Your browser is old and dusty. Try Google Chrome!

Details for sll1150

ORF sll1150
Accession NP_441165.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -356 -342 2.35953 0.177
NP_441061.1_2 Reverse -269 -283 1.47456 0.188
NP_441061.1_2 Reverse -223 -237 -2.36035 0.29
NP_441061.1_2 Reverse -220 -234 -2.36035 0.29
NP_440557.1_1 Reverse -83 -102 1.47442 0.256
NP_440795.1_7 Forward -356 -349 14.6904 0.0123
NP_440795.1_7 Reverse -349 -356 14.6904 0.0123
NP_441418.1_6 Reverse -348 -367 -11.0136 0.043
NP_442291.1_5 Reverse -347 -363 7.2367 0.0657
NP_441453.1_4 Reverse -348 -356 16.539 0.00633
NP_441453.1_4 Forward -357 -349 16.539 0.00633
NP_442151.1_6 Forward -357 -343 14.7492 0.032
NP_441818.1_1 Reverse -349 -360 8.90795 0.271
NP_441818.1_9 Reverse -329 -348 0.982764 0.191
NP_441818.1_9 Reverse -229 -248 -2.55715 0.206
NP_441818.1_9 Reverse -352 -371 -4.6221 0.242
NP_441818.1_9 Reverse -358 -377 -10.522 0.295
NP_440226.1_1 Reverse -348 -367 17.3057 0.0194
NP_440150.1_6 Reverse -345 -364 9.53756 0.188
NP_440150.1_6 Forward -360 -341 5.99764 0.229
NP_440150.1_6 Forward -267 -248 0.786102 0.296
NP_440996.1_2 Forward -20 -11 14.8477 0.248
NP_443002.1_5 Forward -255 -237 12.3097 0.218
NP_443002.1_5 Forward -383 -365 8.3765 0.297
NP_442173.1_1 Forward -356 -348 15.4574 0.00633
NP_442173.1_1 Reverse -349 -357 15.4574 0.00633
NP_442173.1_1 Reverse -256 -264 5.72262 0.203
NP_442752.1_4 Forward -357 -350 13.8055 0.0199
NP_442752.1_4 Reverse -348 -355 13.8055 0.0199
NP_443027.1_4 Forward -359 -349 11.8781 0.0872
NP_443027.1_4 Reverse -346 -356 6.46988 0.275
NP_442975.1_10 Forward -361 -347 4.22722 0.245
NP_440784.1_7 Forward -356 -349 15.9687 0.0123
NP_440784.1_7 Reverse -349 -356 15.9687 0.0123
NP_440784.1_7 Forward -218 -211 5.84064 0.248
NP_440061.1_9 Forward -359 -345 20.4518 0.0035
NP_440061.1_9 Forward -258 -244 7.86545 0.189
NP_440878.1_9 Reverse -338 -357 1.27776 0.181
NP_440878.1_9 Forward -382 -363 -2.26216 0.258
NP_442062.1_8 Reverse -348 -358 19.4496 0.000558
NP_442062.1_8 Forward -357 -347 17.6796 0.00193
NP_441859.1_3 Forward -358 -339 10.7167 0.118
NP_441802.1_1 Forward -112 -93 12.9791 0.175
NP_440304.1_4 Reverse -346 -356 17.9746 0.00654
NP_440304.1_4 Forward -266 -256 4.69992 0.252
NP_440304.1_4 Forward -359 -349 1.84832 0.299
NP_442268.1_9 Reverse -355 -374 12.1925 0.295
NP_442242.1_4 Forward -356 -349 14.3954 0.0124
NP_442242.1_4 Reverse -349 -356 14.3954 0.0124
NP_439918.1_2 Reverse -235 -254 -1.08219 0.236
NP_441200.1_4 Forward -114 -95 6.58763 0.272
NP_441208.1_9 Reverse -345 -359 15.3392 0.0867
NP_441208.1_9 Reverse -252 -266 6.6861 0.234
NP_441925.1_4 Forward -379 -360 -9.04772 0.213
NP_441925.1_4 Forward -254 -235 -16.1275 0.281
NP_441925.1_4 Forward -382 -363 -16.3242 0.282
NP_441925.1_4 Forward -221 -202 -17.6025 0.297
NP_441083.1_5 Forward -357 -347 19.3512 0.000718
NP_441083.1_5 Reverse -348 -358 11.3864 0.0159
NP_441083.1_5 Reverse -255 -265 5.38824 0.12
NP_442827.1_8 Forward -365 -346 4.52188 0.134
NP_441434.1_7 Reverse -350 -364 5.30946 0.225
NP_441738.1_2 Forward -355 -348 15.28 0.0102
NP_441738.1_2 Reverse -350 -357 15.28 0.0102
NP_441558.1_5 Reverse -346 -365 12.4875 0.0677
NP_440209.1_1 Reverse -348 -356 18.1123 0.00295
NP_440209.1_1 Forward -357 -349 18.1123 0.00295
NP_442889.1_8 Reverse -31 -45 5.40719 0.227
NP_441713.1_1 Reverse -342 -361 6.78429 0.0568
NP_440178.1_7 Reverse -347 -366 -9.34199 0.0701
NP_440178.1_7 Forward -179 -160 -22.42 0.265
NP_442570.1_3 Reverse -355 -374 -1.37718 0.212
NP_442570.1_3 Reverse -238 -257 -5.21209 0.241
NP_441716.1_1 Forward -357 -343 9.14437 0.124
NP_441716.1_1 Reverse -348 -362 8.84938 0.13
NP_441327.1_5 Forward -22 -13 16.6177 0.111
NP_442111.1_4 Reverse -347 -361 7.76774 0.0867
NP_442111.1_4 Forward -358 -344 3.63784 0.236
NP_441163.1_1 Reverse -340 -357 11.8378 0.183
NP_441163.1_7 Forward -266 -247 16.8141 0.226
NP_440906.1_5 Forward -356 -349 15.8704 0.0124
NP_440906.1_5 Reverse -349 -356 15.8704 0.0124
NP_441209.1_4 Reverse -266 -285 10.7167 0.279
NP_440747.1_10 Reverse -345 -357 7.80712 0.00223
NP_440747.1_10 Forward -360 -348 7.31547 0.00577
NP_440747.1_10 Reverse -109 -121 -12.0557 0.199
NP_441130.1_10 Reverse -346 -360 17.9942 0.0144
NP_441130.1_10 Forward -359 -345 10.0294 0.117
NP_441486.1_1 Forward -360 -346 5.01447 0.0398
NP_442330.1_3 Forward -240 -221 9.24257 0.237
NP_442634.1_2 Reverse -342 -361 5.60432 0.241
NP_442634.1_4 Forward -359 -345 6.3911 0.0507
NP_442634.1_4 Reverse -346 -360 -4.81863 0.22
NP_441265.1_3 Reverse -342 -356 7.17775 0.181
NP_440403.1_4 Forward -366 -347 2.55606 0.13
NP_442848.1_1 Forward -363 -349 -1.08205 0.263
NP_441012.1_4 Reverse -46 -59 9.75405 0.272
NP_441012.1_4 Forward -57 -44 6.31247 0.282
NP_443018.1_3 Forward -356 -349 14.8871 0.0123
NP_443018.1_3 Reverse -349 -356 14.8871 0.0123
NP_441316.1_7 Forward -359 -344 6.56807 0.107
NP_441634.1_8 Forward -359 -345 -3.04867 0.295
NP_441634.1_8 Reverse -346 -360 -3.44199 0.295
NP_441634.1_9 Reverse -353 -372 19.8614 0.0999
NP_440376.1_1 Forward -357 -348 19.4693 0.000692
NP_440376.1_1 Reverse -348 -357 19.4693 0.000692
NP_443065.1_7 Reverse -101 -120 16.1249 0.276
NP_442687.1_7 Reverse -347 -357 18.5646 0.0028
NP_442687.1_7 Forward -358 -348 15.8113 0.0125
NP_442687.1_7 Reverse -267 -277 8.4365 0.107
NP_442687.1_7 Forward -265 -255 6.56821 0.159
NP_442485.1_3 Reverse -346 -365 -4.81876 0.285
NP_442485.1_3 Reverse -264 -283 -5.70374 0.295
NP_441013.1_3 Reverse -346 -365 7.07928 0.273
NP_440042.1_2 Reverse -338 -357 8.75091 0.184
NP_441422.1_7 Forward -359 -342 6.82368 0.0992
NP_440533.1_3 Reverse -202 -216 17.6992 0.197
NP_440360.1_10 Forward -254 -240 1.86788 0.282
NP_442658.1_1 Reverse -346 -356 17.6791 0.00565
NP_442658.1_1 Forward -359 -349 17.0891 0.00615
NP_442161.1_7 Forward -260 -241 5.40766 0.208
NP_441971.1_5 Reverse -371 -390 7.86593 0.288
NP_441855.2_4 Forward -127 -108 13.0901 0.173
NP_440656.1_8 Forward -368 -349 -7.08038 0.249
NP_441414.1_9 Forward -357 -338 -1.86883 0.106
NP_441414.1_9 Reverse -348 -367 -7.17871 0.212
NP_441487.1_6 Forward -272 -253 -2.0655 0.286
NP_441487.1_9 Forward -265 -246 0.196116 0.237
NP_441256.1_1 Reverse -41 -60 -7.86702 0.239
NP_442937.1_5 Forward -362 -343 6.09597 0.288
NP_441165.1_4 Forward -231 -212 18.9773 0.0547
NP_441958.1_5 Reverse -347 -357 20.5312 0.000966
NP_441958.1_5 Forward -358 -348 12.2714 0.00183
NP_441958.1_5 Forward -265 -255 -1.29827 0.236
NP_442836.1_5 Reverse -342 -361 7.17762 0.169
NP_440203.1_5 Forward -354 -344 11.2876 0.2
NP_440203.1_5 Reverse -258 -268 10.206 0.235
NP_439905.1_1 Forward -255 -242 9.65572 0.216
NP_439905.1_1 Forward -356 -343 8.27909 0.234
NP_439905.1_1 Reverse -220 -233 6.50913 0.285
NP_440984.1_7 Reverse -343 -357 9.93102 0.126
NP_440984.1_7 Forward -362 -348 8.45605 0.144
NP_441162.1_3 Reverse -115 -134 10.5209 0.211
NP_439990.1_5 Reverse -343 -356 9.85238 0.13
NP_439990.1_5 Reverse -320 -333 9.75405 0.133
NP_442376.1_2 Forward -124 -105 -3.54046 0.202
NP_442690.1_1 Reverse -10 -29 -17.3068 0.299
NP_442911.1_2 Reverse -338 -357 4.81767 0.0367
NP_442911.1_2 Forward -367 -348 -4.81876 0.142
NP_440153.1_5 Reverse -349 -363 18.8791 0.0435
NP_442536.1_4 Forward -111 -93 8.18062 0.299
NP_440993.1_4 Forward -372 -355 4.07041 0.277
NP_439975.1_2 Reverse -241 -259 8.18062 0.215
NP_441348.1_7 Reverse -376 -395 5.60432 0.289
NP_441099.1_5 Reverse -338 -357 -8.55534 0.197
NP_442002.1_9 Reverse -347 -354 14.1004 0.074
NP_442002.1_9 Forward -265 -258 12.4288 0.185
NP_442002.1_9 Forward -358 -351 10.7572 0.185
NP_441294.1_7 Forward -361 -347 14.914 0.033
NP_442438.1_10 Forward -110 -96 2.85119 0.168
NP_440879.1_6 Reverse -250 -269 2.65439 0.242
NP_441000.1_6 Reverse -347 -361 23.4024 0.0121
NP_442771.1_1 Forward -359 -341 -4.70074 0.166
NP_440147.1_4 Forward -359 -346 19.6855 0.00258
NP_440147.1_4 Reverse -346 -359 10.344 0.0355
NP_440147.1_4 Forward -266 -253 6.31247 0.0963
NP_440147.1_4 Reverse -94 -107 4.8375 0.146
NP_441550.1_8 Reverse -346 -356 19.8424 0.00352
NP_441550.1_8 Forward -359 -349 8.82935 0.112
NP_441916.1_7 Reverse -348 -358 18.4663 0.00144
NP_441916.1_7 Forward -357 -347 16.893 0.00407
NP_441916.1_7 Reverse -269 -279 1.74999 0.275
NP_440465.1_10 Reverse -345 -364 0.0977854 0.29
NP_441041.1_7 Reverse -345 -357 18.593 0.00508
NP_441041.1_7 Forward -360 -348 8.58373 0.133
NP_440099.1_1 Reverse -146 -165 3.63691 0.256
NP_442004.1_6 Reverse -110 -124 5.80112 0.181
NP_442004.1_6 Forward -357 -343 5.1128 0.197
NP_441725.1_5 Forward -356 -346 18.7612 0.0119
NP_441725.1_5 Reverse -349 -359 2.04498 0.115
NP_441725.1_5 Reverse -256 -266 -0.118297 0.232
NP_439966.1_7 Forward -359 -349 17.9741 0.00631
NP_439966.1_7 Reverse -346 -356 8.14104 0.14
NP_439966.1_7 Reverse -108 -118 4.10949 0.289
NP_439966.1_9 Reverse -346 -355 0.983037 0.253
NP_439966.1_9 Forward -359 -350 0.884706 0.253
NP_440202.1_8 Forward -365 -346 11.7516 0.272
NP_442941.1_3 Reverse -349 -359 10.7964 0.0116
NP_442941.1_3 Forward -356 -346 2.43831 0.14
NP_440289.1_2 Forward -360 -347 14.0806 0.012
NP_440289.1_2 Reverse -345 -358 4.73917 0.0649
NP_440260.1_7 Reverse -248 -267 -6.09707 0.283
NP_440260.1_8 Reverse -354 -372 -0.177514 0.206
NP_442281.1_1 Forward -362 -348 11.7987 0.0437
NP_442281.1_1 Reverse -343 -357 9.73373 0.0675
NP_442281.1_1 Forward -260 -246 2.16228 0.276
NP_442256.1_2 Reverse -346 -364 -8.24065 0.218
NP_440437.1_1 Forward -270 -251 -2.36049 0.218
NP_440437.1_1 Reverse -342 -361 -5.40875 0.282
NP_440647.1_9 Forward -359 -341 6.31233 0.219
NP_442500.1_9 Forward -99 -80 13.6675 0.275
NP_442012.1_1 Forward -284 -265 -0.885524 0.27
NP_442012.1_1 Reverse -342 -361 -1.67217 0.294
NP_441457.1_7 Reverse -346 -365 5.80098 0.186
NP_441457.1_7 Reverse -208 -227 2.0644 0.263
NP_441556.1_4 Forward -369 -350 14.4398 0.165
NP_441556.1_10 Reverse -343 -357 9.92981 0.281
NP_440498.1_1 Forward -366 -348 6.01734 0.093
NP_442068.1_4 Forward -255 -236 5.89851 0.245
NP_441644.1_6 Forward -357 -347 15.7125 0.0048
NP_441644.1_6 Reverse -348 -358 10.1076 0.0628
NP_441644.1_6 Reverse -44 -54 4.40448 0.239
NP_442215.1_2 Reverse -253 -269 -1.61309 0.186
NP_442215.1_2 Forward -359 -343 -3.57971 0.218
NP_442029.1_1 Forward -55 -36 -12.4886 0.247
NP_440253.1_2 Reverse -348 -366 5.62401 0.0906
NP_440929.1_8 Forward -357 -348 19.2726 0.000701
NP_440929.1_8 Reverse -348 -357 19.2726 0.000701
NP_442933.1_10 Forward -357 -348 17.601 0.00325
NP_442933.1_10 Reverse -348 -357 17.601 0.00325
NP_441751.2_8 Forward -356 -342 21.1407 0.00597
NP_442554.1_8 Forward -356 -346 16.9913 0.0065
NP_442554.1_8 Reverse -349 -359 14.1397 0.0144
NP_442554.1_8 Reverse -45 -55 5.09324 0.161
NP_442167.1_6 Forward -352 -336 13.6275 0.228
NP_442075.1_5 Forward -128 -109 21.4122 0.0457
NP_441762.1_7 Forward -358 -346 11.7404 0.0142
NP_441762.1_7 Reverse -347 -359 11.5437 0.0142
NP_442142.1_4 Reverse -345 -358 15.7516 0.0264
NP_442142.1_4 Forward -56 -43 4.64028 0.214
NP_442292.1_1 Reverse -349 -358 9.63616 0.0183
NP_442292.1_1 Forward -356 -347 9.53783 0.0183
NP_442476.1_6 Reverse -349 -363 9.73436 0.0801
NP_442476.1_6 Forward -356 -342 3.04785 0.165
NP_442381.1_8 Forward -360 -341 -14.6519 0.284
NP_442381.1_8 Reverse -345 -364 -14.7502 0.284
NP_443009.1_5 Reverse -347 -358 20.6093 0.001
NP_443009.1_5 Forward -358 -347 9.10461 0.0965
NP_441715.1_4 Reverse -349 -359 18.8596 0.00741
NP_440357.1_3 Reverse -244 -263 0.0977854 0.285
NP_441448.1_1 Forward -239 -220 3.83436 0.287
NP_441198.1_8 Reverse -346 -356 15.2245 0.0427
NP_441758.1_10 Forward -40 -21 -0.984623 0.265
NP_441468.1_1 Forward -356 -349 15.8704 0.0124
NP_441468.1_1 Reverse -349 -356 15.8704 0.0124
NP_441468.1_9 Reverse -46 -60 16.3225 0.282
NP_441020.2_6 Reverse -346 -363 9.38028 0.173
NP_441015.1_10 Forward -236 -217 -11.6036 0.298
NP_441673.1_1 Forward -357 -348 20.8459 0.000698
NP_441673.1_1 Reverse -348 -357 20.8459 0.000698
NP_441826.1_2 Reverse -342 -356 5.21113 0.0978
NP_441826.1_2 Forward -363 -349 -1.37704 0.245
NP_441826.1_2 Forward -225 -211 -3.83532 0.288
NP_442811.1_2 Reverse -196 -215 -3.24547 0.287
NP_442868.1_6 Reverse -346 -356 16.7946 0.0131
NP_442868.1_6 Forward -359 -349 10.3048 0.038
NP_441251.1_7 Reverse -90 -103 13.7856 0.266
NP_442227.1_2 Reverse -215 -234 2.16274 0.238
NP_442808.1_1 Forward -358 -348 18.4657 0.00201
NP_442808.1_1 Reverse -347 -357 8.73102 0.0481
NP_442808.1_1 Reverse -109 -119 2.73286 0.256
NP_441101.1_4 Reverse -10 -29 11.7992 0.153
NP_441101.1_10 Reverse -344 -363 -7.76869 0.292
NP_442542.1_2 Reverse -346 -359 12.0157 0.114
NP_442542.1_2 Forward -359 -346 8.18076 0.16
NP_442542.1_2 Reverse -253 -266 7.88576 0.168
NP_442542.1_9 Forward -364 -350 5.70218 0.259
NP_442050.1_5 Reverse -346 -356 14.9258 0.0175
NP_442050.1_5 Forward -359 -349 6.96107 0.27
NP_440038.1_4 Forward -258 -239 0.0977854 0.277
NP_442342.1_9 Forward -359 -343 3.59845 0.26
NP_440558.1_2 Forward -226 -207 -6.09707 0.271
NP_441518.1_3 Forward -367 -348 -6.1954 0.132
NP_441878.1_6 Reverse -347 -357 20.2362 0.0046
NP_441878.1_6 Forward -358 -348 10.4031 0.0176
NP_441878.1_6 Forward -179 -169 -7.19813 0.21
NP_441878.1_6 Reverse -254 -264 -7.59145 0.245
NP_441036.1_6 Reverse -345 -363 8.7706 0.292
NP_441036.1_8 Forward -358 -348 17.7779 0.000554
NP_441036.1_8 Reverse -347 -357 8.4365 0.174
NP_442721.1_10 Reverse -140 -159 9.24257 0.265
NP_441557.1_5 Forward -357 -348 19.9609 0.000699
NP_441557.1_5 Reverse -348 -357 19.9609 0.000699
NP_441590.1_4 Forward -255 -236 2.55527 0.293
NP_441458.1_10 Forward -337 -318 1.76941 0.283
NP_442830.1_5 Forward -256 -242 6.29216 0.216
NP_442183.1_1 Forward -357 -343 9.73436 0.094
NP_442183.1_1 Reverse -348 -362 8.55439 0.113
NP_442397.1_9 Reverse -288 -307 2.55606 0.273
NP_440979.1_3 Forward -356 -338 11.3272 0.234
NP_441819.1_4 Reverse -145 -164 11.9958 0.146
NP_442135.1_3 Forward -369 -350 6.19431 0.26
NP_441574.1_1 Reverse -210 -229 -3.24547 0.238
NP_441549.1_9 Reverse -251 -269 8.86894 0.0579
NP_441549.1_9 Forward -361 -343 -5.29072 0.198
NP_442347.1_2 Reverse -349 -358 11.1111 0.056
NP_442347.1_2 Forward -356 -347 3.34298 0.284
NP_442347.1_10 Forward -254 -240 15.9285 0.216
NP_440547.1_5 Reverse -214 -233 7.86593 0.225
NP_441037.1_4 Reverse -346 -356 18.9151 0.00351
NP_441037.1_4 Forward -359 -349 6.92787 0.237
NP_442594.1_8 Forward -55 -36 5.60432 0.244
NP_442317.1_6 Reverse -343 -362 6.39097 0.238
NP_441633.1_3 Forward -359 -346 24.897 0.00268
NP_441633.1_3 Forward -221 -208 -5.58558 0.236
NP_441633.1_3 Reverse -346 -359 -5.78224 0.236
NP_440136.1_2 Forward -356 -349 15.9687 0.0123
NP_440136.1_2 Reverse -349 -356 15.9687 0.0123
NP_442590.1_9 Forward -126 -107 5.80098 0.267
NP_442998.1_5 Reverse -252 -262 14.533 0.149
NP_442998.1_10 Forward -355 -348 15.5754 0.0102
NP_442998.1_10 Reverse -350 -357 15.5754 0.0102
NP_442998.1_10 Reverse -257 -264 9.28223 0.117
NP_440899.1_8 Reverse -89 -108 -9.44032 0.262
NP_440299.1_1 Reverse -344 -357 8.86849 0.0835
NP_440299.1_1 Forward -361 -348 6.11523 0.152
NP_441799.1_1 Reverse -344 -358 17.9935 0.00957
NP_441799.1_1 Forward -361 -347 7.17714 0.149
NP_441007.1_10 Reverse -343 -356 11.7207 0.0599
NP_440256.1_1 Reverse -345 -364 10.4225 0.0184
NP_440256.1_1 Forward -56 -37 -4.22878 0.15
NP_440087.1_1 Forward -366 -347 -6.58872 0.253
NP_441559.1_8 Forward -362 -348 2.85119 0.143
NP_441559.1_8 Reverse -343 -357 -6.68692 0.279
NP_440915.1_6 Reverse -344 -358 5.60446 0.088
NP_440915.1_6 Forward -361 -347 2.94952 0.11
NP_441179.1_9 Reverse -42 -52 17.7774 0.212
NP_440717.1_3 Forward -216 -202 8.16044 0.27
NP_442785.1_7 Reverse -346 -360 8.35772 0.298
NP_442866.1_1 Reverse -352 -371 -6.29373 0.254
NP_442866.1_1 Reverse -324 -343 -8.35868 0.279
NP_441464.1_1 Forward -371 -352 10.1275 0.24
NP_441464.1_8 Forward -264 -250 14.2576 0.127
NP_441464.1_8 Forward -357 -343 9.93102 0.187
NP_441464.1_10 Reverse -361 -375 15.9292 0.164
NP_441464.1_10 Reverse -243 -257 10.1277 0.262
NP_441464.1_10 Reverse -236 -250 7.66941 0.295
NP_441939.1_3 Reverse -349 -368 14.7491 0.0717
NP_441939.1_3 Forward -356 -337 9.43923 0.145
NP_441199.1_6 Forward -361 -342 17.109 0.0257
NP_441494.1_6 Reverse -343 -356 10.5407 0.225
NP_442993.1_1 Forward -357 -341 0.353528 0.0642
NP_442386.1_9 Forward -358 -349 15.7322 0.0144
NP_442386.1_9 Reverse -347 -356 6.39082 0.219
NP_441750.1_1 Reverse -357 -376 -12.7836 0.3
NP_441340.1_5 Forward -356 -349 15.6737 0.0124
NP_441340.1_5 Reverse -349 -356 15.6737 0.0124
NP_440327.1_6 Reverse -351 -370 3.04771 0.285
NP_442240.1_1 Forward -273 -254 2.9486 0.295
NP_442240.1_2 Reverse -320 -339 -17.7985 0.274
NP_441160.1_1 Forward -271 -252 -3.44213 0.236
NP_441027.1_1 Reverse -7 -21 12.192 0.27
NP_440211.1_1 Reverse -160 -179 10.4217 0.263
NP_440586.1_8 Forward -356 -349 13.2151 0.026
NP_440586.1_8 Reverse -349 -356 13.2151 0.026
NP_440586.1_8 Forward -52 -45 5.8403 0.283
NP_440586.1_9 Reverse -105 -124 5.211 0.288
NP_442251.1_6 Forward -356 -349 15.2804 0.0124
NP_442251.1_6 Reverse -349 -356 15.2804 0.0124
NP_441262.1_3 Reverse -348 -355 14.7888 0.0223
NP_441262.1_3 Forward -357 -350 14.7888 0.0223
NP_440027.1_3 Forward -367 -349 4.63995 0.255
NP_443051.1_1 Reverse -347 -356 18.0926 0.00402
NP_443051.1_1 Forward -358 -349 10.4228 0.00754
NP_439937.1_9 Forward -358 -341 -6.74666 0.157
NP_439937.1_9 Reverse -347 -364 -16.2847 0.287
NP_441595.1_5 Reverse -341 -359 7.09898 0.222
NP_440836.1_6 Reverse -96 -110 11.2093 0.227
NP_441740.2_10 Reverse -357 -376 8.06259 0.286
NP_441740.2_10 Forward -284 -265 7.96426 0.286
NP_440439.1_1 Forward -360 -347 21.6521 0.00844
NP_440439.1_1 Reverse -345 -358 8.67241 0.0513
NP_440372.1_2 Forward -356 -349 16.3621 0.0124
NP_440372.1_2 Reverse -349 -356 16.3621 0.0124
NP_440271.1_2 Forward -62 -43 0.884433 0.284
NP_440819.1_5 Forward -22 -14 7.68924 0.266
NP_440316.1_10 Reverse -245 -255 8.1415 0.24
NP_440139.1_1 Forward -363 -344 6.78348 0.139
NP_441572.1_7 Reverse -342 -361 9.0459 0.074
NP_442887.1_5 Reverse -36 -55 -11.2103 0.264
NP_442384.1_10 Reverse -348 -361 11.819 0.0326
NP_442384.1_10 Forward -357 -344 10.049 0.047
NP_442114.1_4 Reverse -348 -359 9.20345 0.17
NP_441877.1_7 Forward -362 -343 5.89851 0.218
NP_441018.1_7 Reverse -236 -255 9.24257 0.23
NP_442790.1_4 Reverse -339 -358 -7.96535 0.161
NP_442262.1_10 Forward -356 -349 14.1988 0.0123
NP_442262.1_10 Reverse -349 -356 14.1988 0.0123
NP_442262.1_10 Reverse -256 -263 7.90559 0.266
NP_442244.1_6 Reverse -207 -226 3.6377 0.291
NP_440163.1_10 Forward -56 -46 8.82982 0.26
NP_440344.1_10 Reverse -341 -358 -11.6625 0.223
NP_440282.1_10 Reverse -264 -283 -8.16202 0.26
NP_440531.1_6 Reverse -340 -359 1.0811 0.182
NP_440531.1_6 Reverse -108 -127 -5.01543 0.291
NP_440189.1_10 Reverse -337 -356 5.30933 0.279
NP_440562.1_3 Forward -356 -339 6.92201 0.15
NP_441965.1_10 Forward -360 -344 3.69678 0.256
NP_440297.1_9 Forward -356 -346 9.51814 0.0917
NP_440297.1_9 Reverse -349 -359 -0.118297 0.282
NP_440297.1_9 Reverse -45 -55 -0.511621 0.289
NP_441592.1_4 Forward -357 -338 7.96426 0.124
NP_441896.1_3 Forward -366 -347 -0.4922 0.241
NP_440999.1_9 Forward -361 -347 7.17775 0.0896
NP_440999.1_9 Reverse -344 -358 0.88457 0.174
NP_440999.1_9 Forward -223 -209 -0.295402 0.203
NP_440888.1_2 Reverse -348 -362 13.5686 0.027
NP_440888.1_2 Forward -357 -343 5.50552 0.276
NP_440179.1_6 Forward -263 -244 5.11266 0.245
NP_442225.1_10 Reverse -100 -119 12.88 0.197
NP_439969.1_3 Reverse -343 -362 0.786102 0.265
NP_442948.1_2 Reverse -347 -366 4.62101 0.26
NP_442033.1_10 Forward -359 -340 1.76941 0.0882
NP_442033.1_10 Forward -360 -341 -4.32711 0.179
NP_441543.1_2 Reverse -349 -358 18.486 0.00236
NP_441543.1_2 Forward -356 -347 9.34117 0.0818
NP_442845.1_2 Reverse -342 -356 6.09611 0.217
NP_442845.1_2 Reverse -240 -254 5.99778 0.219
NP_442845.1_4 Forward -359 -340 8.84924 0.185
NP_441834.1_10 Forward -282 -263 2.0644 0.26
NP_441551.1_5 Forward -361 -345 14.3158 0.115
NP_441551.1_5 Reverse -344 -360 7.33433 0.249
NP_440982.1_1 Forward -219 -200 4.71854 0.294
NP_440982.1_1 Forward -255 -236 4.03023 0.294
NP_441469.1_4 Forward -124 -105 11.3075 0.249
NP_441469.1_8 Forward -358 -349 16.126 0.00797
NP_441469.1_8 Reverse -347 -356 13.3727 0.073
NP_443064.1_6 Forward -357 -347 13.8273 0.0796
NP_442578.1_7 Forward -356 -349 14.5921 0.026
NP_442578.1_7 Reverse -349 -356 14.5921 0.026
NP_441462.1_2 Forward -357 -347 20.1379 0.000967
NP_441462.1_2 Reverse -348 -358 11.5831 0.00406
NP_441462.1_2 Forward -264 -254 -1.19994 0.291
NP_441621.1_7 Forward -359 -345 6.3911 0.068
NP_441621.1_7 Reverse -346 -360 4.52282 0.0934
NP_443062.1_6 Forward -365 -346 10.6192 0.112
NP_443062.1_6 Reverse -340 -359 2.3594 0.256
NP_442204.1_1 Forward -57 -46 0.648657 0.281
NP_442204.1_1 Forward -361 -350 0.0586712 0.284
NP_442204.1_5 Reverse -338 -357 6.19431 0.147
NP_441560.1_3 Forward -243 -225 8.7706 0.28
NP_441560.1_8 Reverse -343 -362 13.0709 0.232
NP_440504.1_5 Forward -101 -83 9.36059 0.162
NP_440255.1_8 Forward -105 -86 12.8799 0.298
NP_440516.1_2 Reverse -342 -360 9.16393 0.101
NP_440516.1_8 Forward -357 -348 16.9127 0.00442
NP_440516.1_8 Reverse -348 -357 16.9127 0.00442
NP_442428.1_4 Forward -358 -339 5.60432 0.211
NP_442428.1_5 Forward -356 -349 15.8704 0.0124
NP_442428.1_5 Reverse -349 -356 15.8704 0.0124
NP_442428.1_8 Reverse -353 -372 -1.47551 0.284
NP_440783.1_5 Reverse -229 -248 1.96607 0.19
NP_440673.1_3 Forward -355 -348 12.4288 0.0426
NP_440673.1_3 Reverse -350 -357 12.4288 0.0426
NP_440865.1_9 Reverse -342 -361 -1.7705 0.178
NP_441052.1_2 Reverse -348 -358 10.5014 0.0285
NP_441052.1_2 Forward -357 -347 10.4031 0.0285
NP_442219.1_8 Reverse -203 -222 9.80987 0.219
NP_442219.1_9 Reverse -349 -358 8.35786 0.0681
NP_442219.1_9 Forward -356 -347 8.25953 0.0681
NP_440436.1_4 Reverse -349 -358 18.1905 0.00233
NP_440436.1_4 Forward -356 -347 15.9289 0.00508
NP_440436.1_4 Reverse -220 -229 6.39082 0.162
NP_441884.1_8 Reverse -347 -366 9.14423 0.0541
NP_441884.1_8 Reverse -95 -114 -10.1286 0.268
NP_441884.1_9 Reverse -345 -364 -14.8485 0.138
NP_441884.1_9 Forward -267 -248 -25.7633 0.29
NP_440314.1_9 Forward -356 -337 -6.88371 0.233
NP_441719.1_2 Reverse -15 -29 14.5017 0.278
NP_441719.1_4 Forward -356 -349 16.3621 0.0124
NP_441719.1_4 Reverse -349 -356 16.3621 0.0124
NP_441733.1_5 Forward -377 -358 14.3558 0.294
NP_441733.1_10 Reverse -345 -358 16.9322 0.0382
NP_441733.1_10 Forward -122 -109 12.5073 0.106
NP_441004.1_1 Reverse -381 -400 -9.83364 0.212
NP_441004.1_1 Reverse -263 -282 -15.1435 0.273
NP_441004.1_1 Forward -283 -264 -17.4051 0.291
NP_442813.1_2 Reverse -2 -21 5.50599 0.191
NP_442366.1_3 Forward -358 -340 -1.35749 0.211
NP_440296.1_10 Reverse -345 -364 -4.32711 0.209
NP_441115.1_4 Forward -54 -36 13.293 0.0827
NP_441115.1_4 Forward -358 -340 11.3264 0.145
NP_442694.1_4 Reverse -357 -366 12.8811 0.239
NP_440328.1_4 Forward -363 -344 14.3558 0.0367
NP_443054.1_2 Forward -359 -345 8.35772 0.122
NP_441851.1_10 Reverse -347 -357 17.4829 0.0027
NP_441851.1_10 Forward -358 -348 16.008 0.00552
NP_442622.1_1 Reverse -347 -366 -11.9969 0.257
NP_442622.1_8 Reverse -348 -366 0.412472 0.0762
NP_442011.1_1 Reverse -209 -228 0.0977854 0.268
NP_442011.1_1 Forward -358 -339 -0.4922 0.268
NP_442515.1_1 Reverse -347 -361 10.0294 0.0568
NP_442515.1_1 Forward -358 -344 7.47274 0.0913
NP_442515.1_1 Forward -265 -251 1.47456 0.158
NP_442515.1_1 Forward -202 -188 -2.26202 0.271
NP_441396.1_5 Reverse -239 -248 8.25953 0.224
NP_442709.1_3 Reverse -341 -360 10.6192 0.121
NP_441349.1_10 Reverse -102 -121 -5.31042 0.198
NP_441349.1_10 Forward -367 -348 -8.85033 0.279
NP_441409.1_6 Reverse -342 -361 -4.52377 0.0922
NP_440432.1_9 Reverse -349 -364 6.07642 0.0481
NP_442843.1_1 Reverse -247 -266 -3.93378 0.23
NP_439960.1_10 Reverse -105 -123 -4.20908 0.292
NP_441477.1_10 Reverse -341 -359 4.24738 0.203
NP_442450.1_5 Reverse -346 -356 10.1081 0.115
NP_440588.1_2 Reverse -339 -358 18.3873 0.0104
NP_442006.1_2 Forward -366 -349 -18.0541 0.287
NP_442006.1_2 Reverse -246 -263 -19.1357 0.299
NP_440483.1_4 Reverse -364 -383 2.3594 0.288
NP_442243.1_1 Forward -277 -259 -1.16155 0.269
NP_441570.1_1 Reverse -348 -366 2.87075 0.023
NP_440078.1_10 Forward -357 -338 9.0459 0.196
NP_441078.1_4 Forward -357 -348 19.6659 0.0007
NP_441078.1_4 Reverse -348 -357 19.6659 0.0007
NP_442729.1_7 Reverse -94 -112 14.7688 0.183
NP_442729.1_8 Reverse -344 -357 10.2457 0.125
NP_441663.1_8 Forward -363 -344 10.0292 0.0779
NP_442443.1_1 Reverse -379 -398 -3.93378 0.267
NP_440526.1_3 Forward -356 -345 18.446 0.0306
NP_441432.1_8 Reverse -347 -356 8.35786 0.0755
NP_441432.1_8 Forward -358 -349 8.25953 0.0755
NP_442320.1_8 Forward -363 -349 -3.44199 0.122
NP_441732.1_2 Reverse -344 -360 -15.8711 0.163
NP_441732.1_2 Forward -361 -345 -16.0677 0.164
NP_440497.1_6 Forward -58 -39 -2.55715 0.264
NP_440629.1_6 Forward -363 -344 14.2621 0.183
NP_440760.1_1 Forward -357 -338 -4.52377 0.0447
NP_440760.1_1 Reverse -348 -367 -11.9969 0.0903
NP_442274.1_8 Reverse -215 -233 13.7606 0.286
NP_442353.1_7 Forward -128 -109 10.5209 0.176
NP_440913.1_1 Reverse -226 -244 3.65739 0.295
NP_442727.1_1 Reverse -234 -248 12.7826 0.256
NP_442400.1_1 Forward -360 -341 -4.42544 0.266
NP_442489.1_7 Forward -357 -348 20.1576 0.000695
NP_442489.1_7 Reverse -348 -357 20.1576 0.000695
NP_442489.1_7 Reverse -255 -264 -1.77023 0.247
NP_440565.1_7 Forward -125 -106 1.47442 0.246
NP_440559.1_1 Forward -356 -347 17.306 0.00658
NP_440559.1_1 Reverse -349 -358 8.75118 0.0586
NP_441659.2_8 Forward -357 -347 19.3512 0.000966
NP_441659.2_8 Reverse -348 -358 11.9764 0.0147
NP_440860.1_8 Reverse -346 -365 16.3224 0.209
NP_439956.1_7 Reverse -352 -371 10.3242 0.257
NP_442008.1_2 Reverse -345 -364 4.62101 0.234
NP_442776.1_8 Forward -261 -242 12.585 0.281
NP_442346.1_5 Reverse -347 -357 17.9746 0.00128
NP_442346.1_5 Forward -54 -44 12.4681 0.0421
NP_442346.1_5 Forward -358 -348 9.02648 0.118
NP_442346.1_5 Reverse -209 -219 8.92815 0.121
NP_440545.1_3 Forward -361 -344 7.70866 0.0488
NP_440545.1_3 Reverse -344 -361 7.61033 0.0489
NP_440545.1_5 Reverse -359 -376 6.82368 0.21
NP_441856.1_3 Forward -360 -341 0.786102 0.213
NP_440831.1_3 Reverse -339 -358 8.52284 0.223
NP_441786.1_10 Forward -343 -324 5.89931 0.287
NP_441653.1_2 Forward -368 -349 20.6338 0.026
NP_440010.1_1 Reverse -232 -251 6.19431 0.297
NP_440010.1_4 Forward -361 -342 -3.34455 0.297
NP_441943.1_8 Reverse -259 -278 -12.5869 0.261
NP_442603.1_7 Forward -357 -343 14.7486 0.0613
NP_441888.1_7 Forward -362 -348 13.6676 0.0743
NP_443022.1_9 Forward -389 -370 19.3707 0.194
NP_441948.1_4 Forward -364 -346 8.08229 0.0623
NP_441948.1_4 Reverse -103 -121 -3.71743 0.203
NP_439970.1_3 Reverse -151 -170 5.40766 0.278
NP_441833.1_4 Forward -356 -349 15.9687 0.0124
NP_441833.1_4 Reverse -349 -356 15.9687 0.0124
NP_441329.1_6 Forward -33 -14 1.09773 0.244
NP_441895.1_2 Forward -373 -354 -17.5035 0.234
NP_442162.1_9 Forward -356 -349 16.2637 0.0124
NP_442162.1_9 Reverse -349 -356 16.2637 0.0124
NP_442140.1_3 Forward -356 -346 14.828 0.0433
NP_442140.1_3 Reverse -349 -359 14.238 0.0486
NP_441609.1_5 Reverse -88 -107 7.86593 0.299
NP_440875.1_9 Reverse -350 -360 14.3096 0.0453
NP_440875.1_9 Forward -355 -345 9.24806 0.233
NP_441813.1_5 Forward -359 -349 19.4496 0.00647
NP_441813.1_5 Reverse -346 -356 8.92815 0.0347
NP_440594.1_8 Forward -356 -343 10.9334 0.153
NP_440590.1_4 Reverse -349 -362 5.13249 0.0585
NP_440590.1_4 Forward -356 -343 -3.32397 0.255
NP_440567.1_1 Forward -356 -342 7.27608 0.0744
NP_442497.1_10 Forward -356 -347 19.8626 0.00532
NP_442497.1_10 Reverse -349 -358 10.4228 0.0087
NP_440821.1_4 Reverse -346 -356 19.5479 0.00399
NP_440821.1_4 Forward -359 -349 10.2065 0.0163
NP_441239.1_9 Forward -359 -347 17.7386 0.0146
NP_441239.1_9 Reverse -346 -358 17.0502 0.0153
NP_441239.1_9 Reverse -253 -265 3.57889 0.283
NP_441239.1_9 Forward -107 -95 3.08724 0.296
NP_441239.1_9 Forward -257 -245 2.98891 0.3
NP_441951.1_9 Reverse -117 -136 0.687771 0.258
NP_441009.1_4 Reverse -269 -288 10.9142 0.26
NP_441892.1_1 Forward -124 -107 -3.79607 0.249
NP_441892.1_1 Reverse -35 -52 -4.28772 0.258
NP_440665.1_1 Reverse -351 -370 -14.0619 0.261
NP_440604.1_6 Forward -357 -338 -2.85214 0.225
NP_440740.1_4 Reverse -227 -246 18.1901 0.265
NP_440833.1_6 Forward -107 -93 7.3738 0.278
NP_441526.1_8 Reverse -354 -373 5.211 0.277
NP_440949.1_7 Forward -356 -337 16.4199 0.162
NP_440949.1_7 Forward -365 -346 11.8967 0.218
NP_442138.1_10 Reverse -348 -367 3.73603 0.114
NP_440412.1_2 Reverse -356 -375 6.98095 0.281
NP_440546.1_4 Forward -357 -347 12.8578 0.0572
NP_440546.1_4 Reverse -348 -358 11.8882 0.0679
NP_440546.1_4 Reverse -246 -256 9.46426 0.136
NP_440546.1_4 Forward -53 -43 9.27034 0.146
NP_440675.1_3 Reverse -210 -229 11.8975 0.17
NP_440675.1_3 Reverse -348 -367 7.17762 0.25
NP_440462.1_4 Reverse -356 -370 10.3243 0.24
NP_440462.1_6 Forward -359 -349 17.2863 0.00752
NP_440462.1_6 Reverse -346 -356 10.4031 0.0396
NP_442340.1_3 Forward -276 -257 -7.17871 0.23
NP_442340.1_3 Reverse -98 -117 -7.27704 0.23
NP_440868.1_4 Forward -361 -349 19.9018 0.00963
NP_440868.1_4 Reverse -344 -356 9.77374 0.043
NP_442499.1_3 Forward -358 -340 4.24738 0.289
NP_440905.1_1 Forward -258 -240 6.31233 0.229
NP_440036.1_10 Reverse -203 -215 18.6235 0.282
NP_441084.1_6 Forward -55 -41 9.34412 0.287
NP_440696.1_3 Reverse -348 -366 11.7205 0.123
NP_442039.1_4 Forward -356 -349 15.1821 0.0124
NP_442039.1_4 Reverse -349 -356 15.1821 0.0124
NP_441811.1_4 Forward -224 -205 1.96607 0.29
NP_441811.1_8 Reverse -342 -356 10.226 0.22
NP_440825.1_6 Reverse -355 -374 7.37428 0.285
NP_442696.1_6 Forward -361 -342 -12.1936 0.251
NP_442837.1_3 Forward -356 -349 15.7721 0.0124
NP_442837.1_3 Reverse -349 -356 15.7721 0.0124
NP_442837.1_3 Reverse -111 -118 5.84064 0.272
NP_439994.1_3 Forward -358 -339 12.2431 0.153
NP_442053.1_1 Forward -357 -348 18.3876 0.0007
NP_442053.1_1 Reverse -348 -357 18.3876 0.0007
NP_440505.1_3 Forward -359 -349 15.9097 0.00857
NP_440505.1_3 Reverse -346 -356 7.84651 0.147
NP_441203.1_1 Forward -356 -337 -20.1584 0.297
NP_441203.1_1 Reverse -256 -275 -20.4534 0.297
NP_442532.1_7 Reverse -348 -362 3.53951 0.195
NP_440914.1_1 Reverse -348 -358 8.6151 0.186
NP_440914.1_1 Forward -357 -347 8.51751 0.186
NP_441011.1_8 Reverse -349 -358 16.9127 0.00602
NP_441011.1_8 Forward -356 -347 14.356 0.0249
NP_442533.1_6 Forward -357 -348 17.2076 0.00137
NP_442533.1_6 Reverse -348 -357 17.2076 0.00137
NP_442533.1_6 Forward -53 -44 4.62128 0.179
NP_442533.1_6 Forward -255 -246 3.04799 0.228
NP_442533.1_6 Reverse -210 -219 1.76968 0.289
NP_442533.1_6 Reverse -376 -385 1.37636 0.3
NP_442232.1_3 Reverse -340 -359 5.50599 0.0823
NP_442232.1_3 Reverse -202 -221 -9.93197 0.264
NP_441482.1_7 Forward -363 -349 -2.65535 0.0979
NP_441482.1_7 Reverse -342 -356 -8.75187 0.193
NP_441482.1_7 Reverse -301 -315 -11.8985 0.286
NP_439944.1_9 Forward -356 -346 17.4829 0.00423
NP_440816.1_7 Reverse -344 -363 11.4058 0.218
NP_441527.1_4 Forward -31 -12 -13.0351 0.298
NP_441527.1_4 Forward -32 -13 -13.1306 0.298
NP_440115.1_6 Reverse -345 -355 19.2529 0.0106
NP_440115.1_6 Forward -360 -350 6.66654 0.172
NP_440608.1_6 Forward -356 -337 5.60352 0.242
NP_441602.1_4 Forward -368 -349 16.6174 0.235
NP_441106.1_1 Forward -358 -349 18.191 0.0028
NP_441106.1_1 Reverse -347 -356 9.73449 0.0311
NP_442306.1_10 Forward -362 -343 -19.5684 0.199
NP_442306.1_10 Reverse -343 -362 -20.2567 0.202
NP_441286.1_1 Forward -358 -346 14.6903 0.00418
NP_441286.1_1 Reverse -347 -359 -3.40261 0.145
NP_440670.1_8 Forward -357 -348 18.3876 0.000699
NP_440670.1_8 Reverse -348 -357 18.3876 0.000699
NP_440670.1_8 Forward -264 -255 5.11294 0.171
NP_440886.1_4 Forward -117 -98 15.1424 0.225
NP_440886.1_7 Forward -358 -348 17.7774 0.0011
NP_440886.1_7 Reverse -347 -357 8.04271 0.0805
NP_442614.1_2 Forward -357 -343 18.7808 0.0465
NP_442072.1_9 Reverse -347 -365 -13.7472 0.121
NP_441753.1_10 Reverse -160 -179 2.65439 0.228
NP_442022.1_4 Reverse -381 -400 6.09597 0.273
NP_442022.1_4 Reverse -357 -376 6.09597 0.273
NP_440907.2_8 Forward -356 -346 19.449 0.00351
NP_440907.2_8 Reverse -349 -359 7.94438 0.117
NP_441021.1_8 Forward -362 -344 1.49411 0.269
NP_442459.1_9 Forward -129 -110 21.9273 0.038
NP_441463.1_3 Reverse -224 -243 -0.0988766 0.132
NP_441463.1_3 Forward -367 -348 -6.09707 0.239
NP_441463.1_3 Reverse -203 -222 -9.63698 0.282
NP_441463.1_5 Reverse -347 -361 13.6676 0.188
NP_440501.1_2 Reverse -191 -210 9.53756 0.228
NP_441626.1_2 Forward -356 -349 15.7721 0.0124
NP_441626.1_2 Reverse -349 -356 15.7721 0.0124
NP_442365.1_5 Forward -263 -244 6.88262 0.268
NP_442365.1_7 Reverse -344 -363 -2.95047 0.208
NP_442615.1_1 Reverse -339 -357 10.9339 0.0191
NP_440387.1_1 Forward -357 -341 6.54838 0.0282
NP_440387.1_1 Reverse -348 -364 -2.00642 0.145
NP_440387.1_1 Forward -278 -262 -5.84132 0.254
NP_440855.1_1 Reverse -38 -57 0.196116 0.244
NP_440855.1_5 Forward -258 -239 3.73524 0.287
NP_441431.1_2 Forward -360 -346 16.9119 0.0308
NP_441431.1_2 Reverse -345 -359 9.83206 0.176
NP_441488.1_7 Reverse -204 -223 11.0125 0.113
NP_441488.1_7 Reverse -342 -361 8.45592 0.121
NP_440634.1_1 Forward -359 -340 16.7157 0.223
NP_440814.1_8 Forward -110 -91 -1.27885 0.297
NP_440114.1_10 Reverse -348 -362 13.8643 0.0481
NP_440114.1_10 Forward -357 -343 5.80112 0.292
NP_440287.1_6 Reverse -208 -227 4.71934 0.196
NP_440287.1_6 Reverse -346 -365 2.0644 0.254
NP_441720.1_6 Reverse -350 -369 11.2092 0.25
NP_440293.1_3 Reverse -273 -292 -5.50708 0.279
NP_440766.1_4 Reverse -344 -358 7.86607 0.0871
NP_440766.1_5 Forward -111 -99 15.2951 0.193
NP_439988.1_3 Reverse -242 -256 20.1574 0.111
NP_439988.1_7 Forward -358 -344 14.9452 0.292
NP_441237.1_9 Forward -356 -346 17.2863 0.00348
NP_442930.1_1 Forward -16 -6 11.091 0.26
NP_439910.1_2 Forward -365 -348 -13.3342 0.162
NP_442867.1_3 Reverse -4 -23 7.07928 0.193
NP_440457.1_1 Reverse -344 -356 9.38042 0.0927
NP_440457.1_1 Forward -268 -256 3.38223 0.196
NP_440457.1_1 Forward -361 -349 1.21895 0.244
NP_440798.1_2 Forward -375 -361 15.8302 0.235
NP_440798.1_2 Forward -250 -236 15.2402 0.24
NP_440798.1_6 Reverse -349 -362 4.8375 0.143
NP_440798.1_6 Forward -356 -343 0.805932 0.248
NP_442680.1_5 Forward -110 -91 0.169919 0.268
NP_440142.1_2 Reverse -93 -107 18.4858 0.274
NP_441332.1_6 Forward -256 -246 11.9372 0.239
NP_441332.1_6 Forward -373 -363 11.6467 0.254
NP_441332.1_6 Forward -350 -340 10.6786 0.294
NP_440473.1_9 Reverse -244 -263 -7.17871 0.236
NP_442509.1_9 Forward -357 -347 17.3841 0.00128
NP_442509.1_9 Reverse -348 -358 16.2041 0.00739
NP_442936.1_10 Forward -20 -6 7.92401 0.27
NP_442514.1_10 Forward -277 -258 7.47261 0.258
NP_440554.1_4 Reverse -349 -359 16.4996 0.0189
NP_440554.1_4 Forward -356 -346 6.27322 0.123
NP_441885.1_5 Reverse -348 -358 11.4848 0.00668
NP_441885.1_5 Forward -357 -347 11.3864 0.00668
NP_442341.1_7 Forward -358 -344 13.3726 0.0355
NP_442341.1_7 Forward -265 -251 5.80112 0.145
NP_442341.1_9 Forward -359 -345 11.897 0.118
NP_441756.1_5 Reverse -104 -123 1.27776 0.217
NP_441756.1_5 Forward -125 -106 -1.67217 0.262
NP_442395.2_4 Forward -358 -339 8.75009 0.121
NP_440423.1_6 Reverse -340 -359 -13.0786 0.21
NP_443000.1_7 Forward -359 -349 11.5831 0.0344
NP_443000.1_7 Reverse -346 -356 2.14332 0.226
NP_440507.2_3 Reverse -339 -358 8.65176 0.247
NP_443059.1_8 Reverse -109 -128 15.2408 0.233
NP_440275.1_3 Reverse -346 -356 19.5479 0.00756
NP_440275.1_3 Forward -359 -349 15.418 0.0178
NP_440091.1_1 Forward -361 -349 8.29878 0.0653
NP_440091.1_1 Forward -223 -211 -0.846001 0.293
NP_440679.1_10 Forward -364 -345 -20.3551 0.284
NP_443010.1_10 Forward -360 -343 7.60248 0.167
NP_442451.1_2 Forward -365 -346 5.99764 0.119
NP_442451.1_2 Forward -113 -94 -6.68705 0.232
NP_440175.1_7 Reverse -354 -372 12.974 0.198
NP_440149.1_8 Reverse -348 -367 -1.7705 0.162
NP_441105.1_3 Reverse -337 -356 -7.08038 0.245
NP_442373.1_1 Reverse -292 -311 7.17762 0.128
NP_440216.1_1 Reverse -348 -362 16.4209 0.00307
NP_440216.1_1 Forward -357 -343 -2.16369 0.0482
NP_440216.1_1 Reverse -255 -269 -5.11362 0.121
NP_440216.1_1 Reverse -112 -126 -12.3901 0.264
NP_440216.1_9 Forward -326 -317 5.3096 0.298
NP_440172.1_1 Forward -357 -347 16.303 0.00854
NP_440172.1_1 Reverse -348 -358 8.73149 0.0586
NP_442015.1_10 Forward -361 -348 12.114 0.0372
NP_442015.1_10 Reverse -344 -357 3.26421 0.184
NP_441226.1_7 Forward -356 -349 14.4934 0.0123
NP_441226.1_7 Reverse -349 -356 14.4934 0.0123
NP_441757.1_6 Reverse -377 -396 17.109 0.0577
NP_441111.1_7 Forward -356 -348 18.7023 0.00294
NP_441111.1_7 Reverse -349 -357 18.7023 0.00294
NP_441766.1_2 Forward -357 -348 17.5026 0.00297
NP_441766.1_2 Reverse -348 -357 17.5026 0.00297
NP_440416.1_9 Reverse -312 -331 -17.4051 0.239
NP_440416.1_9 Reverse -227 -246 -17.8968 0.248
NP_440416.1_9 Reverse -105 -124 -18.4868 0.259
NP_443052.1_9 Reverse -108 -127 -5.9004 0.274
NP_442403.1_8 Reverse -309 -328 -2.95047 0.294
NP_440591.1_9 Reverse -341 -359 5.72234 0.237
NP_442154.1_1 Reverse -355 -373 -16.5005 0.241
NP_440261.1_5 Forward -356 -343 25.6837 0.00402
NP_440261.1_5 Reverse -349 -362 -4.30728 0.145
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TCTCCGCCAGTACACAGGCCTGTCCTGCCCCCAACACAAAGCCGGCGATCGCCCCGAACCAGATTAAGCGCCGCCCATAGAAAGTACGATAGGGCTGACTCATGGTGACCTGTACTTGGCTAGGCCGTTGACGCAGGGCAATCTGCCCCATGCCCCAACCAAACACGGTGCCGAGGAGGGCAGTCATCACCCCACTCAAGACAATAACACGATAATTCATAGGACTAAGGCCTCCTGGTCTGACAATGGAACAATACACAGTTCATGCTTAGCTCAGCCGGCGGGATCCAGGGGCAGAAATAGCCCACAAATAAGGGCTTATAAGGACTTACCAGCACTTAAAGCAAGGCCATGGTTGTCGATAGTATATTAAAGGTAAGGGAAAAATAATTTCCCCCCT

CDS

GTGATTATCCTAGTCAAAAATCCACTTTTTATGAGCAATACCAGCAATTTTCGTCAGATCATGGCGGAGGCAAAAGGCCAAAGTCTGATCGGGCCAAACGTGATCAAAAACGCCCTCCCCTATCTTGGCGGAGGCTTGGTGCTGACAGCGGCGGGAACCTTTGGTGGTCTCAGCGTCATGCAGGGCAATCCCGGTCTATTCATGACCACCTTTTGGGTCGCTTTAATCGGTAATTTTATTCTCTTTTTTGTCGCCATGCGGGTGGCGCAAAGTGGCAATAACGCAACGGCTTTGCCCTTGCTAACCCTGTATAGTCTGCTATCTGGTTATACCCTGAGTGGCATTATTTACCTGGCCCTGCAAACCAGTGGAGTGGGTATCCAAGGCATTGGTGTGGCGGCCCTGGGCTGTGGTGTAACTTTTGTGGTGGCCCGTAGTATTGGCTCCAATTTATCGGAAGAAGATGGCATTGCCCTGAGCAAAACCGTCAGCTTAGCCTTGATTGGACTAGTGGTGGTGATGCTTCTCCAAGTGGTGCTCGGCTTTTTTGGGGTCATTACCCCTACCTTTTTGGAAGTGGCCATTTCTGGCTTCGGGGTGTTGCTATTTGCCGGCGTGTCGGTGGTGGACTTTTTTGTTCTCCCCCGCACCTACCGGGATGATCAATATTTGGCTGCATCCCTGTCCATGTATTTGACCTATATCAACCTGTTTATCTTCATTCTGCGTCTACTGATTGCCCTCAACGGTCGAGACTAA

Protein

MIILVKNPLFMSNTSNFRQIMAEAKGQSLIGPNVIKNALPYLGGGLVLTAAGTFGGLSVMQGNPGLFMTTFWVALIGNFILFFVAMRVAQSGNNATALPLLTLYSLLSGYTLSGIIYLALQTSGVGIQGIGVAALGCGVTFVVARSIGSNLSEEDGIALSKTVSLALIGLVVVMLLQVVLGFFGVITPTFLEVAISGFGVLLFAGVSVVDFFVLPRTYRDDQYLAASLSMYLTYINLFIFILRLLIALNGRD