Your browser is old and dusty. Try Google Chrome!

Details for sll1131

ORF sll1131
Accession NP_440846.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -328 -342 -0.590395 0.234
NP_441480.1_8 Forward -343 -324 12.4875 0.275
NP_441453.1_4 Forward -208 -200 3.85433 0.284
NP_441453.1_7 Forward -203 -196 13.4121 0.23
NP_441818.1_9 Reverse -349 -368 -8.45701 0.277
NP_440226.1_1 Reverse -199 -218 4.22769 0.199
NP_441519.1_4 Reverse -200 -217 17.7384 0.129
NP_443002.1_5 Reverse -322 -340 11.6214 0.247
NP_443027.1_4 Forward -210 -200 8.4365 0.202
NP_439997.1_4 Forward -244 -225 6.68596 0.266
NP_441675.1_4 Forward -173 -154 7.27595 0.236
NP_441675.1_4 Forward -280 -261 4.42435 0.257
NP_440784.1_7 Forward -207 -200 8.59391 0.129
NP_440110.1_8 Forward -254 -235 10.8159 0.0878
NP_442062.1_3 Reverse -247 -266 -2.26216 0.269
NP_442062.1_8 Forward -208 -198 6.07655 0.138
NP_441859.1_3 Forward -218 -199 2.06362 0.267
NP_440304.1_4 Reverse -137 -147 2.24165 0.299
NP_442097.1_2 Reverse -146 -165 0.687771 0.259
NP_440011.1_1 Reverse -353 -372 15.8307 0.171
NP_440916.1_1 Reverse -86 -100 20.4524 0.0296
NP_442896.1_7 Reverse -103 -122 5.60432 0.1
NP_441434.1_1 Forward -266 -252 8.31942 0.259
NP_442601.1_7 Forward -337 -318 11.1109 0.271
NP_442111.1_3 Forward -97 -84 15.5315 0.196
NP_441163.1_4 Forward -304 -285 13.9854 0.278
NP_440747.1_10 Reverse -196 -208 -12.2524 0.254
NP_440470.1_5 Forward -280 -261 13.3207 0.158
NP_440470.1_5 Reverse -259 -278 12.5568 0.165
NP_440403.1_4 Forward -217 -198 -8.16202 0.251
NP_440842.1_10 Forward -131 -117 2.65453 0.274
NP_440842.1_10 Reverse -136 -150 2.35953 0.274
NP_441014.1_8 Forward -370 -351 -7.96535 0.282
NP_441014.1_10 Reverse -188 -207 3.53858 0.213
NP_442848.1_1 Forward -214 -200 -4.03198 0.279
NP_442485.1_3 Forward -210 -191 0.196116 0.247
NP_441846.1_10 Reverse -360 -379 -23.4033 0.285
NP_440642.1_10 Reverse -180 -194 5.99717 0.238
NP_442658.1_1 Reverse -197 -207 5.48612 0.265
NP_442161.1_7 Forward -381 -362 11.7008 0.0732
NP_442544.1_2 Forward -83 -69 -1.77037 0.287
NP_441414.1_6 Forward -255 -236 1.37609 0.227
NP_440800.1_7 Reverse -316 -330 10.6193 0.294
NP_441165.1_9 Reverse -250 -269 19.4681 0.249
NP_441127.1_1 Reverse -1 -15 11.2093 0.232
NP_440318.1_1 Reverse -189 -208 7.66927 0.2
NP_442486.1_4 Forward -145 -126 9.14423 0.264
NP_442690.1_1 Reverse -259 -278 0.58944 0.122
NP_442690.1_1 Forward -280 -261 -1.86883 0.13
NP_442690.1_1 Reverse -258 -277 -16.5201 0.289
NP_441099.1_5 Forward -138 -119 -11.6036 0.287
NP_442002.1_1 Forward -247 -229 -9.71562 0.283
NP_440475.1_5 Forward -190 -171 12.0942 0.109
NP_440147.1_4 Forward -332 -319 2.77255 0.202
NP_440147.1_4 Forward -210 -197 1.10092 0.239
NP_441550.1_8 Forward -210 -200 8.53436 0.123
NP_440983.1_5 Forward -369 -350 8.55425 0.151
NP_441514.1_6 Forward -186 -179 14.2971 0.248
NP_441678.1_9 Forward -198 -179 -3.3438 0.287
NP_442281.1_1 Reverse -323 -337 2.65393 0.26
NP_441079.1_7 Reverse -342 -361 -2.55791 0.22
NP_441079.1_7 Forward -267 -248 -5.1145 0.261
NP_001035871.2_7 Forward -297 -287 12.1731 0.272
NP_440437.1_1 Reverse -193 -212 1.17943 0.155
NP_442982.1_5 Forward -195 -176 -2.95047 0.289
NP_442068.1_4 Forward -369 -350 6.78348 0.23
NP_441644.1_6 Reverse -199 -209 3.51951 0.277
NP_441644.1_6 Reverse -328 -338 3.42118 0.282
NP_442215.1_2 Reverse -244 -260 0.255197 0.154
NP_442215.1_2 Reverse -117 -133 -6.03799 0.263
NP_442029.1_6 Reverse -316 -335 9.14423 0.193
NP_442933.1_10 Reverse -199 -208 10.6195 0.0484
NP_440891.1_8 Forward -282 -263 13.0204 0.294
NP_440430.1_5 Reverse -78 -97 16.2241 0.219
NP_442554.1_8 Reverse -200 -210 7.45319 0.092
NP_442554.1_8 Forward -336 -326 2.43831 0.272
NP_441762.1_7 Reverse -198 -210 -5.95921 0.258
NP_442142.1_4 Forward -211 -198 8.96682 0.106
NP_442292.1_1 Reverse -200 -209 -0.68859 0.268
NP_440919.1_7 Forward -277 -259 10.8497 0.171
NP_443009.1_5 Forward -209 -198 6.05637 0.177
NP_441715.1_4 Forward -207 -197 7.74818 0.108
NP_440620.1_4 Reverse -261 -275 13.9534 0.281
NP_440881.1_4 Forward -197 -178 2.55606 0.226
NP_441448.1_1 Reverse -197 -216 8.06259 0.21
NP_440379.1_5 Reverse -351 -370 -8.35868 0.252
NP_441468.1_1 Reverse -200 -207 4.26735 0.246
NP_441015.1_10 Reverse -356 -375 -10.0303 0.282
NP_441876.1_9 Reverse -233 -243 14.1392 0.267
NP_441876.1_9 Forward -87 -77 13.1559 0.267
NP_441826.1_2 Forward -214 -200 1.27789 0.157
NP_441826.1_9 Forward -282 -263 21.5729 0.141
NP_441330.1_1 Reverse -316 -335 -6.88371 0.175
NP_441637.1_9 Forward -72 -54 -3.02911 0.293
NP_442542.1_2 Forward -237 -224 4.8375 0.293
NP_442789.1_4 Forward -254 -235 -2.55715 0.238
NP_441518.1_3 Forward -218 -199 -10.227 0.238
NP_441557.1_5 Forward -208 -199 -0.885252 0.26
NP_441445.1_1 Reverse -190 -209 -0.590531 0.297
NP_441433.1_2 Forward -35 -16 16.5191 0.234
NP_441433.1_8 Reverse -286 -305 0.687771 0.238
NP_441433.1_8 Reverse -7 -26 -4.72043 0.294
NP_441739.1_2 Reverse -228 -244 5.56438 0.228
NP_441458.1_10 Reverse -190 -209 4.12936 0.236
NP_441116.1_9 Reverse -258 -272 15.9292 0.172
NP_441574.1_1 Reverse -372 -391 -2.85214 0.233
NP_442347.1_2 Reverse -200 -209 5.01461 0.244
NP_442347.1_10 Forward -369 -355 16.5185 0.182
NP_441633.1_3 Reverse -197 -210 -3.91395 0.177
NP_442764.1_8 Reverse -236 -255 8.55425 0.171
NP_442998.1_5 Forward -97 -87 12.8614 0.158
NP_442998.1_5 Forward -96 -86 12.7631 0.159
NP_442998.1_5 Forward -199 -189 11.4848 0.184
NP_442998.1_5 Reverse -81 -91 9.41981 0.241
NP_440899.1_8 Forward -277 -258 -8.752 0.258
NP_441799.1_1 Forward -212 -198 10.422 0.0747
NP_441007.1_10 Forward -213 -200 0.117615 0.25
NP_441007.1_10 Reverse -134 -147 -1.06236 0.3
NP_440256.1_1 Reverse -287 -306 -7.08038 0.228
NP_441362.1_2 Forward -227 -208 16.4671 0.141
NP_441362.1_2 Forward -279 -260 4.88691 0.261
NP_442007.1_3 Reverse -341 -360 10.815 0.265
NP_440456.1_7 Forward -273 -259 9.73436 0.294
NP_441559.1_8 Reverse -194 -208 -0.983719 0.18
NP_441559.1_8 Reverse -195 -209 -6.78525 0.279
NP_442158.1_4 Forward -264 -254 12.5664 0.245
NP_441296.1_9 Forward -375 -362 10.6384 0.258
NP_441866.1_4 Forward -348 -335 14.7038 0.273
NP_440695.1_6 Forward -228 -214 17.974 0.126
NP_440695.1_6 Forward -280 -266 14.8714 0.208
NP_440695.1_6 Reverse -259 -273 10.2174 0.269
NP_442386.1_9 Reverse -198 -207 5.21086 0.262
NP_442386.1_9 Forward -300 -291 5.0142 0.27
NP_441254.1_1 Reverse -217 -230 10.3434 0.295
NP_442714.1_5 Reverse -140 -159 -1.18052 0.3
NP_441134.1_6 Forward -366 -348 13.0964 0.178
NP_440586.1_8 Forward -207 -200 9.28187 0.164
NP_442959.1_5 Forward -280 -261 13.0775 0.222
NP_440684.1_9 Reverse -322 -336 9.14437 0.221
NP_440684.1_9 Forward -342 -328 8.65272 0.225
NP_439937.1_9 Reverse -225 -242 -9.59824 0.196
NP_439937.1_9 Reverse -226 -243 -11.1715 0.245
NP_440398.1_6 Forward -305 -286 2.3594 0.294
NP_439943.1_3 Forward -347 -328 11.3075 0.265
NP_440819.1_5 Forward -271 -263 7.8859 0.266
NP_440819.1_5 Forward -97 -89 7.68924 0.266
NP_441877.1_5 Forward -270 -251 -0.197208 0.276
NP_440163.1_9 Reverse -86 -105 11.6025 0.281
NP_440531.1_6 Forward -216 -197 7.96426 0.0903
NP_440531.1_6 Reverse -94 -113 3.6377 0.141
NP_441965.1_10 Forward -211 -195 6.54838 0.171
NP_442556.1_10 Forward -159 -140 11.8865 0.217
NP_440350.1_1 Reverse -86 -105 -4.22878 0.24
NP_441103.1_9 Reverse -90 -100 15.1264 0.192
NP_440937.1_5 Reverse -348 -367 15.7324 0.249
NP_440937.1_5 Reverse -202 -221 10.1275 0.275
NP_440999.1_9 Reverse -195 -209 8.75105 0.0722
NP_440888.1_2 Forward -154 -140 6.78381 0.22
NP_440888.1_2 Reverse -176 -190 5.1122 0.293
NP_439969.1_3 Reverse -129 -148 4.22769 0.214
NP_441543.1_2 Forward -207 -198 10.1278 0.0788
NP_442845.1_2 Reverse -355 -369 6.3911 0.21
NP_441178.1_6 Forward -373 -354 3.53858 0.269
NP_440071.1_3 Reverse -353 -371 19.5871 0.251
NP_442204.1_1 Reverse -286 -297 2.71361 0.266
NP_441560.1_8 Forward -31 -12 11.5127 0.294
NP_440255.1_8 Reverse -239 -258 17.9217 0.194
NP_442428.1_5 Reverse -200 -207 11.4455 0.062
NP_441867.1_2 Forward -296 -277 -2.26216 0.153
NP_440673.1_3 Reverse -350 -357 5.54565 0.288
NP_441052.1_2 Reverse -199 -209 6.07655 0.0943
NP_442219.1_9 Reverse -200 -209 4.81794 0.196
NP_440436.1_4 Forward -399 -390 8.75075 0.0995
NP_440436.1_4 Forward -207 -198 4.42421 0.265
NP_440041.1_6 Reverse -77 -96 8.75009 0.285
NP_442577.1_7 Forward -273 -254 9.63507 0.199
NP_442366.1_3 Forward -338 -320 -2.0458 0.219
NP_441437.1_1 Forward -110 -91 11.0125 0.264
NP_442873.1_5 Forward -370 -351 13.9616 0.179
NP_442854.1_4 Forward -369 -350 11.2084 0.269
NP_440864.1_9 Reverse -350 -369 -4.81876 0.224
NP_442856.1_7 Reverse -190 -209 -1.08219 0.216
NP_442689.1_8 Reverse -263 -280 -3.69774 0.251
NP_442843.1_1 Reverse -291 -310 1.17943 0.168
NP_440726.1_8 Reverse -108 -127 11.9958 0.214
NP_439950.1_1 Reverse -297 -306 13.1761 0.277
NP_439950.1_1 Forward -240 -231 12.4878 0.279
NP_440483.1_1 Reverse -285 -304 -5.99873 0.238
NP_441570.1_1 Reverse -199 -217 -10.6006 0.174
NP_442348.1_2 Forward -229 -220 16.0277 0.113
NP_440526.1_3 Reverse -200 -211 0.451529 0.281
NP_441432.1_8 Forward -209 -200 5.89959 0.13
NP_443024.1_2 Reverse -227 -240 15.1616 0.233
NP_442274.1_8 Forward -65 -47 13.2834 0.286
NP_440199.1_10 Forward -211 -201 7.05986 0.242
NP_441945.1_10 Reverse -121 -140 9.83255 0.258
NP_442353.1_4 Forward -399 -380 0.785326 0.265
NP_442353.1_4 Forward -204 -185 0.785326 0.265
NP_441072.1_2 Reverse -317 -336 6.19431 0.288
NP_442400.1_10 Reverse -261 -274 7.79662 0.282
NP_442489.1_7 Reverse -199 -208 -1.6719 0.235
NP_442749.1_5 Reverse -250 -267 11.3087 0.183
NP_441022.1_1 Forward -119 -110 12.8891 0.222
NP_440118.1_5 Reverse -374 -393 -2.16383 0.242
NP_442346.1_5 Forward -209 -199 11.6814 0.0606
NP_440352.1_5 Reverse -71 -90 9.73562 0.289
NP_440545.1_3 Forward -115 -98 -6.05768 0.268
NP_441856.1_6 Forward -209 -195 15.9292 0.26
NP_441126.1_6 Forward -100 -86 14.9898 0.253
NP_440847.1_8 Reverse -87 -106 17.404 0.175
NP_442603.1_9 Forward -301 -283 7.19731 0.279
NP_441585.1_5 Reverse -251 -270 11.3067 0.211
NP_441888.1_7 Forward -335 -321 1.67122 0.241
NP_441112.1_6 Reverse -311 -330 -2.0655 0.296
NP_441112.1_10 Reverse -129 -148 23.7955 0.00744
NP_441973.1_1 Forward -22 -7 0.176559 0.236
NP_441813.1_3 Forward -197 -178 14.7221 0.238
NP_442028.1_1 Reverse -161 -174 7.79662 0.289
NP_442886.1_1 Forward -275 -261 15.6342 0.283
NP_442886.1_1 Reverse -264 -278 15.6342 0.283
NP_441239.1_9 Forward -301 -289 3.57889 0.283
NP_440156.1_4 Forward -92 -82 15.5158 0.176
NP_440624.1_5 Forward -127 -109 11.6201 0.192
NP_441892.1_1 Forward -217 -200 -5.1727 0.275
NP_442105.1_9 Forward -105 -91 15.905 0.263
NP_440219.1_4 Forward -96 -83 16.4115 0.222
NP_441017.1_6 Reverse -249 -263 12.5853 0.217
NP_441769.1_3 Reverse -262 -281 -6.19614 0.263
NP_441874.1_1 Reverse -357 -371 8.94771 0.285
NP_440833.1_6 Forward -270 -256 13.8636 0.157
NP_441617.1_6 Reverse -261 -280 9.53756 0.116
NP_441617.1_6 Forward -343 -324 -4.22878 0.265
NP_440401.1_8 Reverse -256 -275 18.0924 0.0354
NP_441497.1_2 Forward -351 -332 6.78429 0.233
NP_440402.1_1 Forward -132 -113 3.24438 0.269
NP_442402.1_2 Reverse -85 -99 11.602 0.272
NP_442402.1_4 Forward -263 -244 -2.45958 0.199
NP_442402.1_4 Reverse -223 -242 -9.83437 0.293
NP_442402.1_10 Reverse -263 -273 13.8442 0.182
NP_442402.1_10 Reverse -232 -242 12.3692 0.212
NP_442402.1_10 Reverse -190 -200 11.2876 0.264
NP_440696.1_3 Forward -158 -140 -3.52077 0.287
NP_442039.1_7 Reverse -149 -159 11.4848 0.257
NP_441811.1_1 Forward -380 -361 10.1275 0.26
NP_442532.1_1 Forward -175 -161 8.75312 0.294
NP_442532.1_4 Forward -278 -260 21.6359 0.0215
NP_442532.1_4 Reverse -261 -279 14.558 0.203
NP_442470.1_3 Forward -368 -349 9.7334 0.246
NP_442533.1_1 Forward -255 -236 -17.5035 0.289
NP_442533.1_6 Forward -208 -199 12.8811 0.0253
NP_440263.1_5 Reverse -264 -278 15.7325 0.194
NP_440263.1_5 Forward -275 -261 8.16106 0.294
NP_439944.1_9 Reverse -200 -210 6.8632 0.165
NP_441028.1_6 Reverse -90 -100 5.38779 0.255
NP_441028.1_6 Reverse -89 -99 5.38779 0.255
NP_441527.1_4 Forward -182 -163 -9.50187 0.259
NP_442728.1_2 Reverse -111 -130 16.6174 0.194
NP_441106.1_1 Reverse -198 -207 4.32629 0.227
NP_440429.1_4 Forward -217 -198 13.1758 0.261
NP_439903.1_6 Forward -171 -152 7.76679 0.151
NP_440797.1_8 Forward -258 -239 16.9065 0.268
NP_442674.1_3 Reverse -182 -201 7.17681 0.219
NP_442382.1_9 Reverse -377 -396 7.96345 0.29
NP_442717.1_3 Forward -67 -48 3.6377 0.187
NP_442022.1_4 Reverse -349 -368 5.50599 0.283
NP_440841.1_4 Reverse -326 -345 -8.55534 0.25
NP_442842.1_10 Reverse -172 -191 -0.0199524 0.273
NP_442362.1_7 Forward -297 -279 12.6055 0.222
NP_442615.1_1 Reverse -190 -208 -5.09406 0.204
NP_441431.1_2 Reverse -196 -210 5.89884 0.284
NP_441065.1_2 Forward -288 -269 14.916 0.165
NP_441836.1_2 Reverse -193 -212 6.4893 0.115
NP_442224.1_1 Reverse -136 -155 4.916 0.164
NP_442357.1_5 Forward -274 -260 20.5508 0.0661
NP_442930.1_1 Reverse -260 -270 12.3692 0.239
NP_442930.1_1 Reverse -85 -95 10.501 0.276
NP_442930.1_1 Reverse -86 -96 10.4026 0.276
NP_440213.1_5 Reverse -108 -127 8.35759 0.279
NP_440798.1_1 Forward -93 -75 13.2475 0.294
NP_442680.1_7 Forward -278 -259 -0.4922 0.253
NP_441436.1_8 Reverse -361 -380 10.6192 0.262
NP_442509.1_6 Forward -211 -192 10.9142 0.294
NP_442509.1_9 Reverse -21 -31 9.22267 0.192
NP_441489.1_3 Reverse -212 -226 12.2346 0.198
NP_440524.1_2 Reverse -350 -369 -5.01543 0.283
NP_442514.1_5 Forward -372 -353 2.26028 0.17
NP_440554.1_4 Forward -207 -197 5.87989 0.129
NP_440478.1_9 Forward -201 -182 7.47261 0.299
NP_442341.1_7 Forward -365 -351 3.63784 0.217
NP_442341.1_9 Forward -339 -325 4.8172 0.291
NP_441173.1_9 Reverse -233 -241 10.1471 0.261
NP_440191.1_8 Reverse -224 -242 16.6363 0.254
NP_440149.1_8 Forward -214 -195 -4.91709 0.215
NP_442373.1_2 Reverse -360 -379 -9.53865 0.264
NP_440216.1_9 Forward -292 -283 9.04618 0.286
NP_440216.1_9 Reverse -254 -263 7.57121 0.286
NP_440172.1_1 Forward -330 -320 9.12481 0.0586
NP_442015.1_10 Reverse -195 -208 -0.472371 0.268
NP_441226.1_7 Forward -336 -329 9.77352 0.131
NP_441226.1_7 Reverse -328 -335 6.82361 0.246
NP_440416.1_9 Forward -371 -352 -19.7651 0.278
NP_440072.1_5 Reverse -361 -379 -0.865831 0.252
NP_442226.1_8 Forward -161 -151 12.6647 0.285
NP_442564.1_10 Forward -371 -357 8.16106 0.296
NP_440261.1_5 Reverse -200 -213 -12.4687 0.297
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CACCATCGTCGGTAACTAAATCGGACTCTTCCCCCTGCCCAACAGCAACGATATTTTTGATTTTGCCGTCGGCAATTTCTAGATGGTAAAGTCCTAAATCCTCCCAAGGCCTGGGAAACTGAAAATTTTCGGGAAAATTTACCTTGGTTTTGACCAAATTGGGGGGAATATGGGCATTTTTAAGCCAATAGTGGCCATCACTGGGAAGAACCAGAGGGGAAGACATAAAAAAGATGATTTAGTTTGCCAGTTTGCCGTTGCATCAATTCAGGGCCAAGCTCCAAAACTTTGCGTTACCCTGCAGGGGAAAAATTTAGCCCCTATTTGCAATTAGATGCCAATTTTCCTAGAACATTGACCAGTATAATAGCCGGATTATCTGCCCTTTACTGACTTCGCC

CDS

ATGATTACCAGGGAAACCTTGCCCGTTTATTTACAACGCCTTTGGCAAAACGCCATGGTGCGCTGGTGGATCATTGGCATTATTGCCATGGTTTTGAACGTTGTCCTCTTGGATTGGTTCAAAGTGTCCCTCGGCATGGGCCTCACCTGGGCTTCCGTCCTCTCCGCCGAAGTCATTACCATCATTCGTTACGGGGCGATTGACCTCTGGGTATTTCGTAATCCTAACCTTTCTTGGCAACGCTGTTGGGAATACCATGTGGCCAATTTCAGTGGCTTTTTTCTCTGGAGTTTAATTATTGTAATTTTGGGCAATAAATTGGGCTGGGACCATAAAATAGCGGCTATCGTTGCCACCATGATTACCGTATTTTGGAGCATGGCCACTAACTTTCTTTGGGTCTGGCGTAAACCGAAAAAGAAAGCTTAA

Protein

MITRETLPVYLQRLWQNAMVRWWIIGIIAMVLNVVLLDWFKVSLGMGLTWASVLSAEVITIIRYGAIDLWVFRNPNLSWQRCWEYHVANFSGFFLWSLIIVILGNKLGWDHKIAAIVATMITVFWSMATNFLWVWRKPKKKA