Your browser is old and dusty. Try Google Chrome!

Details for sll1154

ORF sll1154
Accession NP_441156.1
Symbol
Category Drug and analog sensitivity
Definition putative antibiotic efflux protein
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440557.1_1 Reverse -203 -222 -0.4922 0.27
NP_442538.1_6 Reverse -223 -242 13.4708 0.269
NP_442272.1_1 Reverse -275 -293 18.8139 0.0652
NP_442169.1_1 Reverse -15 -34 -3.44213 0.295
NP_441816.1_6 Reverse -165 -177 17.4436 0.218
NP_442173.1_3 Forward -98 -88 16.008 0.251
NP_001035873.1_8 Forward -203 -184 7.7676 0.224
NP_442752.1_4 Reverse -97 -104 10.8555 0.0846
NP_442752.1_4 Reverse -165 -172 9.47889 0.109
NP_441812.1_1 Forward -156 -142 12.5853 0.247
NP_441675.1_4 Forward -268 -249 8.06259 0.232
NP_440061.1_9 Forward -117 -103 10.0287 0.131
NP_442062.1_3 Reverse -356 -375 -1.7705 0.264
NP_441859.1_3 Reverse -128 -147 1.37531 0.287
NP_440735.1_10 Forward -116 -102 18.9775 0.151
NP_441802.1_1 Reverse -12 -31 6.09597 0.269
NP_440304.1_4 Reverse -32 -42 11.8781 0.051
NP_441210.1_3 Reverse -82 -101 18.7807 0.134
NP_441208.1_9 Forward -39 -25 9.43936 0.213
NP_441082.1_10 Forward -202 -189 16.1456 0.168
NP_441925.1_4 Forward -114 -95 -16.8158 0.285
NP_441083.1_5 Forward -106 -96 4.69992 0.134
NP_441558.1_5 Reverse -25 -44 6.88262 0.2
NP_441444.1_1 Forward -253 -234 2.45773 0.295
NP_441713.1_8 Forward -98 -80 7.29564 0.294
NP_441486.1_1 Forward -361 -347 -3.34366 0.178
NP_441486.1_1 Reverse -346 -360 -5.70361 0.254
NP_442330.1_4 Reverse -13 -32 13.0919 0.286
NP_442634.1_2 Reverse -163 -182 -0.787193 0.297
NP_440403.1_10 Reverse -97 -116 10.7175 0.186
NP_440842.1_10 Reverse -24 -38 1.17956 0.294
NP_441014.1_8 Forward -113 -94 -7.4737 0.28
NP_441014.1_10 Forward -359 -340 -0.886293 0.254
NP_443018.1_3 Reverse -130 -137 4.26735 0.267
NP_443018.1_3 Forward -137 -130 4.07068 0.299
NP_440376.1_1 Forward -189 -180 3.44131 0.203
NP_442687.1_7 Reverse -33 -43 5.78156 0.188
NP_441077.1_2 Forward -228 -209 4.63094 0.225
NP_441077.1_2 Forward -291 -272 2.24364 0.273
NP_441077.1_6 Forward -223 -207 7.04377 0.233
NP_441846.1_10 Reverse -96 -115 -1.7705 0.115
NP_441846.1_10 Reverse -94 -113 -13.0786 0.197
NP_441846.1_10 Reverse -98 -117 -21.3384 0.256
NP_440642.1_8 Forward -172 -153 15.5589 0.153
NP_440642.1_10 Forward -32 -18 3.63724 0.269
NP_440642.1_10 Forward -38 -24 2.94893 0.277
NP_440360.1_5 Forward -147 -128 0.786102 0.297
NP_442658.1_9 Reverse -375 -394 11.6025 0.286
NP_442496.1_5 Reverse -20 -38 10.7372 0.217
NP_442496.1_5 Forward -293 -275 9.65558 0.217
NP_442496.1_5 Reverse -19 -37 4.05072 0.299
NP_441487.1_6 Forward -135 -116 0.392778 0.259
NP_441317.1_4 Forward -348 -334 15.5754 0.161
NP_442025.1_7 Forward -43 -25 15.0979 0.275
NP_442690.1_1 Forward -372 -353 -5.99873 0.164
NP_442690.1_1 Reverse -274 -293 -16.9135 0.294
NP_443044.1_1 Forward -154 -135 7.07928 0.258
NP_441654.1_6 Forward -257 -239 16.7131 0.176
NP_442598.1_1 Forward -298 -284 16.7159 0.3
NP_442438.1_10 Reverse -124 -138 0.88457 0.213
NP_441916.1_10 Reverse -103 -122 7.17762 0.195
NP_440345.1_3 Forward -391 -377 10.7067 0.273
NP_442642.1_9 Reverse -20 -37 0.432165 0.271
NP_440174.1_2 Reverse -366 -385 10.9142 0.276
NP_442996.1_7 Forward -56 -37 13.0901 0.278
NP_441725.1_5 Forward -42 -32 0.471689 0.173
NP_439966.1_3 Reverse -171 -190 13.4708 0.293
NP_439966.1_7 Forward -108 -98 4.20782 0.285
NP_441079.1_7 Reverse -236 -255 -2.26292 0.217
NP_441079.1_7 Forward -382 -363 -5.60616 0.267
NP_441644.1_6 Forward -36 -26 3.71617 0.267
NP_440929.1_8 Forward -115 -106 0.786375 0.299
NP_442671.1_2 Forward -304 -285 22.4312 0.000887
NP_440382.1_2 Forward -223 -204 5.89851 0.264
NP_440382.1_2 Reverse -359 -378 3.83357 0.274
NP_440096.1_5 Forward -188 -169 6.68596 0.275
NP_441762.1_7 Reverse -96 -108 -5.95921 0.258
NP_440421.1_1 Reverse -374 -388 14.7492 0.233
NP_440379.1_6 Reverse -97 -116 6.19431 0.266
NP_441468.1_1 Reverse -130 -137 3.97235 0.277
NP_441020.2_9 Reverse -101 -120 15.1424 0.289
NP_441015.1_10 Reverse -100 -119 -11.0136 0.29
NP_441637.1_9 Forward -245 -227 1.59244 0.292
NP_441764.1_8 Forward -67 -57 12.0764 0.284
NP_442719.1_2 Forward -36 -18 -11.5846 0.292
NP_441612.1_2 Reverse -226 -236 6.61303 0.283
NP_442227.1_2 Forward -113 -94 6.78429 0.198
NP_441911.1_10 Forward -286 -267 10.5835 0.226
NP_441849.1_2 Forward -264 -245 10.265 0.161
NP_442903.1_2 Forward -62 -43 2.91208 0.263
NP_442747.1_1 Reverse -94 -113 -17.0118 0.247
NP_441048.1_6 Forward -221 -207 14.1444 0.296
NP_442593.1_9 Reverse -333 -352 14.6186 0.278
NP_441878.1_4 Reverse -19 -38 5.40766 0.271
NP_441557.1_8 Forward -173 -163 12.4676 0.236
NP_441445.1_1 Reverse -171 -190 0.884433 0.266
NP_441590.1_4 Forward -114 -95 6.48849 0.256
NP_441574.1_2 Reverse -252 -271 15.1416 0.226
NP_441037.1_4 Reverse -127 -137 11.3134 0.156
NP_440899.1_8 Reverse -52 -71 -10.7186 0.284
NP_440299.1_1 Forward -362 -349 5.82024 0.162
NP_440299.1_9 Forward -132 -114 17.1162 0.269
NP_442504.1_4 Reverse -237 -256 5.75208 0.114
NP_442334.1_2 Reverse -171 -188 -6.84433 0.267
NP_442333.2_7 Reverse -294 -313 10.4225 0.0603
NP_440256.1_1 Forward -214 -195 -8.752 0.266
NP_441866.1_4 Forward -347 -334 18.9834 0.0821
NP_441866.1_4 Reverse -299 -312 15.0929 0.273
NP_442452.1_3 Reverse -86 -105 0.786102 0.282
NP_442866.1_1 Forward -111 -92 -9.73531 0.298
NP_441464.1_10 Forward -247 -233 8.65272 0.275
NP_442386.1_9 Reverse -110 -119 5.40752 0.253
NP_442386.1_9 Forward -139 -130 4.7192 0.289
NP_442791.1_5 Reverse -93 -112 -10.7186 0.281
NP_439976.1_1 Forward -389 -377 17.0496 0.272
NP_440586.1_8 Reverse -130 -137 7.70858 0.227
NP_440586.1_9 Forward -136 -117 7.47261 0.273
NP_441262.1_3 Reverse -129 -136 5.34899 0.181
NP_440027.1_3 Forward -114 -96 12.4081 0.159
NP_439937.1_9 Forward -29 -12 -12.7448 0.276
NP_441789.1_7 Forward -115 -96 -1.47628 0.251
NP_440316.1_10 Reverse -104 -114 7.45319 0.251
NP_441572.1_7 Reverse -100 -119 -4.6221 0.24
NP_440267.1_2 Forward -381 -367 12.192 0.125
NP_442114.1_8 Reverse -236 -250 8.84875 0.234
NP_440163.1_10 Reverse -346 -356 8.4365 0.274
NP_440344.1_10 Reverse -221 -238 -11.3676 0.212
NP_440894.1_10 Forward -111 -92 3.24438 0.276
NP_441778.1_8 Forward -48 -34 16.9119 0.273
NP_440888.1_2 Forward -36 -22 9.14375 0.137
NP_440888.1_2 Forward -28 -14 5.1122 0.293
NP_442892.1_9 Reverse -54 -68 14.7486 0.293
NP_440600.1_1 Reverse -329 -348 14.4666 0.207
NP_439969.1_1 Forward -116 -97 1.0811 0.204
NP_442277.1_7 Reverse -331 -347 -0.279674 0.221
NP_441543.1_3 Forward -107 -93 5.99717 0.287
NP_442845.1_2 Reverse -105 -119 5.60446 0.228
NP_441551.1_5 Forward -110 -94 5.85938 0.293
NP_442710.1_7 Reverse -363 -382 -1.64837 0.221
NP_442710.1_7 Forward -223 -204 -2.80169 0.252
NP_442710.1_7 Forward -380 -361 -7.99162 0.299
NP_441469.1_8 Reverse -128 -137 5.50626 0.265
NP_443064.1_6 Forward -106 -96 11.1125 0.13
NP_442204.1_1 Reverse -93 -104 5.27021 0.213
NP_442780.1_1 Forward -56 -37 11.1109 0.17
NP_440454.1_2 Reverse -231 -245 10.6112 0.291
NP_440454.1_8 Reverse -237 -253 18.839 0.215
NP_440516.1_8 Reverse -97 -106 -0.295266 0.232
NP_441785.1_1 Forward -358 -344 13.0292 0.231
NP_441033.1_2 Forward -148 -129 -4.22878 0.293
NP_442428.1_5 Reverse -130 -137 4.36568 0.271
NP_442120.1_10 Reverse -28 -47 -15.4385 0.294
NP_442219.1_8 Forward -148 -129 8.55364 0.245
NP_440436.1_4 Forward -173 -164 5.40752 0.204
NP_441086.1_3 Forward -268 -249 5.27153 0.29
NP_442366.1_3 Reverse -128 -146 -5.88071 0.298
NP_439949.1_7 Reverse -381 -395 16.1259 0.176
NP_442873.1_3 Forward -116 -97 7.96345 0.204
NP_442873.1_5 Forward -112 -93 7.66846 0.276
NP_441851.1_10 Reverse -110 -120 8.4365 0.116
NP_442208.1_5 Reverse -97 -116 -5.60541 0.266
NP_441157.1_1 Reverse -357 -371 25.4666 0.00625
NP_441982.1_6 Forward -387 -378 10.289 0.297
NP_442024.1_9 Forward -356 -343 19.0955 0.123
NP_440431.1_3 Forward -268 -249 -10.4236 0.275
NP_442450.1_3 Forward -63 -45 13.293 0.205
NP_442450.1_5 Reverse -95 -105 6.07655 0.204
NP_442006.1_3 Reverse -91 -109 -4.11075 0.29
NP_442006.1_3 Reverse -100 -118 -7.25734 0.298
NP_441570.1_1 Reverse -367 -385 -1.84914 0.0598
NP_442729.1_5 Reverse -128 -138 8.33817 0.248
NP_440707.1_9 Reverse -11 -30 3.04771 0.268
NP_442443.1_1 Reverse -11 -30 -5.80207 0.285
NP_441432.1_8 Reverse -201 -210 5.21127 0.185
NP_441432.1_8 Reverse -26 -35 2.85133 0.281
NP_441432.1_9 Reverse -55 -68 8.21054 0.292
NP_441030.1_4 Forward -62 -43 8.92807 0.274
NP_442797.1_7 Reverse -103 -121 -0.865831 0.288
NP_440199.1_10 Reverse -346 -356 13.4514 0.108
NP_442727.1_1 Forward -248 -234 13.5693 0.245
NP_442400.1_10 Forward -391 -378 7.79662 0.282
NP_441800.1_7 Forward -183 -165 -1.25915 0.242
NP_440025.1_3 Forward -31 -17 16.2259 0.149
NP_440459.1_2 Reverse -120 -137 12.1336 0.158
NP_442551.1_3 Reverse -357 -376 17.7133 0.229
NP_440847.1_3 Forward -145 -131 13.7653 0.209
NP_440847.1_3 Forward -26 -12 11.307 0.269
NP_441358.1_3 Forward -303 -285 15.4563 0.225
NP_441329.1_6 Reverse -328 -347 -1.67153 0.293
NP_440671.1_4 Reverse -91 -105 5.30946 0.286
NP_440671.1_5 Reverse -180 -194 13.4703 0.293
NP_442140.1_3 Reverse -130 -140 11.5831 0.0743
NP_442140.1_3 Forward -137 -127 3.91327 0.271
NP_442723.1_1 Forward -181 -162 3.04693 0.28
NP_442723.1_1 Forward -124 -105 1.47364 0.298
NP_441692.1_2 Forward -299 -280 9.14423 0.0714
NP_441813.1_7 Reverse -188 -202 8.3571 0.285
NP_442028.1_1 Forward -255 -242 9.89744 0.251
NP_441239.1_9 Forward -108 -96 7.31547 0.165
NP_440604.1_6 Reverse -153 -172 -3.44213 0.225
NP_440219.1_1 Forward -350 -331 15.4197 0.158
NP_441541.1_1 Reverse -209 -227 -2.95826 0.264
NP_442216.1_4 Reverse -321 -329 8.08217 0.255
NP_441582.1_5 Forward -140 -121 7.57013 0.172
NP_440905.1_1 Forward -31 -13 2.37909 0.259
NP_442402.1_1 Forward -31 -12 8.55425 0.278
NP_442402.1_4 Forward -31 -12 -8.85106 0.284
NP_441848.1_6 Forward -114 -95 12.0933 0.296
NP_441848.1_7 Forward -29 -10 -1.67294 0.254
NP_441084.1_6 Reverse -25 -39 10.4106 0.241
NP_442358.1_6 Reverse -22 -40 16.9321 0.129
NP_440505.1_3 Reverse -200 -210 4.40493 0.292
NP_440351.1_8 Forward -379 -361 5.62401 0.266
NP_442844.1_5 Reverse -279 -298 2.35861 0.26
NP_442532.1_1 Forward -303 -289 8.8503 0.292
NP_440914.1_1 Reverse -27 -37 7.15123 0.249
NP_440914.1_1 Reverse -111 -121 6.27291 0.288
NP_441011.1_8 Forward -234 -225 8.84951 0.144
NP_441011.1_8 Forward -186 -177 5.60459 0.247
NP_442533.1_1 Reverse -94 -113 5.211 0.0798
NP_442533.1_1 Reverse -96 -115 -5.9004 0.155
NP_442322.1_4 Forward -117 -100 -8.02495 0.286
NP_440854.1_7 Forward -253 -239 20.0635 0.0551
NP_441482.1_7 Reverse -91 -105 -11.4068 0.262
NP_441028.1_6 Forward -22 -12 3.71617 0.281
NP_441527.1_4 Forward -296 -277 -8.64244 0.248
NP_441527.1_4 Forward -68 -49 -11.6982 0.284
NP_441527.1_4 Reverse -332 -351 -11.8892 0.284
NP_442492.1_2 Reverse -129 -148 6.58763 0.173
NP_441930.1_3 Reverse -236 -255 4.9832 0.266
NP_440886.1_7 Forward -107 -97 6.37109 0.13
NP_442614.1_2 Reverse -105 -119 6.6861 0.287
NP_440799.1_10 Forward -295 -276 12.4875 0.267
NP_441753.1_10 Reverse -120 -139 2.85105 0.226
NP_440326.1_6 Forward -247 -233 18.6428 0.209
NP_441463.1_2 Forward -350 -332 -0.302112 0.29
NP_441463.1_3 Forward -148 -129 -9.63698 0.282
NP_441626.1_5 Forward -30 -11 8.16093 0.254
NP_441993.1_1 Forward -42 -23 5.06532 0.208
NP_441993.1_1 Forward -204 -185 0.777198 0.292
NP_440143.1_9 Reverse -44 -63 -3.44288 0.271
NP_440935.1_6 Reverse -209 -226 6.16362 0.276
NP_440737.1_1 Reverse -28 -47 4.81767 0.278
NP_441853.1_5 Reverse -15 -34 0.786102 0.279
NP_441156.1_2 Forward -298 -282 19.2962 0.175
NP_441156.1_3 Forward -361 -343 25.5852 0.00524
NP_441510.2_5 Forward -113 -94 17.7965 0.16
NP_440766.1_4 Reverse -93 -107 3.14618 0.155
NP_440457.1_1 Reverse -93 -105 1.31728 0.241
NP_440457.1_1 Reverse -102 -114 -0.0593532 0.25
NP_440798.1_6 Forward -137 -124 5.13249 0.14
NP_441436.1_2 Forward -204 -185 -4.91709 0.294
NP_441436.1_2 Reverse -11 -30 -5.40875 0.294
NP_442509.1_9 Reverse -180 -190 6.56775 0.263
NP_441885.1_5 Reverse -349 -359 -0.904945 0.241
NP_442128.1_6 Reverse -18 -32 17.7975 0.259
NP_442341.1_7 Forward -238 -224 1.76955 0.281
NP_441173.1_9 Forward -388 -380 10.2454 0.261
NP_442395.2_4 Forward -107 -88 11.3067 0.0907
NP_442395.2_4 Reverse -188 -207 5.01354 0.171
NP_440552.1_8 Reverse -43 -60 11.6067 0.247
NP_441902.1_3 Reverse -13 -23 11.8156 0.288
NP_442495.1_4 Reverse -7 -17 11.9764 0.251
NP_440216.1_9 Forward -229 -220 11.4061 0.267
NP_440216.1_9 Forward -74 -65 6.29291 0.289
NP_440172.1_1 Reverse -202 -212 4.40493 0.189
NP_440172.1_1 Reverse -34 -44 4.0116 0.208
NP_440117.1_1 Reverse -322 -341 -10.4236 0.279
NP_439971.2_8 Reverse -165 -179 13.0776 0.285
NP_441766.1_4 Reverse -113 -132 12.5858 0.0769
NP_440416.1_9 Forward -121 -102 -19.1751 0.27
NP_442116.1_6 Forward -390 -373 7.11854 0.265
NP_442154.1_1 Forward -205 -187 -18.5654 0.282
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTCAATGCATAATTTCCCAAAAAAGTCGATTAACTTTTGGTTAACCATAGCCGTTTTTTGACTTATTTTAAGGGGAGTTAATCAGTTGATTAAGTCGAAATTAAGATAGAATTAAGAAAAGATTAAGCCGGCAAGTAATTGGTCGAAATATTCTTGTTTTTTTGTGGTTATCCCTTGAAAAAAACTGAAAGTTATTGCCTGTTGAGAGTGGGGGGTTAACCCTGTCAACCCTCCCCAGATTGATCTACAAAATGTTCAATTTCACCATCGCAGACCGATTTGGCTTCCCCACGCCCCGCTCACCCTGGTAAGGAATTTTGGGTCTATCATGGAAAAGCAAACTGTAAAGAAACCTTAAGCAGTTGCCCTTTGCCTCATTTCCTCCCCAGCAGATTATTCC

CDS

GTGAGTTCTTTCCAGACCCTCCGTCAACTATCTCCCTCCACCCAGAAAACTTTTGCTCTGTTGTTTGCTTCAGTGCTGATGTTTTGGCTCAGCCTCACTGCCCTTCTTCCCACTCTGCCCATGTATGCCCAGGATGTGGGAGCAACGAAACAACAAGTGGGTTGGATTATGGGGAGTTTCGCCCTTGGCCTGTTGGGGTCCAGAATTTGGATTGGTCAGTTGGTTGATCGCCGGGGGAGAAAAATTGCCATTGTCATTGGTGCATTGGTTGTGGCTCTGGCCCCCTTGGGATACCTACTCACCGCCACTGTGGGAGCTTTAATGGCCATTCGAGCTTTTCACGGCATTTGCTTGGCTGCCTATACCACCGGCTATAACTCCCTAGTGGTGGATTTATCCCCACCCCAACAACGGGGGGAAATTATTGGCTATATGAGTTTAGCGGTGCCTATTGGTATGGGATTTGGGCCGGCTGTGGGGGCTTACATTTCCCAAAGCATTGGCTACGAATTCCTATTCATTGCCTCTTCCCTGTTGGGCTTTATTTCCCTGGTTTTGGCCCTACAGGTGCGGGAAAACCGTCCCCCAGATCAATCGTCAGCAGAGGATGTTTTCGGCGATCGCCCCCGACCCCGTTCCATCGGCAAACTCCTCACCAGTCGCTCCATGGCCGTACCCACCTTGGTGTTACTGCTGATTGGGCTTTTGTTCGGTAACTTGGCCACTTTTTTGCCCCTGTTTGTGCGGGAAATTGACCTAGCTACCTATGCGGGAGTTTTTTACAGTGTGGCGGCGATCGCCAGTTTTGTGCCCCGCCTCTTCCTTGGTTCCTTGGCGGATACCTATGGTCGGGGGCTATTCATTGTCGGTAGCCTGATTTGCTATTTGCTGTCTATGGTGTGCCTTGCCCAAGCGGATAACTCTTGGGAATTATTGACCGCAGCCGCCCTCGAAGGAGCAGGTAGTGGCATTTTATTACCCACCACCATCGCCCTAATTTCCGATCGTTCCTCCCTGGAGGAAAGGGGAAGGGTTTTCTCCGTGTGCATGAGCGGTTTTGATGGAGGCATTGCCATTGCCGCTCCCATTATGGGCGTACTGAACGAGATATTTGGTTACCGCCATGTATTTTGGCTCAGCGGCGGATTAGCCCTGGCGGCAATCATGGTTTTTGGCATTTTTTCCAACCCCACCATCGGCCGTTCCCTCAGGTTTTGCATTGGCCGCAGTAGGGACCTCTACGCCACTCCCCAATAG

Protein

MSSFQTLRQLSPSTQKTFALLFASVLMFWLSLTALLPTLPMYAQDVGATKQQVGWIMGSFALGLLGSRIWIGQLVDRRGRKIAIVIGALVVALAPLGYLLTATVGALMAIRAFHGICLAAYTTGYNSLVVDLSPPQQRGEIIGYMSLAVPIGMGFGPAVGAYISQSIGYEFLFIASSLLGFISLVLALQVRENRPPDQSSAEDVFGDRPRPRSIGKLLTSRSMAVPTLVLLLIGLLFGNLATFLPLFVREIDLATYAGVFYSVAAIASFVPRLFLGSLADTYGRGLFIVGSLICYLLSMVCLAQADNSWELLTAAALEGAGSGILLPTTIALISDRSSLEERGRVFSVCMSGFDGGIAIAAPIMGVLNEIFGYRHVFWLSGGLALAAIMVFGIFSNPTIGRSLRFCIGRSRDLYATPQ