Your browser is old and dusty. Try Google Chrome!

Details for sll1142

ORF sll1142
Accession NP_440826.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -330 -316 2.75286 0.172
NP_440795.1_7 Forward -330 -323 14.6904 0.0123
NP_440795.1_7 Reverse -323 -330 14.6904 0.0123
NP_441418.1_6 Forward -82 -63 -20.8467 0.129
NP_441418.1_6 Reverse -322 -341 -28.3199 0.204
NP_440897.1_6 Forward -82 -63 -4.52452 0.28
NP_441453.1_4 Reverse -322 -330 16.539 0.00633
NP_441453.1_4 Forward -331 -323 16.539 0.00633
NP_441623.1_1 Reverse -282 -300 -0.177514 0.228
NP_442151.1_6 Reverse -322 -336 17.3058 0.0111
NP_442151.1_6 Forward -331 -317 13.7659 0.0457
NP_442151.1_6 Forward -82 -68 11.0127 0.109
NP_441818.1_1 Forward -330 -319 9.59626 0.232
NP_441818.1_9 Reverse -193 -212 5.30933 0.153
NP_441818.1_9 Forward -82 -63 -10.7186 0.298
NP_440226.1_1 Forward -331 -312 6.29264 0.132
NP_442655.1_1 Forward -87 -68 2.26107 0.238
NP_442173.1_1 Forward -330 -322 15.4574 0.00633
NP_442173.1_1 Reverse -323 -331 15.4574 0.00633
NP_442752.1_4 Forward -331 -324 13.8055 0.0199
NP_442752.1_4 Reverse -322 -329 13.8055 0.0199
NP_442752.1_4 Reverse -115 -122 9.47889 0.109
NP_442752.1_4 Forward -107 -100 5.84064 0.166
NP_443027.1_4 Reverse -320 -330 16.2046 0.0437
NP_443027.1_4 Forward -333 -323 7.25653 0.24
NP_441812.1_3 Forward -332 -318 10.9143 0.215
NP_442975.1_10 Forward -335 -321 19.3701 0.00397
NP_442975.1_10 Reverse -318 -332 12.782 0.0459
NP_440784.1_7 Forward -330 -323 15.9687 0.0123
NP_440784.1_7 Reverse -323 -330 15.9687 0.0123
NP_442861.1_4 Reverse -38 -57 9.04509 0.162
NP_441250.1_3 Forward -189 -170 2.85105 0.267
NP_440061.1_9 Forward -163 -149 7.17714 0.216
NP_440061.1_9 Reverse -366 -380 6.88214 0.228
NP_441054.1_2 Reverse -242 -261 11.2092 0.271
NP_441054.1_4 Reverse -312 -330 -2.63579 0.243
NP_441145.1_1 Reverse -357 -376 5.211 0.254
NP_442062.1_8 Reverse -322 -332 10.3048 0.0493
NP_442062.1_8 Forward -331 -321 10.3048 0.0493
NP_442062.1_8 Forward -377 -367 3.91327 0.243
NP_440761.1_4 Reverse -317 -336 -3.3438 0.132
NP_440761.1_4 Forward -336 -317 -13.2752 0.257
NP_441900.1_2 Reverse -301 -319 -4.60312 0.288
NP_440304.1_4 Reverse -320 -330 19.9412 0.00364
NP_440304.1_4 Forward -333 -323 10.8948 0.051
NP_440304.1_4 Reverse -191 -201 3.61828 0.295
NP_442242.1_4 Forward -330 -323 14.3954 0.0124
NP_442242.1_4 Reverse -323 -330 14.3954 0.0124
NP_440044.1_8 Reverse -323 -342 13.3725 0.0351
NP_442207.1_4 Reverse -379 -398 5.89931 0.285
NP_441620.1_3 Reverse -315 -334 13.4708 0.248
NP_441208.1_9 Forward -334 -320 13.7659 0.103
NP_442196.1_10 Reverse -320 -339 11.7008 0.224
NP_440370.1_10 Forward -340 -321 6.78429 0.283
NP_440132.1_1 Reverse -191 -209 8.18062 0.28
NP_442110.1_7 Reverse -322 -336 2.85119 0.222
NP_442110.1_7 Forward -331 -317 2.16287 0.222
NP_441082.1_10 Reverse -147 -160 10.934 0.236
NP_441925.1_4 Forward -168 -149 -5.99948 0.185
NP_440769.1_7 Forward -86 -67 1.57275 0.297
NP_440856.1_4 Forward -20 -1 -2.16383 0.209
NP_441083.1_5 Forward -331 -321 11.2881 0.0159
NP_441083.1_5 Reverse -322 -332 11.2881 0.0159
NP_442827.1_8 Reverse -314 -333 0.883656 0.194
NP_441738.1_2 Forward -329 -322 15.28 0.0102
NP_441738.1_2 Reverse -324 -331 15.28 0.0102
NP_441738.1_2 Reverse -100 -107 8.20023 0.181
NP_441558.1_5 Reverse -320 -339 11.3075 0.0828
NP_440209.1_1 Reverse -322 -330 18.1123 0.00295
NP_440209.1_1 Forward -331 -323 18.1123 0.00295
NP_442889.1_8 Reverse -319 -333 9.53707 0.097
NP_442889.1_8 Forward -334 -320 7.27547 0.156
NP_440447.1_6 Forward -339 -321 6.11567 0.145
NP_441713.1_1 Forward -337 -318 -6.1954 0.118
NP_441713.1_1 Reverse -316 -335 -14.5535 0.259
NP_441770.1_4 Reverse -297 -316 -5.01543 0.204
NP_440178.1_7 Forward -332 -313 -4.81876 0.0583
NP_442570.1_3 Forward -84 -65 2.16274 0.189
NP_439953.1_2 Forward -34 -16 10.9339 0.266
NP_441716.1_1 Forward -82 -68 3.93283 0.259
NP_441716.1_1 Reverse -368 -382 2.94952 0.284
NP_442111.1_4 Reverse -321 -335 8.65272 0.0709
NP_441624.1_6 Forward -216 -197 14.5516 0.221
NP_441533.1_4 Forward -190 -173 17.3362 0.202
NP_440906.1_5 Forward -330 -323 15.8704 0.0124
NP_440906.1_5 Reverse -323 -330 15.8704 0.0124
NP_440747.1_10 Forward -334 -322 5.54551 0.0128
NP_440747.1_10 Reverse -319 -331 -1.92764 0.0192
NP_440747.1_10 Forward -380 -368 -2.71429 0.0639
NP_440747.1_10 Forward -85 -73 -12.4491 0.282
NP_441486.1_1 Reverse -319 -333 6.19444 0.0344
NP_441486.1_1 Forward -334 -320 4.03116 0.0508
NP_442634.1_4 Forward -333 -319 7.07942 0.0479
NP_442634.1_4 Reverse -320 -334 -1.8687 0.149
NP_440842.1_10 Reverse -271 -285 3.8345 0.254
NP_440842.1_10 Forward -285 -271 2.35953 0.274
NP_440057.1_1 Reverse -368 -387 9.24257 0.269
NP_441012.1_4 Reverse -69 -82 14.1789 0.207
NP_443018.1_3 Forward -330 -323 14.8871 0.0123
NP_443018.1_3 Reverse -323 -330 14.8871 0.0123
NP_441316.1_7 Reverse -320 -335 2.04485 0.156
NP_441634.1_8 Forward -379 -365 1.86788 0.178
NP_441634.1_8 Reverse -150 -164 -3.93365 0.295
NP_440376.1_1 Forward -331 -322 19.4693 0.000692
NP_440376.1_1 Reverse -322 -331 19.4693 0.000692
NP_440376.1_1 Reverse -350 -359 7.47288 0.0751
NP_440376.1_1 Reverse -193 -202 0.393051 0.279
NP_441857.1_5 Forward -338 -320 8.86894 0.185
NP_441588.1_4 Reverse -324 -334 16.2046 0.0369
NP_441588.1_4 Forward -329 -319 6.66654 0.185
NP_442687.1_7 Forward -332 -322 9.02648 0.0994
NP_442687.1_7 Reverse -321 -331 9.02648 0.0994
NP_442687.1_7 Reverse -72 -82 6.46988 0.165
NP_442687.1_7 Forward -108 -98 3.71661 0.292
NP_442485.1_2 Forward -234 -215 8.45592 0.288
NP_441846.1_10 Forward -78 -59 -13.4719 0.206
NP_441846.1_10 Reverse -192 -211 -23.1083 0.277
NP_441013.1_2 Reverse -104 -122 -4.50408 0.299
NP_441422.1_7 Reverse -297 -314 -5.66436 0.247
NP_441950.1_7 Reverse -202 -221 -8.85033 0.287
NP_442296.1_9 Forward -376 -357 -4.72043 0.28
NP_441763.1_10 Reverse -311 -330 17.5015 0.0777
NP_442658.1_1 Reverse -320 -330 13.0576 0.04
NP_442658.1_1 Forward -333 -323 13.0576 0.04
NP_441855.2_4 Forward -320 -301 10.0051 0.267
NP_442782.1_2 Reverse -194 -208 0.88457 0.282
NP_442205.1_9 Reverse -316 -332 6.84337 0.111
NP_442205.1_9 Reverse -379 -395 -3.8747 0.297
NP_441414.1_9 Forward -331 -312 -2.45882 0.117
NP_441414.1_9 Reverse -350 -369 -5.99873 0.185
NP_440720.1_1 Forward -342 -323 6.58763 0.195
NP_442321.1_1 Forward -84 -65 -0.39387 0.171
NP_441958.1_5 Forward -332 -322 21.2195 0.000805
NP_441958.1_5 Reverse -321 -331 21.2195 0.000805
NP_441958.1_5 Forward -108 -98 -2.18325 0.267
NP_441958.1_5 Reverse -192 -202 -2.28158 0.27
NP_441162.1_3 Reverse -99 -118 18.7807 0.0626
NP_439990.1_5 Forward -336 -323 16.3422 0.0382
NP_439990.1_5 Reverse -317 -330 12.999 0.103
NP_441580.1_6 Forward -342 -323 4.32602 0.117
NP_441580.1_6 Reverse -311 -330 -8.752 0.271
NP_440153.1_8 Forward -202 -189 1.9859 0.22
NP_443055.1_3 Reverse -313 -332 15.8971 0.0848
NP_440993.1_2 Forward -222 -206 3.50012 0.258
NP_440993.1_2 Forward -207 -191 1.73016 0.279
NP_441099.1_5 Reverse -312 -331 -2.55715 0.124
NP_441099.1_5 Forward -341 -322 -11.6036 0.287
NP_442002.1_1 Reverse -376 -394 -10.3056 0.292
NP_442002.1_9 Forward -299 -292 11.1505 0.185
NP_440809.1_9 Forward -340 -322 -7.55234 0.225
NP_440475.1_1 Forward -340 -321 17.8792 0.0906
NP_441294.1_7 Forward -335 -321 13.7621 0.0568
NP_441294.1_7 Forward -165 -151 10.4025 0.191
NP_440147.1_4 Forward -333 -320 12.3107 0.0326
NP_440147.1_4 Reverse -320 -333 3.16588 0.193
NP_441295.1_4 Forward -81 -62 -5.11376 0.293
NP_441550.1_8 Forward -333 -323 15.3192 0.0132
NP_441550.1_8 Reverse -320 -330 13.0576 0.0273
NP_441916.1_7 Forward -331 -321 18.9579 0.00144
NP_441916.1_7 Reverse -322 -332 18.9579 0.00144
NP_441916.1_7 Reverse -193 -203 2.92996 0.235
NP_441916.1_10 Forward -225 -206 5.11266 0.216
NP_441041.1_3 Forward -163 -145 18.2734 0.149
NP_441041.1_4 Reverse -322 -341 9.73422 0.0309
NP_441041.1_4 Forward -331 -312 3.34271 0.0656
NP_441041.1_7 Forward -334 -322 17.7184 0.00706
NP_441041.1_7 Reverse -319 -331 9.65268 0.108
NP_442396.1_5 Reverse -202 -215 5.13249 0.3
NP_443063.1_7 Forward -83 -67 7.72835 0.276
NP_441725.1_5 Forward -330 -320 11.1898 0.0247
NP_441725.1_5 Reverse -323 -333 1.94665 0.115
NP_441725.1_5 Forward -81 -71 -0.511621 0.26
NP_439966.1_7 Reverse -320 -330 14.8275 0.0177
NP_439966.1_7 Forward -333 -323 6.27276 0.185
NP_442941.1_3 Forward -330 -320 19.9412 0.00262
NP_442941.1_3 Reverse -323 -333 11.0914 0.0116
NP_440289.1_2 Reverse -319 -332 6.60746 0.0591
NP_440289.1_2 Forward -334 -321 -2.144 0.251
NP_440260.1_8 Reverse -196 -214 1.39578 0.187
NP_441514.1_1 Reverse -173 -183 14.6315 0.274
NP_442281.1_1 Forward -336 -322 9.43874 0.0703
NP_442281.1_1 Reverse -317 -331 8.16044 0.0845
NP_442281.1_1 Reverse -68 -82 5.01387 0.172
NP_442281.1_1 Forward -207 -193 4.32555 0.199
NP_442281.1_1 Forward -87 -73 2.16228 0.276
NP_441334.1_7 Reverse -320 -339 -20.1584 0.275
NP_440647.1_9 Forward -333 -315 6.50899 0.219
NP_442500.1_9 Forward -326 -307 19.2723 0.158
NP_441087.1_6 Reverse -295 -313 1.00172 0.258
NP_441556.1_4 Reverse -233 -252 17.0428 0.116
NP_440453.1_5 Reverse -345 -363 6.70565 0.275
NP_441644.1_6 Forward -331 -321 19.0557 0.000803
NP_441644.1_6 Reverse -322 -332 19.0557 0.000803
NP_441644.1_6 Forward -82 -72 9.02601 0.0872
NP_441644.1_6 Forward -202 -192 8.63269 0.097
NP_441644.1_6 Reverse -73 -83 4.10949 0.249
NP_442215.1_2 Forward -84 -68 3.79511 0.0918
NP_442215.1_2 Forward -333 -317 -4.1697 0.228
NP_442029.1_1 Reverse -147 -166 -12.3902 0.247
NP_442029.1_6 Forward -87 -68 3.53937 0.282
NP_440253.1_2 Forward -359 -341 0.117479 0.196
NP_440929.1_8 Forward -331 -322 19.2726 0.000701
NP_440929.1_8 Reverse -322 -331 19.2726 0.000701
NP_442933.1_10 Forward -331 -322 17.601 0.00325
NP_442933.1_10 Reverse -322 -331 17.601 0.00325
NP_442933.1_10 Reverse -368 -377 8.1612 0.0885
NP_441751.2_8 Forward -330 -316 21.0424 0.00597
NP_441751.2_8 Reverse -323 -337 -4.62196 0.176
NP_442554.1_8 Forward -330 -320 16.9913 0.0065
NP_442554.1_8 Reverse -323 -333 16.4013 0.0065
NP_442554.1_8 Reverse -74 -84 4.50326 0.184
NP_442554.1_8 Forward -81 -71 2.92996 0.249
NP_442554.1_8 Reverse -243 -253 2.14332 0.281
NP_442167.1_6 Forward -197 -181 13.5292 0.228
NP_442075.1_10 Forward -331 -312 16.3224 0.282
NP_441762.1_7 Reverse -321 -333 0.432302 0.0747
NP_441762.1_7 Forward -332 -320 -6.84419 0.284
NP_442142.1_4 Reverse -319 -332 14.1783 0.0311
NP_442142.1_4 Forward -334 -321 10.9334 0.0646
NP_442142.1_4 Forward -380 -367 7.78685 0.13
NP_442142.1_4 Reverse -233 -246 6.0169 0.175
NP_442142.1_4 Reverse -70 -83 3.85363 0.243
NP_442142.1_4 Forward -158 -145 3.46031 0.255
NP_442292.1_1 Forward -330 -321 17.5026 0.00435
NP_442292.1_1 Reverse -323 -332 17.5026 0.00435
NP_442292.1_5 Forward -315 -296 1.0811 0.257
NP_443009.1_5 Reverse -321 -332 15.7911 0.0107
NP_443009.1_5 Forward -332 -321 15.7911 0.0107
NP_441371.1_3 Reverse -297 -315 10.7372 0.277
NP_441715.1_4 Forward -330 -320 14.238 0.0295
NP_441715.1_4 Reverse -323 -333 7.35486 0.108
NP_440015.1_9 Forward -331 -313 4.05072 0.164
NP_440183.1_1 Forward -330 -311 13.1758 0.239
NP_441198.1_8 Reverse -320 -330 13.2713 0.108
NP_441198.1_8 Forward -333 -323 12.783 0.116
NP_440379.1_5 Reverse -364 -383 -9.14533 0.259
NP_441468.1_1 Forward -330 -323 15.8704 0.0124
NP_441468.1_1 Reverse -323 -330 15.8704 0.0124
NP_441015.1_10 Forward -81 -62 -10.4236 0.284
NP_441673.1_1 Forward -331 -322 20.8459 0.000698
NP_441673.1_1 Reverse -322 -331 20.8459 0.000698
NP_441826.1_2 Reverse -67 -81 3.14618 0.115
NP_441826.1_2 Reverse -316 -330 -2.75368 0.275
NP_442490.1_9 Reverse -181 -200 -5.80207 0.273
NP_442868.1_6 Reverse -320 -330 1.06167 0.205
NP_442868.1_6 Forward -333 -323 0.963343 0.205
NP_442719.1_2 Forward -366 -348 -11.3879 0.291
NP_442227.1_2 Forward -122 -103 -3.63879 0.294
NP_442808.1_1 Reverse -321 -331 8.73102 0.0481
NP_442808.1_1 Forward -332 -322 8.73102 0.0481
NP_442808.1_1 Forward -209 -199 2.63453 0.26
NP_441101.1_10 Forward -381 -362 -1.37718 0.199
NP_440145.1_3 Forward -341 -322 15.7324 0.0108
NP_442113.1_6 Forward -373 -354 15.4374 0.296
NP_442050.1_5 Reverse -320 -330 18.0724 0.00365
NP_442050.1_5 Forward -333 -323 9.22267 0.193
NP_442342.1_9 Reverse -320 -336 4.77842 0.243
NP_440558.1_2 Reverse -15 -34 -6.68705 0.279
NP_441878.1_6 Forward -332 -322 10.5014 0.0176
NP_441878.1_6 Reverse -321 -331 10.5014 0.0176
NP_441878.1_6 Reverse -72 -82 10.4031 0.0176
NP_441878.1_6 Reverse -241 -251 0.766681 0.134
NP_441878.1_6 Forward -83 -73 0.668351 0.139
NP_441878.1_6 Forward -284 -274 -7.59145 0.245
NP_441878.1_6 Reverse -192 -202 -7.88644 0.278
NP_441036.1_8 Forward -332 -322 15.713 0.00724
NP_441036.1_8 Reverse -321 -331 15.713 0.00724
NP_441557.1_5 Forward -331 -322 19.9609 0.000699
NP_441557.1_5 Reverse -322 -331 19.9609 0.000699
NP_442066.2_4 Forward -331 -312 -9.24366 0.296
NP_442066.2_9 Reverse -318 -331 10.8357 0.154
NP_441433.1_8 Forward -81 -62 5.99764 0.174
NP_441433.1_8 Forward -324 -305 -1.37718 0.258
NP_441433.1_8 Reverse -4 -23 -3.73712 0.283
NP_442777.1_3 Forward -375 -357 4.54162 0.261
NP_441308.1_8 Reverse -320 -330 13.353 0.218
NP_440101.1_10 Reverse -379 -398 12.6841 0.135
NP_441458.1_8 Forward -186 -167 2.09991 0.295
NP_442183.1_1 Forward -331 -317 12.586 0.0562
NP_442183.1_9 Reverse -149 -159 9.7148 0.296
NP_442632.1_1 Forward -200 -181 10.7167 0.288
NP_442347.1_2 Reverse -369 -378 4.81794 0.257
NP_442347.1_2 Forward -330 -321 3.34298 0.284
NP_442347.1_2 Reverse -323 -332 3.34298 0.284
NP_442645.1_2 Reverse -117 -136 -14.9469 0.185
NP_442645.1_2 Reverse -314 -333 -16.9135 0.245
NP_441037.1_4 Forward -333 -323 15.0168 0.028
NP_441037.1_4 Reverse -320 -330 7.31769 0.237
NP_441037.1_4 Reverse -191 -201 6.53804 0.255
NP_441633.1_3 Forward -333 -320 -6.17557 0.238
NP_441633.1_3 Reverse -300 -313 -7.06055 0.288
NP_440136.1_2 Forward -330 -323 15.9687 0.0123
NP_440136.1_2 Reverse -323 -330 15.9687 0.0123
NP_442590.1_10 Reverse -146 -165 5.60432 0.258
NP_442998.1_5 Reverse -1 -11 11.3864 0.187
NP_442998.1_10 Forward -329 -322 15.5754 0.0102
NP_442998.1_10 Reverse -324 -331 15.5754 0.0102
NP_440899.1_2 Reverse -311 -330 9.83173 0.172
NP_440899.1_2 Reverse -62 -81 7.86512 0.21
NP_440899.1_2 Forward -213 -194 6.09517 0.269
NP_440899.1_5 Forward -369 -350 6.09597 0.242
NP_440299.1_1 Forward -335 -322 4.93527 0.193
NP_441799.1_1 Reverse -318 -332 14.4536 0.0236
NP_441799.1_1 Forward -335 -321 9.14375 0.0988
NP_441799.1_1 Forward -381 -367 4.32555 0.255
NP_441007.1_10 Reverse -317 -330 4.93583 0.182
NP_442333.2_5 Reverse -62 -81 -12.3902 0.249
NP_440256.1_1 Reverse -319 -338 7.57094 0.0257
NP_440256.1_1 Forward -334 -315 -9.24366 0.275
NP_441559.1_8 Forward -336 -322 1.86788 0.153
NP_441559.1_8 Reverse -297 -311 -5.01529 0.245
NP_441559.1_8 Reverse -317 -331 -7.57189 0.295
NP_440915.1_6 Forward -335 -321 13.4709 0.0187
NP_440915.1_6 Reverse -189 -203 4.32615 0.097
NP_440915.1_6 Reverse -318 -332 3.93283 0.1
NP_440749.1_4 Forward -31 -13 12.8014 0.181
NP_441199.1_6 Forward -335 -316 2.55606 0.198
NP_442993.1_1 Forward -331 -315 17.0698 0.00793
NP_442993.1_1 Reverse -322 -338 -9.47957 0.186
NP_442993.1_1 Reverse -193 -209 -12.3312 0.27
NP_440677.1_1 Forward -115 -96 12.5858 0.136
NP_442386.1_9 Forward -332 -323 6.39082 0.219
NP_442386.1_9 Reverse -321 -330 6.39082 0.219
NP_441750.1_1 Forward -82 -63 -13.0786 0.3
NP_441750.1_7 Reverse -152 -162 14.828 0.254
NP_441340.1_5 Forward -330 -323 15.6737 0.0124
NP_441340.1_5 Reverse -323 -330 15.6737 0.0124
NP_441947.1_4 Forward -342 -323 12.8808 0.226
NP_440586.1_1 Reverse -189 -208 -2.0655 0.25
NP_440586.1_8 Forward -330 -323 13.2151 0.026
NP_440586.1_8 Reverse -323 -330 13.2151 0.026
NP_440586.1_8 Forward -376 -369 10.7568 0.128
NP_442251.1_6 Forward -330 -323 15.2804 0.0124
NP_442251.1_6 Reverse -323 -330 15.2804 0.0124
NP_442251.1_8 Reverse -308 -322 18.7808 0.205
NP_441262.1_3 Reverse -322 -329 14.7888 0.0223
NP_441262.1_3 Forward -331 -324 14.7888 0.0223
NP_440027.1_3 Forward -134 -116 9.35981 0.184
NP_440027.1_3 Reverse -337 -355 7.09821 0.214
NP_443051.1_1 Reverse -321 -330 19.5676 0.00335
NP_443051.1_1 Forward -332 -323 19.5676 0.00335
NP_439937.1_9 Reverse -321 -338 -16.383 0.287
NP_439937.1_9 Forward -220 -203 -17.0714 0.291
NP_440439.1_1 Reverse -319 -332 8.77074 0.0497
NP_440439.1_1 Forward -334 -321 1.78924 0.143
NP_439943.1_7 Forward -330 -311 2.26107 0.298
NP_440372.1_2 Forward -330 -323 16.3621 0.0124
NP_440372.1_2 Reverse -323 -330 16.3621 0.0124
NP_440171.1_3 Forward -71 -52 2.94938 0.284
NP_440316.1_10 Forward -77 -67 5.68323 0.29
NP_441803.1_2 Reverse -317 -336 -0.590531 0.282
NP_439977.1_5 Forward -337 -318 -1.57384 0.256
NP_442384.1_10 Reverse -322 -335 8.08242 0.0692
NP_442384.1_10 Reverse -368 -381 7.59077 0.0784
NP_442384.1_10 Forward -331 -318 6.21414 0.108
NP_442384.1_10 Forward -24 -11 4.64084 0.151
NP_442384.1_10 Forward -82 -69 4.14919 0.167
NP_442384.1_10 Reverse -98 -111 1.29759 0.263
NP_442121.1_4 Forward -115 -96 -5.99873 0.299
NP_440476.1_2 Reverse -48 -67 12.6833 0.284
NP_442790.1_4 Reverse -184 -203 -0.0988766 0.0927
NP_442262.1_10 Forward -330 -323 14.1988 0.0123
NP_442262.1_10 Reverse -323 -330 14.1988 0.0123
NP_441689.1_5 Reverse -320 -330 17.8758 0.0158
NP_441689.1_5 Forward -333 -323 8.3377 0.132
NP_440344.1_10 Forward -338 -321 9.18362 0.00856
NP_440282.1_10 Reverse -63 -82 -8.752 0.263
NP_440531.1_6 Reverse -314 -333 6.39097 0.106
NP_440531.1_6 Reverse -65 -84 1.17943 0.179
NP_440531.1_6 Forward -385 -366 -5.21209 0.294
NP_440531.1_8 Reverse -247 -266 5.89931 0.249
NP_441335.1_8 Forward -246 -227 7.17762 0.281
NP_440826.1_5 Forward -314 -296 15.5767 0.231
NP_440826.1_9 Forward -390 -371 21.6314 0.101
NP_442750.1_3 Reverse -190 -209 -2.45882 0.184
NP_442529.1_9 Reverse -230 -249 15.0441 0.235
NP_440297.1_9 Forward -81 -71 9.32148 0.0917
NP_440297.1_9 Forward -330 -320 9.22315 0.0917
NP_440297.1_9 Reverse -323 -333 -0.216628 0.282
NP_440297.1_9 Forward -250 -240 -0.609952 0.292
NP_442280.1_10 Forward -92 -74 7.20763 0.268
NP_442280.1_10 Reverse -63 -81 6.42843 0.275
NP_441896.1_3 Forward -340 -321 -1.37718 0.258
NP_440990.1_10 Reverse -106 -125 14.9458 0.265
NP_440894.1_4 Reverse -68 -87 3.73603 0.219
NP_442067.1_4 Reverse -62 -81 3.6377 0.282
NP_440999.1_9 Forward -335 -321 1.76955 0.158
NP_440999.1_9 Reverse -318 -332 -1.18038 0.229
NP_440888.1_2 Forward -331 -317 13.5686 0.027
NP_440888.1_2 Reverse -322 -336 9.43874 0.127
NP_440888.1_2 Reverse -73 -87 5.1122 0.293
NP_440491.1_1 Reverse -347 -366 9.25599 0.218
NP_440052.1_5 Forward -342 -323 -0.590531 0.191
NP_442077.1_9 Reverse -278 -297 -4.42544 0.22
NP_441543.1_2 Forward -330 -321 15.9293 0.00518
NP_441543.1_2 Reverse -323 -332 15.9293 0.00518
NP_441543.1_2 Forward -376 -367 11.3078 0.0567
NP_442845.1_2 Reverse -316 -330 14.1593 0.0866
NP_442845.1_2 Forward -337 -323 9.2427 0.178
NP_442845.1_2 Forward -82 -68 4.12949 0.267
NP_441319.1_8 Forward -383 -365 6.80398 0.27
NP_440982.1_1 Forward -209 -190 4.32522 0.294
NP_441469.1_8 Forward -332 -323 6.5879 0.227
NP_441469.1_8 Reverse -321 -330 6.5879 0.227
NP_442315.1_1 Reverse -110 -128 20.0787 0.0484
NP_443064.1_6 Forward -331 -321 10.8217 0.13
NP_443064.1_6 Reverse -322 -332 10.8217 0.13
NP_442337.1_8 Reverse -180 -199 -1.96717 0.293
NP_442578.1_7 Forward -330 -323 14.5921 0.026
NP_442578.1_7 Reverse -323 -330 14.5921 0.026
NP_440710.1_1 Forward -291 -273 -9.32229 0.297
NP_441462.1_2 Forward -331 -321 20.2362 0.000805
NP_441462.1_2 Reverse -322 -332 20.2362 0.000805
NP_441462.1_2 Reverse -193 -203 6.27322 0.0713
NP_443062.1_1 Forward -331 -313 20.2468 0.0208
NP_443062.1_1 Reverse -322 -340 10.106 0.121
NP_443062.1_6 Reverse -360 -379 1.57275 0.272
NP_440519.1_8 Reverse -193 -209 4.68009 0.218
NP_440519.1_8 Forward -82 -66 3.59845 0.244
NP_442204.1_1 Forward -335 -324 8.90846 0.0852
NP_442204.1_1 Reverse -318 -329 0.0586712 0.284
NP_442487.1_5 Reverse -321 -340 6.68515 0.198
NP_440516.1_2 Reverse -316 -334 -1.94747 0.295
NP_440516.1_8 Forward -331 -322 16.9127 0.00442
NP_440516.1_8 Reverse -322 -331 16.9127 0.00442
NP_442428.1_5 Forward -330 -323 15.8704 0.0124
NP_442428.1_5 Reverse -323 -330 15.8704 0.0124
NP_441443.1_10 Forward -80 -62 8.6715 0.193
NP_442859.1_2 Forward -255 -236 2.0644 0.28
NP_440673.1_2 Forward -341 -322 17.5109 0.0505
NP_440673.1_3 Forward -329 -322 12.4288 0.0426
NP_440673.1_3 Reverse -324 -331 12.4288 0.0426
NP_440673.1_3 Forward -200 -193 8.8889 0.206
NP_440673.1_7 Reverse -311 -330 10.2259 0.111
NP_441052.1_2 Reverse -73 -83 11.4848 0.0285
NP_441052.1_2 Forward -331 -321 10.4031 0.0285
NP_441052.1_2 Reverse -322 -332 10.4031 0.0285
NP_441052.1_2 Reverse -368 -378 4.69992 0.149
NP_441052.1_2 Forward -82 -72 1.16001 0.25
NP_441052.1_2 Forward -377 -367 1.06167 0.252
NP_442219.1_8 Reverse -114 -133 12.7089 0.153
NP_442219.1_9 Forward -330 -321 8.25953 0.0681
NP_442219.1_9 Reverse -323 -332 8.25953 0.0681
NP_440436.1_4 Forward -330 -321 9.24241 0.0871
NP_440436.1_4 Reverse -323 -332 9.24241 0.0871
NP_440436.1_4 Forward -123 -114 5.40752 0.204
NP_442086.1_4 Forward -133 -114 15.0585 0.268
NP_440314.1_9 Reverse -323 -342 9.93088 0.0293
NP_440314.1_9 Forward -216 -197 -8.752 0.253
NP_440314.1_9 Forward -330 -311 -9.34199 0.264
NP_441719.1_4 Forward -330 -323 16.3621 0.0124
NP_441719.1_4 Reverse -323 -330 16.3621 0.0124
NP_441004.1_1 Forward -317 -298 -9.63698 0.21
NP_441004.1_1 Reverse -187 -206 -14.3569 0.267
NP_441004.1_4 Reverse -190 -200 15.418 0.154
NP_442366.1_3 Forward -332 -314 -4.50408 0.272
NP_442366.1_5 Forward -334 -324 14.8275 0.0375
NP_440296.1_10 Reverse -190 -209 -15.4385 0.298
NP_441115.1_4 Forward -332 -314 13.3914 0.0802
NP_442206.1_10 Reverse -193 -208 -0.315096 0.29
NP_443054.1_2 Reverse -320 -334 10.9143 0.0761
NP_443054.1_2 Forward -361 -347 7.9644 0.134
NP_441851.1_10 Forward -332 -322 8.53483 0.114
NP_441851.1_10 Reverse -321 -331 8.53483 0.114
NP_441851.1_10 Forward -108 -98 5.19158 0.221
NP_442208.1_5 Forward -313 -294 2.75272 0.248
NP_442515.1_1 Forward -332 -318 -4.7203 0.298
NP_441349.1_10 Reverse -312 -331 -2.85214 0.127
NP_441409.1_6 Forward -337 -318 0.58944 0.0648
NP_441409.1_6 Reverse -316 -335 -5.70374 0.11
NP_440432.1_9 Reverse -323 -338 -2.97003 0.177
NP_440474.1_8 Forward -330 -316 14.6503 0.0612
NP_440431.1_3 Reverse -321 -340 -12.3902 0.299
NP_442450.1_5 Reverse -320 -330 9.41981 0.115
NP_442450.1_5 Forward -333 -323 7.64985 0.13
NP_442006.1_2 Forward -76 -59 -15.6941 0.228
NP_441003.1_9 Reverse -64 -83 9.83255 0.213
NP_441570.1_1 Forward -331 -313 -5.58572 0.0758
NP_441570.1_1 Reverse -193 -211 -8.53565 0.115
NP_441570.1_1 Reverse -322 -340 -8.73231 0.12
NP_441078.1_4 Forward -331 -322 19.6659 0.0007
NP_441078.1_4 Reverse -322 -331 19.6659 0.0007
NP_441078.1_4 Forward -82 -73 -1.47524 0.266
NP_441078.1_4 Reverse -73 -82 -1.77023 0.266
NP_440526.1_3 Reverse -323 -334 1.92649 0.267
NP_440526.1_3 Forward -330 -319 1.82816 0.267
NP_441432.1_8 Reverse -321 -330 16.8143 0.00595
NP_441432.1_8 Forward -332 -323 16.8143 0.00595
NP_441432.1_8 Forward -83 -74 3.14632 0.259
NP_442320.1_4 Reverse -311 -330 21.4347 0.085
NP_442320.1_8 Forward -337 -323 -1.37704 0.0817
NP_441732.1_2 Forward -335 -319 -6.92296 0.0558
NP_441732.1_2 Reverse -318 -334 -16.6577 0.186
NP_441732.1_2 Forward -221 -205 -17.5427 0.27
NP_441030.1_6 Reverse -71 -90 13.5253 0.213
NP_442003.1_4 Forward -330 -311 9.63589 0.299
NP_440760.1_1 Forward -331 -312 -19.5684 0.219
NP_440760.1_1 Reverse -322 -341 -22.2233 0.252
NP_440760.1_1 Reverse -350 -369 -22.9117 0.274
NP_442797.1_1 Forward -210 -191 -6.78538 0.298
NP_440199.1_10 Reverse -319 -329 14.238 0.0861
NP_441945.1_10 Forward -252 -233 12.3892 0.216
NP_440913.1_1 Forward -84 -66 8.96727 0.181
NP_442727.1_1 Reverse -198 -212 11.0127 0.297
NP_442489.1_7 Forward -331 -322 20.1576 0.000695
NP_442489.1_7 Reverse -322 -331 20.1576 0.000695
NP_442489.1_7 Reverse -368 -377 5.21127 0.077
NP_442489.1_7 Forward -82 -73 -1.6719 0.235
NP_442489.1_7 Reverse -73 -82 -1.77023 0.247
NP_442079.1_7 Reverse -323 -342 6.68596 0.155
NP_440559.1_1 Reverse -323 -332 8.65285 0.0586
NP_440559.1_1 Forward -330 -321 8.65285 0.0586
NP_441659.2_8 Forward -331 -321 20.9245 0.000805
NP_441659.2_8 Reverse -322 -332 20.9245 0.000805
NP_441659.2_8 Forward -202 -192 2.43831 0.2
NP_442913.1_10 Forward -340 -321 -2.95047 0.195
NP_441040.1_2 Reverse -294 -313 -6.39206 0.181
NP_442346.1_5 Forward -332 -322 16.303 0.00248
NP_442346.1_5 Reverse -321 -331 16.303 0.00248
NP_442346.1_5 Reverse -72 -82 11.5831 0.0634
NP_442346.1_5 Forward -83 -73 11.3864 0.0681
NP_440352.1_5 Forward -309 -290 11.1957 0.267
NP_440545.1_3 Forward -335 -318 3.67709 0.0804
NP_441856.1_3 Forward -334 -315 0.196116 0.216
NP_441856.1_3 Reverse -319 -338 -0.983855 0.228
NP_441629.1_3 Forward -89 -70 -3.93454 0.29
NP_442551.1_4 Forward -84 -69 2.24151 0.245
NP_441833.1_4 Forward -330 -323 15.9687 0.0124
NP_441833.1_4 Reverse -323 -330 15.9687 0.0124
NP_442162.1_9 Forward -330 -323 16.2637 0.0124
NP_442162.1_9 Reverse -323 -330 16.2637 0.0124
NP_442796.1_9 Reverse -344 -363 14.9458 0.139
NP_440671.1_4 Reverse -316 -330 7.66941 0.21
NP_440671.1_4 Forward -337 -323 5.60446 0.279
NP_440224.1_1 Forward -342 -323 -0.590531 0.144
NP_442199.1_5 Reverse -234 -253 -2.26216 0.185
NP_442140.1_1 Forward -170 -151 16.7429 0.201
NP_442140.1_3 Reverse -323 -333 6.66654 0.159
NP_442723.1_1 Forward -131 -112 3.04693 0.28
NP_440875.1_9 Reverse -324 -334 7.69067 0.255
NP_440875.1_9 Forward -329 -319 7.59334 0.255
NP_441813.1_5 Reverse -320 -330 15.9097 0.01
NP_441813.1_5 Forward -333 -323 8.63316 0.0367
NP_441813.1_7 Forward -161 -147 10.0287 0.235
NP_440590.1_4 Reverse -323 -336 12.8023 0.013
NP_440590.1_4 Forward -330 -317 -3.71729 0.255
NP_440567.1_1 Reverse -323 -337 6.3911 0.0837
NP_440567.1_1 Forward -330 -316 3.63784 0.139
NP_442497.1_10 Forward -330 -321 17.601 0.00813
NP_442497.1_10 Reverse -323 -332 17.601 0.00813
NP_440821.1_4 Reverse -320 -330 11.0914 0.0146
NP_440821.1_4 Forward -333 -323 2.24165 0.131
NP_441239.1_9 Reverse -320 -332 12.1337 0.0494
NP_441239.1_9 Forward -333 -321 11.1504 0.0648
NP_441239.1_9 Forward -90 -78 5.84051 0.206
NP_441239.1_9 Forward -204 -192 4.46387 0.253
NP_441239.1_9 Forward -253 -241 3.87389 0.272
NP_441951.1_4 Reverse -187 -206 3.83436 0.273
NP_440706.1_1 Forward -335 -316 -4.32711 0.262
NP_440400.1_1 Forward -211 -192 -0.787962 0.285
NP_441892.1_1 Forward -340 -323 4.16874 0.115
NP_441892.1_1 Reverse -64 -81 1.31714 0.154
NP_441892.1_1 Reverse -313 -330 -0.452814 0.185
NP_441892.1_1 Forward -211 -194 -4.09106 0.255
NP_442193.1_1 Reverse -193 -211 8.37728 0.272
NP_442193.1_8 Reverse -116 -135 9.43841 0.294
NP_440219.1_1 Reverse -37 -56 12.4595 0.276
NP_442629.1_3 Reverse -144 -163 0.58944 0.294
NP_441874.1_1 Reverse -183 -197 15.1426 0.173
NP_441874.1_1 Forward -323 -309 10.521 0.261
NP_440546.1_4 Reverse -322 -332 13.5365 0.0459
NP_440546.1_4 Forward -331 -321 13.5365 0.0459
NP_443033.1_10 Forward -341 -327 18.5841 0.0951
NP_440462.1_6 Reverse -320 -330 16.893 0.00853
NP_440462.1_6 Forward -333 -323 10.5014 0.0396
NP_442340.1_3 Reverse -366 -385 -9.83364 0.275
NP_440868.1_4 Reverse -318 -330 8.20045 0.0602
NP_440868.1_4 Forward -335 -323 -0.846001 0.282
NP_442479.1_2 Forward -108 -89 12.5858 0.19
NP_440270.1_2 Forward -267 -248 8.94757 0.24
NP_441474.1_1 Forward -212 -193 -1.77127 0.264
NP_442402.1_4 Forward -173 -154 -8.26108 0.278
NP_442402.1_10 Reverse -305 -315 13.6475 0.2
NP_442402.1_10 Reverse -306 -316 13.0576 0.204
NP_442402.1_10 Reverse -62 -72 12.1726 0.222
NP_442460.1_3 Reverse -2 -21 13.3725 0.208
NP_441843.2_2 Forward -163 -144 14.0599 0.233
NP_442039.1_4 Forward -330 -323 15.1821 0.0124
NP_442039.1_4 Reverse -323 -330 15.1821 0.0124
NP_442039.1_7 Forward -318 -308 7.45319 0.276
NP_441811.1_1 Reverse -58 -77 5.30933 0.28
NP_441926.1_3 Forward -331 -315 16.5781 0.0428
NP_442837.1_3 Forward -330 -323 15.7721 0.0124
NP_442837.1_3 Reverse -323 -330 15.7721 0.0124
NP_440160.1_9 Reverse -322 -341 10.7175 0.231
NP_442053.1_1 Forward -331 -322 18.3876 0.0007
NP_442053.1_1 Reverse -322 -331 18.3876 0.0007
NP_440505.1_3 Reverse -320 -330 15.123 0.014
NP_440505.1_3 Forward -333 -323 8.04317 0.147
NP_442360.1_5 Reverse -10 -20 15.0247 0.172
NP_441959.1_5 Forward -370 -351 6.29264 0.26
NP_440914.1_1 Forward -331 -321 16.3248 0.00196
NP_440914.1_1 Reverse -322 -332 16.3248 0.00196
NP_441011.1_8 Forward -330 -321 16.6177 0.00602
NP_441011.1_8 Reverse -323 -332 16.6177 0.00602
NP_442101.1_10 Forward -339 -320 -9.14533 0.245
NP_442533.1_6 Forward -331 -322 17.2076 0.00137
NP_442533.1_6 Reverse -322 -331 17.2076 0.00137
NP_442533.1_6 Forward -82 -73 13.9627 0.0155
NP_442533.1_6 Reverse -73 -82 6.68623 0.105
NP_442533.1_6 Forward -377 -368 5.21127 0.15
NP_442533.1_6 Reverse -242 -251 4.22796 0.186
NP_442533.1_6 Forward -251 -242 3.7363 0.204
NP_442533.1_6 Forward -359 -350 2.35967 0.259
NP_442533.1_6 Forward -202 -193 2.16301 0.27
NP_442541.1_10 Forward -360 -346 8.45543 0.218
NP_442541.1_10 Reverse -73 -87 1.47397 0.286
NP_442232.1_3 Forward -316 -297 -12.8819 0.282
NP_442322.1_4 Forward -210 -193 -1.04349 0.226
NP_442322.1_4 Forward -211 -194 -9.69657 0.296
NP_443016.1_1 Forward -257 -238 -6.39206 0.258
NP_441482.1_7 Forward -337 -323 -10.3252 0.209
NP_441482.1_7 Reverse -316 -330 -10.9151 0.222
NP_439944.1_9 Forward -330 -320 17.6796 0.00347
NP_439944.1_9 Reverse -323 -333 9.12481 0.1
NP_441697.1_5 Reverse -36 -55 -10.2658 0.278
NP_441028.1_6 Reverse -306 -316 8.04271 0.217
NP_441028.1_6 Reverse -293 -303 6.37109 0.23
NP_441028.1_6 Reverse -307 -317 6.0761 0.232
NP_441028.1_6 Reverse -294 -304 4.10949 0.278
NP_441028.1_6 Forward -23 -13 3.51951 0.292
NP_440116.1_8 Reverse -323 -342 -3.44213 0.154
NP_440007.1_9 Reverse -318 -332 9.63603 0.17
NP_440007.1_9 Forward -335 -321 3.63784 0.268
NP_440007.1_9 Reverse -69 -83 2.45787 0.281
NP_441972.1_5 Reverse -323 -342 -9.83364 0.293
NP_441106.1_1 Reverse -321 -330 18.486 0.0028
NP_441106.1_1 Forward -332 -323 18.486 0.0028
NP_440429.1_2 Reverse -323 -342 8.84924 0.272
NP_439903.1_6 Reverse -319 -338 7.37347 0.157
NP_439903.1_6 Forward -334 -315 4.12856 0.202
NP_441286.1_1 Forward -332 -320 4.95553 0.027
NP_441286.1_1 Reverse -321 -333 -3.50094 0.145
NP_441286.1_1 Forward -83 -71 -5.36923 0.197
NP_442674.1_3 Reverse -65 -84 12.1917 0.174
NP_440670.1_8 Forward -331 -322 18.3876 0.000699
NP_440670.1_8 Reverse -322 -331 18.3876 0.000699
NP_442908.1_1 Reverse -202 -221 2.26107 0.277
NP_440886.1_4 Forward -101 -82 13.8641 0.271
NP_440886.1_7 Forward -332 -322 8.04271 0.0805
NP_440886.1_7 Reverse -321 -331 8.04271 0.0805
NP_440886.1_7 Forward -162 -152 5.78111 0.163
NP_442614.1_2 Forward -331 -317 7.07942 0.275
NP_442382.1_9 Reverse -298 -317 12.29 0.266
NP_441399.1_4 Forward -370 -351 23.6972 0.0125
NP_442072.1_9 Forward -332 -314 -11.8789 0.0799
NP_442072.1_9 Reverse -321 -339 -22.302 0.229
NP_440907.2_8 Reverse -323 -333 15.9091 0.0161
NP_440907.2_8 Forward -330 -320 9.51767 0.103
NP_440176.1_3 Forward -200 -186 13.1753 0.261
NP_440962.1_5 Reverse -39 -49 18.0729 0.248
NP_441626.1_2 Forward -330 -323 15.7721 0.0124
NP_441626.1_2 Reverse -323 -330 15.7721 0.0124
NP_442365.1_7 Forward -381 -362 -5.70374 0.277
NP_442794.1_1 Forward -335 -323 2.98891 0.286
NP_441401.1_2 Forward -186 -167 16.3224 0.144
NP_442615.1_1 Forward -340 -322 -1.16082 0.125
NP_440387.1_1 Forward -331 -315 6.64671 0.0282
NP_440387.1_1 Forward -377 -361 1.43517 0.104
NP_440387.1_1 Forward -283 -267 -5.448 0.232
NP_441431.1_2 Reverse -319 -333 5.80051 0.288
NP_441488.1_8 Forward -336 -322 9.93039 0.146
NP_441993.1_1 Forward -82 -63 9.84073 0.135
NP_442084.1_6 Reverse -307 -325 7.00065 0.221
NP_440814.1_4 Reverse -313 -332 -11.7019 0.228
NP_440467.1_8 Reverse -230 -249 10.0292 0.291
NP_440114.1_10 Forward -331 -317 16.9125 0.0141
NP_440114.1_10 Reverse -322 -336 8.45605 0.202
NP_440737.1_1 Reverse -358 -377 15.5357 0.0882
NP_440492.1_8 Reverse -230 -249 16.4199 0.21
NP_440287.1_6 Forward -340 -321 6.88262 0.16
NP_440293.1_10 Reverse -190 -209 -1.7705 0.271
NP_442743.1_8 Reverse -169 -188 7.8665 0.267
NP_442930.1_1 Forward -185 -175 12.1726 0.239
NP_439910.1_2 Reverse -314 -331 -12.0559 0.0788
NP_439910.1_2 Forward -339 -322 -22.184 0.215
NP_442867.1_8 Reverse -59 -78 8.55425 0.232
NP_442867.1_8 Forward -358 -339 4.42435 0.283
NP_440457.1_1 Reverse -189 -201 5.34885 0.141
NP_440457.1_1 Forward -111 -99 0.0389777 0.25
NP_440457.1_1 Reverse -318 -330 0.0389777 0.25
NP_442680.1_5 Forward -59 -40 6.32442 0.207
NP_440801.1_5 Forward -56 -42 18.4858 0.235
NP_440142.1_7 Reverse -323 -342 7.17762 0.259
NP_440473.1_1 Forward -380 -361 11.0646 0.283
NP_442509.1_5 Forward -206 -189 15.2794 0.199
NP_442509.1_9 Reverse -322 -332 8.04271 0.192
NP_442509.1_9 Forward -331 -321 8.04271 0.192
NP_442514.1_5 Forward -202 -183 -2.8529 0.222
NP_440554.1_4 Forward -330 -320 16.1063 0.0189
NP_440554.1_4 Reverse -323 -333 8.82982 0.0646
NP_441845.1_6 Reverse -310 -328 5.72234 0.179
NP_441885.1_5 Forward -331 -321 11.3864 0.00668
NP_441885.1_5 Reverse -322 -332 11.3864 0.00668
NP_440478.1_10 Reverse -366 -380 6.6861 0.288
NP_442341.1_7 Forward -83 -69 4.03116 0.204
NP_442341.1_7 Reverse -321 -335 2.06454 0.271
NP_442341.1_7 Forward -298 -284 1.96621 0.274
NP_442341.1_9 Forward -333 -319 15.7319 0.0433
NP_442341.1_9 Reverse -320 -334 14.3553 0.0695
NP_441756.1_5 Reverse -69 -88 -2.85214 0.283
NP_441173.1_9 Reverse -307 -315 11.3271 0.226
NP_441173.1_9 Forward -363 -355 9.85212 0.275
NP_443000.1_7 Reverse -320 -330 17.4829 0.00719
NP_443000.1_7 Forward -333 -323 10.6981 0.0345
NP_441842.1_10 Forward -338 -324 6.19444 0.297
NP_440275.1_3 Reverse -320 -330 9.12481 0.055
NP_440275.1_3 Forward -333 -323 9.02648 0.0563
NP_440275.1_3 Reverse -191 -201 6.27322 0.118
NP_440091.1_1 Reverse -318 -330 1.41561 0.197
NP_443010.1_10 Forward -334 -317 3.83376 0.25
NP_442451.1_2 Forward -227 -208 -10.522 0.274
NP_441122.1_1 Reverse -121 -136 3.91314 0.28
NP_440175.1_4 Reverse -71 -90 -5.31042 0.164
NP_441105.1_3 Forward -87 -68 2.0644 0.107
NP_440216.1_1 Reverse -322 -336 -1.67204 0.0355
NP_440216.1_1 Forward -331 -317 -1.77037 0.0383
NP_440216.1_1 Reverse -73 -87 -11.6035 0.203
NP_440172.1_1 Forward -331 -321 17.5813 0.00421
NP_440172.1_1 Reverse -322 -332 17.5813 0.00421
NP_442015.1_10 Reverse -69 -82 4.8375 0.159
NP_442015.1_10 Forward -335 -322 3.65753 0.178
NP_441226.1_7 Forward -330 -323 14.4934 0.0123
NP_441226.1_7 Reverse -323 -330 14.4934 0.0123
NP_441226.1_7 Forward -201 -194 8.59356 0.197
NP_441226.1_7 Reverse -282 -289 6.52862 0.253
NP_441111.1_7 Forward -330 -322 18.7023 0.00294
NP_441111.1_7 Reverse -323 -331 18.7023 0.00294
NP_442379.1_10 Reverse -315 -332 5.34871 0.132
NP_441766.1_2 Forward -331 -322 17.5026 0.00297
NP_441766.1_2 Reverse -322 -331 17.5026 0.00297
NP_440416.1_1 Reverse -322 -341 -11.5053 0.272
NP_440416.1_9 Forward -367 -348 -19.3717 0.274
NP_443052.1_9 Forward -165 -146 -3.04881 0.245
NP_443052.1_9 Forward -357 -338 -3.63879 0.251
NP_442154.1_1 Reverse -191 -209 -18.2704 0.279
NP_442226.1_8 Reverse -181 -191 14.828 0.256
NP_440261.1_5 Forward -330 -317 -3.02898 0.108
NP_440261.1_5 Reverse -323 -336 -12.3704 0.284
NP_440261.1_5 Forward -81 -68 -12.4687 0.297
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CGCCAAATTAATCACCGCATCCTGGCCATCAACGACCTTTTGCCAGTCCCCGCTTTTAGTGGCTTCATAGGCGATCGCCTTTAACTGGGGGAAACTACCGGGGGCAAATAACCGTTGGGCCTTAGACACACTACGCACCAGCAAAGTTAGCTCATGGCCCTGTTGATGTAGTAGAGGCACCAAAGAGCACCCCACAAAACCCGTCGCCCCAGTCAAAATAATTTTCATTAATGTACGTCTCCCACCACCAGCAGTAATGTGATTTTGACAATTGACAACCCTCCCCATCTTAGGGGGAACGGTCCTTAGTGACCAACTGGCCATGACCCTGGGGGGAGTAGGAGTAAGTTAAAATGAAAACCTGCATTGTGCTGTCAATGTTCCCCAGAGGATCTACCCA

CDS

ATGATTGAGATGAGAGTAGCTGGCATTGCCCTCGATGCGGTAAGTCGCAGTCCCATCGTATTGCTCAAGGATGGATCTGAACGGCGGGCATTACCCATTTATATCAGCCAAGACCAAGCTCGGTCGATTATCGGAGCCCTGGAAAATCAAAAGCCCACCCGTCCCCTCACCCATGACCTGATGGTCAATCTCCTCACCACCTGGGATGTGGACCTCAAAAAAATTATTATTCATTCCCTGCAGGATAATACCTTTTACGCTGTGCTCTGTTGTGCCCAGGGGGATCAAATTAGGGAAATTGACTGCCGCCCCAGTGATGCCATTTCCCTCGCGTTGCGGATGGACAGTCCCATTTGGGTGATGGAAGAAGTGTTGGCCGATGCTTCCATTCCCGTGGATCGAGATGCGGACGAAGAAGAAAGACAAGCTTTTCGGGATTTTCTCGACAATGTTAGCCCGGAAACCCTGATCAAACAGGCTCGCCTAAGTTCCGATAGCTTTGAGGCGGAATCCGATAGTTAG

Protein

MIEMRVAGIALDAVSRSPIVLLKDGSERRALPIYISQDQARSIIGALENQKPTRPLTHDLMVNLLTTWDVDLKKIIIHSLQDNTFYAVLCCAQGDQIREIDCRPSDAISLALRMDSPIWVMEEVLADASIPVDRDADEEERQAFRDFLDNVSPETLIKQARLSSDSFEAESDS