reverse -334 -353 6.88262 0.259
NP_440473.1_1 Reverse -222 -241 13.6676 0.187
NP_442509.1_6 Forward -43 -24 6.58763 0.294
NP_440554.1_4 Forward -269 -259 2.83163 0.251
NP_442862.1_3 Forward -95 -78 6.62702 0.263
NP_442703.1_6 Forward -76 -57 18.1908 0.175
NP_442703.1_9 Forward -87 -69 15.5554 0.129
NP_442341.1_7 Forward -368 -354 3.34284 0.227
NP_442341.1_7 Reverse -186 -200 3.14618 0.234
NP_442341.1_9 Reverse -163 -177 4.62054 0.296
NP_441173.1_9 Forward -10 -2 11.0321 0.228
NP_443000.1_7 Reverse -347 -357 4.89658 0.158
NP_443000.1_7 Reverse -146 -156 1.94665 0.226
NP_441561.1_4 Forward -250 -231 6.58763 0.254
NP_442122.1_9 Forward -266 -247 17.6007 0.207
NP_440091.1_1 Forward -301 -289 2.59558 0.191
NP_442354.1_7 Reverse -355 -374 5.211 0.26
NP_440679.1_10 Reverse -351 -370 -15.9302 0.25
NP_440679.1_10 Forward -232 -213 -16.1268 0.251
NP_441207.1_7 Reverse -367 -381 9.2554 0.282
NP_440175.1_7 Forward -274 -256 8.77756 0.288
NP_440680.1_8 Forward -176 -157 21.828 0.0294
NP_440149.1_8 Forward -358 -339 -3.24547 0.185
NP_440216.1_1 Reverse -284 -298 -12.2918 0.256
NP_440216.1_9 Forward -168 -159 8.65285 0.286
NP_440216.1_9 Forward -167 -158 7.27622 0.286
NP_440172.1_1 Reverse -349 -359 3.61828 0.222
NP_442015.1_10 Reverse -354 -367 1.69091 0.204
NP_442015.1_10 Reverse -161 -174 -1.06236 0.293
NP_441226.1_7 Forward -269 -262 8.59356 0.197
NP_440416.1_9 Forward -308 -289 -18.5851 0.26
NP_440416.1_9 Forward -265 -246 -18.9784 0.267
NP_440416.1_9 Forward -259 -240 -21.3384 0.294
NP_440845.1_1 Forward -22 -3 -3.24547 0.205
NP_442154.1_1 Reverse -280 -298 -15.2222 0.218
NP_442154.1_1 Reverse -241 -259 -17.8771 0.272
NP_440261.1_5 Forward -251 -238 -2.93064 0.0983
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GAAAATTTCAGTGCTGCATCTTATTTATATTTTGGCCTTCACCGTGATTGCCTTCCTTGCTGTTAGCAACCTAATTCGGAGCTTAATTTCCGTCAGCATGGGCAGCCAGCGCACTCCACCCAACAGTTTTTCCCGTCGCTTTGGCCAGAGCAGTCACCCGGAGTTGTTCGATGACCAGGGTCGCCCCATCAGTGAGCCCTTATTGGTGATGCGCTCCGTCAATGTTGACGATGCCAGGGAAAAGTTGAACGCCATTTTTGATGCTTCCCCTAGTGTGACTTTCCAAGAAGGCGAAGAGGAAAAATAATCCTGTCAAGAATCAGCAATAAAATTTTCGAGAATTTCAAATAGATAATGACGTAGGATGATAGGGAATATTGGGTAATGAGCTTTTGCAAAG

CDS

ATGTCTACACACTGTCACTGTCCTCAATGTGGTCATGGGAATGTCGTCAAAAATGGCTTTGTCAAGGGGAAGCAACGATTCAAATGTAAGAGGTGCCAATATAAATTTACCAATCTCTCCAAGGAACGGGGTAAACTTCTCTGGATGAAACTAGAAGCGGTCTTATTGTACATGGGTGGTATGTCAATGAATGCCACAGCAAAACTCTTGGGAGTTTCCACTCAGTCACTGCTCAACTGGATTAGGGATTTTGGCGAAGCAAACTACGAGAAACCGGCTCCAGACTCAGCGATCGTAGTGGAATTAGACGAACTGTGGCATTTTCTTCAGGCCAAAAAAACAAGTTATGGCTCTGGAAGGCATATGACCGTGTTACTGGGAGACTCATCGACTGGGAACTGGGAAATCGTGATAGTCAAACCCTGA

Protein

MSTHCHCPQCGHGNVVKNGFVKGKQRFKCKRCQYKFTNLSKERGKLLWMKLEAVLLYMGGMSMNATAKLLGVSTQSLLNWIRDFGEANYEKPAPDSAIVVELDELWHFLQAKKTSYGSGRHMTVLLGDSSTGNWEIVIVKP