Your browser is old and dusty. Try Google Chrome!

Details for sll1129

ORF sll1129
Accession NP_440850.1
Symbol
Category Other
Definition 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -294 -280 12.7826 0.0447
NP_441061.1_2 Reverse -287 -301 5.01447 0.142
NP_441061.1_2 Forward -258 -244 1.67122 0.183
NP_440557.1_1 Reverse -287 -306 -1.7705 0.277
NP_440557.1_3 Reverse -43 -62 7.47261 0.183
NP_440795.1_7 Forward -294 -287 14.6904 0.0123
NP_440795.1_7 Reverse -287 -294 14.6904 0.0123
NP_441418.1_6 Forward -295 -276 -9.83364 0.0294
NP_442291.1_5 Reverse -285 -301 9.00665 0.0541
NP_442291.1_5 Forward -35 -19 8.31834 0.0558
NP_442291.1_5 Reverse -24 -40 -0.531451 0.185
NP_441453.1_1 Reverse -279 -297 2.57501 0.289
NP_441453.1_4 Reverse -286 -294 16.539 0.00633
NP_441453.1_4 Forward -295 -287 16.539 0.00633
NP_441453.1_4 Forward -34 -26 7.19758 0.0757
NP_441453.1_4 Reverse -25 -33 6.80426 0.121
NP_441453.1_7 Reverse -69 -76 12.9205 0.23
NP_442151.1_6 Reverse -286 -300 19.4691 0.0045
NP_442838.1_7 Forward -257 -238 -11.4069 0.277
NP_441818.1_1 Forward -33 -22 15.0044 0.0389
NP_441818.1_1 Forward -17 -6 10.9729 0.21
NP_441818.1_1 Reverse -287 -298 9.79292 0.232
NP_440226.1_1 Reverse -25 -44 15.7324 0.0231
NP_440226.1_1 Forward -295 -276 11.6025 0.0519
NP_441630.1_3 Forward -303 -284 8.35759 0.113
NP_441342.1_2 Forward -299 -285 11.996 0.208
NP_442173.1_1 Forward -294 -286 15.4574 0.00633
NP_442173.1_1 Reverse -287 -295 15.4574 0.00633
NP_442173.1_1 Reverse -26 -34 7.68924 0.142
NP_442173.1_1 Forward -33 -25 5.72262 0.203
NP_442752.1_4 Forward -295 -288 13.8055 0.0199
NP_442752.1_4 Reverse -286 -293 13.8055 0.0199
NP_442752.1_4 Reverse -25 -32 13.8055 0.0199
NP_443027.1_4 Reverse -284 -294 14.828 0.0437
NP_443027.1_4 Reverse -23 -33 10.2065 0.138
NP_441812.1_3 Forward -296 -282 15.0442 0.106
NP_442975.1_10 Reverse -282 -296 12.782 0.0459
NP_442975.1_10 Reverse -331 -345 3.73557 0.252
NP_442975.1_10 Forward -299 -285 2.06395 0.284
NP_441675.1_4 Reverse -115 -134 3.14605 0.277
NP_440784.1_7 Forward -294 -287 15.9687 0.0123
NP_440784.1_7 Reverse -287 -294 15.9687 0.0123
NP_440784.1_7 Reverse -244 -251 10.2655 0.0801
NP_440784.1_7 Forward -17 -10 6.43063 0.218
NP_440784.1_7 Reverse -26 -33 6.23397 0.241
NP_440784.1_7 Forward -33 -26 6.13563 0.241
NP_442909.1_7 Reverse -287 -301 11.602 0.131
NP_440061.1_9 Reverse -284 -298 11.7987 0.105
NP_440061.1_9 Forward -254 -240 6.19383 0.255
NP_439979.1_9 Reverse -239 -257 7.39397 0.288
NP_442062.1_8 Forward -295 -285 19.4496 0.000558
NP_442062.1_8 Reverse -286 -296 17.3846 0.00193
NP_442062.1_8 Reverse -25 -35 14.6313 0.012
NP_442062.1_8 Forward -34 -24 5.09324 0.184
NP_442062.1_8 Reverse -157 -167 2.83163 0.293
NP_441859.1_3 Reverse -249 -268 8.25844 0.142
NP_441859.1_3 Forward -182 -163 2.26028 0.263
NP_440304.1_4 Reverse -284 -294 10.8948 0.051
NP_440304.1_4 Forward -59 -49 2.7333 0.299
NP_440304.1_4 Forward -297 -287 1.84832 0.299
NP_442242.1_4 Forward -294 -287 14.3954 0.0124
NP_442242.1_4 Reverse -287 -294 14.3954 0.0124
NP_442242.1_4 Forward -33 -26 10.8555 0.127
NP_440044.1_8 Forward -33 -14 10.2259 0.0596
NP_440908.1_4 Reverse -236 -255 17.699 0.187
NP_442207.1_2 Reverse -230 -249 6.39097 0.118
NP_439923.1_5 Reverse -144 -163 13.6675 0.0934
NP_441208.1_9 Forward -298 -284 13.7659 0.103
NP_441208.1_9 Forward -110 -96 7.17775 0.226
NP_441594.1_6 Reverse -241 -260 0.687771 0.282
NP_440370.1_10 Forward -304 -285 8.25926 0.243
NP_442110.1_7 Reverse -286 -300 9.63603 0.0715
NP_441082.1_10 Reverse -34 -47 10.4424 0.236
NP_441083.1_5 Reverse -286 -296 20.3345 0.00053
NP_441083.1_5 Forward -295 -285 11.3864 0.0159
NP_441083.1_5 Forward -34 -24 1.74999 0.198
NP_441083.1_5 Reverse -25 -35 0.963343 0.218
NP_442827.1_8 Reverse -284 -303 4.91521 0.128
NP_442827.1_8 Forward -303 -284 -1.27961 0.245
NP_441738.1_2 Forward -293 -286 15.28 0.0102
NP_441738.1_2 Reverse -288 -295 15.28 0.0102
NP_441738.1_2 Forward -32 -25 15.28 0.0102
NP_441558.1_5 Reverse -284 -303 8.06259 0.162
NP_440209.1_1 Reverse -286 -294 18.1123 0.00295
NP_440209.1_1 Forward -295 -287 18.1123 0.00295
NP_440209.1_1 Reverse -25 -33 8.57422 0.0425
NP_440209.1_1 Forward -34 -26 5.32929 0.139
NP_442889.1_8 Reverse -283 -297 21.4351 0.00292
NP_442889.1_8 Reverse -22 -36 9.14375 0.103
NP_442889.1_10 Reverse -115 -134 17.2421 0.149
NP_440447.1_5 Forward -79 -69 14.4347 0.277
NP_441713.1_1 Reverse -227 -246 -0.590531 0.0952
NP_440178.1_7 Reverse -285 -304 -13.0786 0.129
NP_440178.1_7 Forward -296 -277 -21.6334 0.232
NP_442570.1_3 Reverse -313 -332 -4.42544 0.23
NP_441716.1_1 Reverse -286 -300 6.6861 0.191
NP_441716.1_1 Reverse -157 -171 6.58777 0.195
NP_443013.1_3 Forward -360 -341 2.85105 0.297
NP_441327.1_1 Forward -221 -202 8.53829 0.211
NP_441327.1_5 Reverse -94 -103 13.9627 0.261
NP_442111.1_4 Forward -296 -282 9.34103 0.0609
NP_440906.1_5 Forward -294 -287 15.8704 0.0124
NP_440906.1_5 Reverse -287 -294 15.8704 0.0124
NP_440906.1_5 Reverse -26 -33 6.23397 0.234
NP_440906.1_5 Forward -33 -26 6.13563 0.241
NP_440747.1_10 Forward -298 -286 14.9853 0.00221
NP_440747.1_10 Reverse -283 -295 -2.1243 0.0225
NP_440747.1_10 Forward -37 -25 -4.58258 0.109
NP_440747.1_10 Reverse -22 -34 -12.0557 0.199
NP_440747.1_10 Reverse -154 -166 -12.2524 0.254
NP_441130.1_10 Reverse -284 -298 11.5043 0.106
NP_441130.1_10 Reverse -248 -262 5.80112 0.214
NP_441486.1_1 Forward -298 -284 19.9608 0.00312
NP_441486.1_1 Reverse -22 -36 14.7492 0.00628
NP_441486.1_1 Reverse -283 -297 13.7659 0.00763
NP_441486.1_1 Forward -37 -23 10.226 0.0218
NP_441486.1_1 Reverse -6 -20 -4.62196 0.204
NP_440403.1_10 Reverse -241 -260 5.80098 0.238
NP_440403.1_10 Reverse -163 -182 4.62101 0.254
NP_440842.1_10 Reverse -240 -254 12.0943 0.251
NP_441014.1_8 Forward -41 -22 -4.13045 0.247
NP_441014.1_10 Forward -296 -277 19.3698 0.0349
NP_441014.1_10 Forward -35 -16 4.52188 0.196
NP_441014.1_10 Reverse -171 -190 -3.04956 0.292
NP_442848.1_1 Reverse -19 -33 6.3911 0.0791
NP_442848.1_1 Forward -187 -173 0.491246 0.263
NP_442848.1_1 Forward -301 -287 -0.590395 0.263
NP_441012.1_4 Forward -164 -151 11.0324 0.257
NP_443018.1_3 Forward -294 -287 14.8871 0.0123
NP_443018.1_3 Reverse -287 -294 14.8871 0.0123
NP_443018.1_3 Reverse -26 -33 12.6255 0.0471
NP_443018.1_3 Reverse -251 -258 8.39725 0.147
NP_443018.1_3 Forward -33 -26 5.25066 0.214
NP_443018.1_3 Forward -251 -244 4.26735 0.267
NP_443018.1_3 Reverse -244 -251 4.16902 0.278
NP_443018.1_3 Forward -180 -173 4.07068 0.299
NP_441634.1_8 Forward -297 -283 -3.147 0.295
NP_440376.1_1 Forward -295 -286 19.4693 0.000692
NP_440376.1_1 Reverse -286 -295 19.4693 0.000692
NP_440376.1_1 Reverse -25 -34 -0.000272808 0.285
NP_440376.1_1 Forward -34 -25 -0.0986038 0.285
NP_440376.1_1 Reverse -39 -48 -0.295266 0.286
NP_441588.1_4 Reverse -27 -37 9.12481 0.14
NP_441588.1_4 Reverse -288 -298 8.92815 0.14
NP_441588.1_4 Forward -32 -22 8.63316 0.14
NP_442730.1_1 Forward -82 -63 17.109 0.103
NP_442687.1_7 Reverse -285 -295 15.8113 0.0125
NP_442687.1_7 Forward -296 -286 8.92815 0.0994
NP_442958.1_3 Forward -306 -287 7.66927 0.156
NP_441422.1_7 Reverse -284 -301 -4.58271 0.247
NP_441029.1_4 Reverse -296 -315 -4.22878 0.297
NP_442658.1_1 Reverse -284 -294 15.9091 0.00966
NP_442658.1_1 Forward -254 -244 12.7626 0.0476
NP_442658.1_1 Forward -297 -287 6.76441 0.214
NP_440141.1_8 Forward -175 -156 12.0942 0.189
NP_441855.2_4 Forward -65 -46 12.4153 0.196
NP_442782.1_2 Reverse -146 -160 8.65272 0.198
NP_442782.1_2 Forward -160 -146 2.45787 0.275
NP_442782.1_7 Reverse -17 -36 0.687771 0.21
NP_441414.1_9 Forward -295 -276 15.7324 0.0106
NP_441414.1_9 Reverse -286 -305 -3.24547 0.132
NP_441256.1_8 Reverse -81 -100 5.11266 0.272
NP_442937.1_5 Forward -300 -281 6.58763 0.275
NP_441958.1_5 Forward -296 -286 12.2714 0.00183
NP_441958.1_5 Reverse -285 -295 12.2714 0.00183
NP_441958.1_5 Reverse -24 -34 1.55333 0.095
NP_441127.1_1 Forward -175 -161 15.5359 0.114
NP_441127.1_1 Reverse -235 -249 8.06273 0.3
NP_442836.1_5 Forward -301 -282 7.17762 0.169
NP_440203.1_5 Reverse -289 -299 13.3526 0.116
NP_439905.1_1 Reverse -158 -171 7.39411 0.262
NP_440995.1_8 Forward -44 -25 13.5691 0.117
NP_440984.1_7 Forward -300 -286 11.6026 0.122
NP_442690.1_1 Reverse -201 -220 -9.63698 0.203
NP_442690.1_1 Forward -223 -204 -11.2103 0.225
NP_442690.1_1 Forward -136 -117 -16.0285 0.283
NP_442911.1_2 Reverse -276 -295 6.39097 0.0289
NP_442911.1_2 Forward -305 -286 1.86774 0.0556
NP_442911.1_2 Reverse -147 -166 -5.80207 0.167
NP_440153.1_5 Reverse -287 -301 12.4876 0.0645
NP_440369.1_6 Reverse -158 -177 10.7175 0.25
NP_442064.1_1 Forward -23 -4 -13.1769 0.285
NP_443055.1_6 Forward -309 -291 6.1149 0.172
NP_443055.1_6 Forward -57 -39 -0.0799167 0.252
NP_440602.1_8 Forward -34 -20 16.8142 0.11
NP_441913.1_3 Reverse -140 -153 17.5368 0.218
NP_441099.1_5 Reverse -276 -295 -3.24547 0.131
NP_441099.1_5 Forward -305 -286 -8.45701 0.194
NP_442002.1_9 Reverse -285 -292 10.7572 0.185
NP_441294.1_7 Forward -299 -285 8.48272 0.298
NP_442438.1_10 Forward -300 -286 8.35772 0.0782
NP_441292.1_2 Reverse -67 -86 -6.88371 0.25
NP_441000.1_6 Reverse -285 -299 -5.50694 0.279
NP_440484.1_1 Reverse -61 -80 11.995 0.194
NP_440147.1_3 Reverse -149 -168 1.67108 0.296
NP_440147.1_4 Forward -297 -284 10.049 0.0355
NP_440147.1_4 Reverse -284 -297 3.46087 0.187
NP_440147.1_4 Forward -36 -23 -0.570702 0.291
NP_441175.1_2 Forward -125 -106 5.80098 0.276
NP_441175.1_7 Reverse -286 -305 13.6675 0.113
NP_441550.1_8 Forward -297 -287 14.6309 0.0132
NP_441550.1_8 Reverse -284 -294 6.0761 0.214
NP_441916.1_7 Forward -295 -285 18.4663 0.00144
NP_441916.1_7 Reverse -286 -296 10.3048 0.0261
NP_441916.1_7 Forward -34 -24 7.74818 0.0608
NP_440206.1_4 Reverse -147 -166 4.03023 0.26
NP_440206.1_9 Reverse -106 -125 10.1275 0.272
NP_441041.1_4 Forward -295 -276 0.687771 0.084
NP_441041.1_4 Forward -172 -153 -3.93378 0.128
NP_441041.1_7 Reverse -45 -57 8.87526 0.128
NP_442396.1_5 Reverse -282 -295 16.3422 0.0475
NP_442004.1_6 Reverse -286 -300 8.75105 0.14
NP_441725.1_5 Forward -294 -284 11.2881 0.0247
NP_441725.1_5 Reverse -287 -297 2.04498 0.115
NP_441725.1_5 Forward -33 -23 1.455 0.135
NP_441725.1_5 Forward -251 -241 -1.29827 0.299
NP_439966.1_7 Reverse -284 -294 18.4657 0.00473
NP_439966.1_7 Forward -297 -287 7.25606 0.15
NP_439966.1_7 Reverse -23 -33 6.0761 0.195
NP_439966.1_9 Reverse -284 -293 0.983037 0.253
NP_440202.1_8 Reverse -278 -297 12.8215 0.26
NP_442941.1_3 Forward -294 -284 11.4848 0.0116
NP_442941.1_3 Reverse -287 -297 11.0914 0.0116
NP_442941.1_3 Forward -33 -23 10.1081 0.024
NP_442941.1_3 Reverse -26 -36 -1.19994 0.288
NP_440289.1_2 Reverse -283 -296 11.819 0.0171
NP_440983.1_5 Forward -172 -153 -6.58872 0.278
NP_440260.1_8 Forward -304 -286 -7.55234 0.295
NP_442281.1_1 Reverse -281 -295 11.1104 0.0507
NP_442281.1_1 Reverse -20 -34 9.83206 0.0661
NP_442281.1_1 Forward -39 -25 9.04542 0.0747
NP_442281.1_1 Forward -300 -286 8.94708 0.0747
NP_442281.1_1 Reverse -245 -259 7.07881 0.108
NP_442281.1_1 Forward -257 -243 6.0955 0.136
NP_442281.1_1 Reverse -167 -181 4.71887 0.184
NP_440177.1_9 Reverse -278 -297 12.0942 0.238
NP_442256.1_2 Reverse -284 -302 -6.07737 0.214
NP_442256.1_2 Forward -297 -279 -8.14232 0.217
NP_440437.1_1 Forward -40 -21 -3.14714 0.232
NP_442012.1_1 Reverse -151 -170 8.65258 0.0986
NP_442012.1_1 Reverse -280 -299 -1.7705 0.297
NP_441556.1_10 Forward -300 -286 17.8141 0.0841
NP_440498.1_1 Reverse -277 -295 -0.472507 0.218
NP_443030.1_4 Forward -173 -154 7.66927 0.169
NP_441644.1_6 Reverse -286 -296 17.3841 0.00127
NP_441644.1_6 Forward -295 -285 10.1076 0.0628
NP_441644.1_6 Reverse -157 -167 7.35439 0.129
NP_441644.1_6 Forward -34 -24 6.0761 0.167
NP_441644.1_6 Forward -172 -162 4.69947 0.228
NP_441644.1_6 Reverse -250 -260 3.32285 0.288
NP_443049.1_6 Reverse -24 -34 12.3241 0.24
NP_440867.1_10 Forward -253 -234 3.24438 0.283
NP_442215.1_2 Reverse -284 -300 8.41667 0.0657
NP_442215.1_2 Reverse -241 -257 -4.36636 0.232
NP_442215.1_2 Forward -297 -281 -4.66135 0.237
NP_442215.1_2 Reverse -155 -171 -6.13632 0.264
NP_442215.1_2 Forward -20 -4 -6.82463 0.28
NP_442215.1_5 Forward -329 -310 12.4875 0.287
NP_442029.1_6 Forward -241 -222 2.75272 0.289
NP_442247.1_8 Forward -297 -283 9.63603 0.247
NP_440253.1_2 Forward -295 -277 -2.73412 0.274
NP_440929.1_8 Forward -295 -286 19.2726 0.000701
NP_440929.1_8 Reverse -286 -295 19.2726 0.000701
NP_440929.1_8 Forward -252 -243 6.39124 0.0992
NP_442933.1_10 Forward -295 -286 17.601 0.00325
NP_442933.1_10 Reverse -286 -295 17.601 0.00325
NP_442933.1_10 Forward -34 -25 15.1427 0.00958
NP_442933.1_10 Reverse -9 -18 8.75118 0.0688
NP_442933.1_10 Reverse -25 -34 7.96454 0.0937
NP_442933.1_10 Forward -252 -243 3.83464 0.283
NP_441751.2_8 Forward -33 -19 3.24451 0.0692
NP_441751.2_8 Forward -294 -280 -2.45868 0.132
NP_442926.1_1 Forward -367 -348 -5.99873 0.278
NP_442554.1_8 Reverse -287 -297 15.3197 0.00882
NP_442554.1_8 Forward -294 -284 13.8447 0.0145
NP_442554.1_8 Forward -180 -170 9.91146 0.053
NP_442554.1_8 Reverse -293 -303 6.27322 0.123
NP_442554.1_8 Forward -33 -23 6.07655 0.126
NP_442554.1_8 Forward -251 -241 3.02829 0.245
NP_442554.1_8 Forward -258 -248 2.7333 0.259
NP_442554.1_8 Reverse -244 -254 2.7333 0.259
NP_441762.1_7 Reverse -285 -297 9.57708 0.0142
NP_441762.1_7 Forward -296 -284 2.89058 0.0676
NP_442142.1_4 Reverse -22 -35 8.57349 0.112
NP_442142.1_4 Reverse -283 -296 7.88518 0.127
NP_442142.1_4 Forward -298 -285 5.62358 0.187
NP_442292.1_1 Reverse -287 -296 18.486 0.00229
NP_442292.1_1 Forward -294 -285 9.63616 0.0183
NP_442292.1_1 Forward -33 -24 8.65285 0.0335
NP_442292.1_1 Reverse -173 -182 5.11294 0.162
NP_442292.1_1 Reverse -26 -35 -0.196935 0.239
NP_442292.1_5 Forward -263 -244 -0.983855 0.257
NP_441525.1_1 Reverse -15 -28 11.1307 0.296
NP_442476.1_6 Forward -294 -280 3.14618 0.161
NP_442016.1_10 Reverse -2 -21 6.88262 0.259
NP_441711.1_4 Forward -310 -291 7.57094 0.144
NP_443009.1_5 Forward -296 -285 18.3477 0.00265
NP_443009.1_5 Reverse -320 -331 4.97473 0.222
NP_442408.2_1 Forward -295 -276 -6.88371 0.287
NP_441715.1_4 Forward -294 -284 16.303 0.0117
NP_441715.1_4 Reverse -287 -297 7.94484 0.107
NP_441715.1_4 Forward -33 -23 4.99491 0.24
NP_440279.1_2 Reverse -146 -165 10.5209 0.146
NP_441448.1_1 Reverse -248 -267 9.63589 0.191
NP_441448.1_6 Forward -30 -11 20.5498 0.0407
NP_440183.1_9 Forward -257 -238 -17.8968 0.276
NP_441198.1_5 Reverse -288 -301 12.2117 0.228
NP_440464.1_10 Reverse -287 -297 13.0082 0.169
NP_440464.1_10 Forward -130 -120 12.2442 0.242
NP_441468.1_1 Forward -294 -287 15.8704 0.0124
NP_441468.1_1 Reverse -287 -294 15.8704 0.0124
NP_441468.1_1 Forward -180 -173 10.9539 0.0726
NP_441468.1_1 Forward -251 -244 10.2655 0.0906
NP_441468.1_1 Reverse -26 -33 6.13563 0.209
NP_441468.1_1 Forward -33 -26 6.0373 0.223
NP_441020.2_6 Forward -297 -280 17.6401 0.0176
NP_441020.2_6 Forward -254 -237 7.512 0.229
NP_441015.1_10 Reverse -152 -171 -6.49039 0.249
NP_441673.1_1 Forward -295 -286 20.8459 0.000698
NP_441673.1_1 Reverse -286 -295 20.8459 0.000698
NP_441673.1_1 Forward -34 -25 1.27803 0.155
NP_441673.1_1 Reverse -25 -34 1.27803 0.155
NP_441956.1_9 Reverse -67 -86 4.42435 0.277
NP_441876.1_9 Forward -129 -119 15.4175 0.267
NP_441426.1_3 Forward -173 -154 12.4867 0.256
NP_441826.1_2 Forward -301 -287 14.8476 0.0196
NP_441826.1_2 Reverse -19 -33 1.08123 0.164
NP_441826.1_2 Reverse -151 -165 -1.96703 0.261
NP_441826.1_5 Reverse -71 -90 0.58944 0.3
NP_442868.1_6 Forward -297 -287 9.81313 0.038
NP_442868.1_6 Reverse -284 -294 0.963343 0.205
NP_442868.1_6 Reverse -23 -33 0.176696 0.247
NP_442719.1_2 Forward -132 -114 -9.61797 0.267
NP_442719.1_2 Forward -64 -46 -10.6013 0.278
NP_441612.1_2 Forward -344 -334 12.7122 0.21
NP_441612.1_2 Reverse -286 -296 8.54929 0.21
NP_441612.1_2 Reverse -25 -35 6.70984 0.277
NP_443058.1_7 Forward -296 -277 4.916 0.25
NP_442361.1_8 Forward -23 -5 12.4089 0.282
NP_442808.1_1 Reverse -285 -295 18.4657 0.00201
NP_442808.1_1 Forward -296 -286 8.63269 0.0481
NP_442808.1_1 Forward -234 -224 4.89613 0.185
NP_441849.1_2 Reverse -181 -200 3.77151 0.245
NP_440145.1_3 Forward -305 -286 1.67108 0.125
NP_442820.1_3 Reverse -303 -313 15.8108 0.248
NP_442820.1_3 Forward -25 -15 13.3526 0.277
NP_442050.1_5 Reverse -284 -294 9.12434 0.193
NP_442050.1_5 Forward -297 -287 7.64939 0.243
NP_442050.1_5 Reverse -23 -33 6.76441 0.282
NP_441114.1_3 Forward -329 -320 15.831 0.193
NP_441114.1_3 Reverse -323 -332 7.66954 0.231
NP_440558.1_2 Reverse -154 -173 5.89931 0.137
NP_440558.1_2 Reverse -163 -182 -0.885524 0.205
NP_440558.1_2 Forward -170 -151 -4.52377 0.246
NP_440558.1_2 Reverse -240 -259 -5.60541 0.262
NP_442789.1_4 Forward -297 -278 -6.98204 0.289
NP_441518.1_3 Forward -44 -25 -13.4719 0.264
NP_441878.1_6 Forward -296 -286 10.4031 0.0176
NP_441878.1_6 Reverse -285 -295 10.4031 0.0176
NP_441878.1_6 Forward -253 -243 0.963343 0.128
NP_441878.1_6 Reverse -242 -252 -0.0199663 0.163
NP_441878.1_6 Forward -167 -157 -7.49312 0.231
NP_441878.1_6 Forward -331 -321 -7.59145 0.245
NP_441036.1_8 Reverse -285 -295 17.7779 0.000554
NP_441036.1_8 Forward -296 -286 8.33817 0.174
NP_442650.1_2 Reverse -286 -300 6.19444 0.134
NP_441557.1_5 Forward -295 -286 19.9609 0.000699
NP_441557.1_5 Reverse -286 -295 19.9609 0.000699
NP_441557.1_5 Reverse -25 -34 8.94785 0.0289
NP_441557.1_5 Forward -34 -25 0.688044 0.128
NP_441445.1_1 Reverse -16 -35 6.29264 0.152
NP_442066.2_4 Reverse -2 -21 -8.06369 0.293
NP_442066.2_9 Reverse -282 -295 11.524 0.154
NP_442419.1_2 Forward -300 -281 -5.21209 0.295
NP_441308.1_8 Reverse -284 -294 10.1081 0.22
NP_442183.1_1 Forward -295 -281 23.2057 0.00203
NP_442183.1_1 Forward -34 -20 5.21113 0.226
NP_442347.1_2 Reverse -287 -296 12.4878 0.056
NP_442347.1_2 Forward -33 -24 12.2911 0.056
NP_442347.1_2 Forward -294 -285 11.1111 0.056
NP_442645.1_2 Forward -303 -284 4.52268 0.0235
NP_441037.1_4 Forward -297 -287 7.9999 0.237
NP_441037.1_4 Reverse -284 -294 7.02532 0.237
NP_441633.1_3 Forward -297 -284 8.47575 0.0377
NP_441633.1_3 Reverse -284 -297 -3.71729 0.177
NP_441633.1_3 Forward -254 -241 -6.37223 0.248
NP_440136.1_2 Forward -294 -287 15.9687 0.0123
NP_440136.1_2 Reverse -287 -294 15.9687 0.0123
NP_440136.1_2 Reverse -26 -33 6.23397 0.171
NP_440136.1_2 Forward -33 -26 6.13563 0.193
NP_442998.1_5 Reverse -145 -155 9.12481 0.252
NP_442998.1_5 Reverse -211 -221 8.4365 0.263
NP_442998.1_5 Forward -392 -382 7.25653 0.298
NP_442998.1_10 Forward -293 -286 15.5754 0.0102
NP_442998.1_10 Reverse -288 -295 15.5754 0.0102
NP_442998.1_10 Forward -32 -25 15.5754 0.0102
NP_440899.1_8 Forward -104 -85 -2.26216 0.221
NP_440299.1_1 Forward -299 -286 19.9798 0.00161
NP_440299.1_1 Reverse -282 -295 10.8351 0.0529
NP_440299.1_1 Reverse -168 -181 4.44361 0.207
NP_440299.1_6 Reverse -255 -274 7.66927 0.237
NP_441799.1_1 Forward -299 -285 13.2736 0.0337
NP_441799.1_1 Reverse -282 -296 11.012 0.0629
NP_441799.1_9 Forward -296 -277 -0.0988766 0.213
NP_440640.1_8 Reverse -251 -270 12.2908 0.26
NP_441007.1_10 Reverse -281 -294 1.39592 0.203
NP_441007.1_10 Forward -300 -287 -0.669033 0.287
NP_442334.1_10 Reverse -157 -176 -6.98204 0.22
NP_442201.1_10 Forward -306 -287 1.17943 0.113
NP_440256.1_1 Forward -37 -18 -0.787193 0.0961
NP_440256.1_1 Forward -298 -279 -2.65548 0.122
NP_440256.1_1 Reverse -22 -41 -4.42544 0.155
NP_440256.1_1 Reverse -154 -173 -9.93197 0.291
NP_440087.1_1 Forward -304 -285 -9.14533 0.292
NP_442526.1_3 Forward -30 -11 19.2399 0.128
NP_443042.1_3 Reverse -134 -152 13.1955 0.295
NP_441559.1_8 Forward -88 -74 -4.4253 0.223
NP_441559.1_8 Forward -300 -286 -6.88358 0.281
NP_440915.1_6 Reverse -70 -84 2.45787 0.118
NP_442785.1_7 Reverse -284 -298 10.7177 0.228
NP_442866.1_1 Reverse -254 -273 -1.7705 0.204
NP_440748.1_5 Forward -164 -145 0.982764 0.24
NP_442031.1_2 Forward -234 -215 16.5191 0.255
NP_441939.1_3 Reverse -287 -306 5.50599 0.273
NP_442957.1_3 Reverse -252 -271 3.73603 0.26
NP_442993.1_1 Forward -295 -279 -9.38124 0.185
NP_442386.1_9 Reverse -285 -294 15.7322 0.0144
NP_442386.1_9 Forward -296 -287 13.8639 0.0289
NP_442386.1_9 Reverse -73 -82 5.40752 0.253
NP_442386.1_9 Forward -35 -26 5.11253 0.266
NP_441750.1_1 Reverse -70 -89 -10.3253 0.3
NP_441340.1_5 Forward -294 -287 15.6737 0.0124
NP_441340.1_5 Reverse -287 -294 15.6737 0.0124
NP_441340.1_5 Reverse -26 -33 6.23397 0.132
NP_441340.1_5 Forward -33 -26 5.84064 0.208
NP_441340.1_5 Reverse -244 -251 4.07068 0.239
NP_441340.1_9 Reverse -44 -54 8.25522 0.256
NP_442186.1_9 Forward -175 -156 7.66927 0.228
NP_441271.1_8 Reverse -70 -80 13.648 0.272
NP_442484.1_2 Forward -29 -10 -1.27885 0.288
NP_440168.1_8 Reverse -151 -170 6.78429 0.19
NP_440059.1_3 Reverse -330 -349 9.83173 0.17
NP_442240.1_2 Reverse -287 -306 -12.4886 0.163
NP_440586.1_8 Reverse -26 -33 14.69 0.026
NP_440586.1_8 Forward -294 -287 13.2151 0.026
NP_440586.1_8 Reverse -287 -294 13.2151 0.026
NP_440586.1_8 Reverse -251 -258 7.21693 0.27
NP_440586.1_9 Forward -253 -234 11.4058 0.258
NP_442251.1_6 Forward -294 -287 15.2804 0.0124
NP_442251.1_6 Reverse -287 -294 15.2804 0.0124
NP_442251.1_6 Forward -33 -26 12.0355 0.0627
NP_440192.1_4 Forward -75 -56 9.20356 0.279
NP_440192.1_5 Forward -296 -277 12.2908 0.125
NP_440684.1_9 Forward -301 -287 10.521 0.195
NP_440684.1_9 Reverse -280 -294 9.43936 0.221
NP_441262.1_3 Reverse -286 -293 14.7888 0.0223
NP_441262.1_3 Reverse -25 -32 14.7888 0.0223
NP_441262.1_3 Forward -295 -288 14.7888 0.0223
NP_440027.1_3 Reverse -157 -175 15.8496 0.0944
NP_443051.1_1 Reverse -285 -294 10.4228 0.00754
NP_443051.1_1 Forward -296 -287 10.4228 0.00754
NP_443051.1_1 Reverse -24 -33 0.884706 0.125
NP_439937.1_8 Reverse -248 -267 5.60432 0.192
NP_439937.1_9 Forward -245 -228 -4.09173 0.157
NP_439937.1_9 Forward -158 -141 -15.6947 0.287
NP_440439.1_1 Forward -298 -285 2.57589 0.131
NP_440439.1_1 Reverse -283 -296 1.10092 0.162
NP_440372.1_2 Forward -294 -287 16.3621 0.0124
NP_440372.1_2 Reverse -287 -294 16.3621 0.0124
NP_440372.1_2 Reverse -26 -33 6.82395 0.0854
NP_440372.1_2 Forward -33 -26 6.52896 0.188
NP_441803.1_2 Reverse -281 -300 12.7825 0.0576
NP_441803.1_2 Reverse -152 -171 -0.885524 0.291
NP_440139.1_1 Reverse -280 -299 1.47364 0.26
NP_442384.1_10 Reverse -286 -299 18.9972 0.00338
NP_442384.1_10 Forward -295 -282 14.1789 0.0163
NP_442384.1_10 Reverse -335 -348 1.39592 0.26
NP_441877.1_5 Forward -277 -258 3.53937 0.234
NP_441877.1_7 Reverse -281 -300 0.686995 0.255
NP_441877.1_9 Forward -394 -377 3.97208 0.284
NP_442790.1_4 Reverse -137 -156 -14.0619 0.271
NP_442790.1_4 Reverse -277 -296 -15.2418 0.289
NP_442262.1_10 Forward -294 -287 14.1988 0.0123
NP_442262.1_10 Reverse -287 -294 14.1988 0.0123
NP_442262.1_10 Reverse -26 -33 12.9205 0.0422
NP_442262.1_10 Reverse -251 -258 10.7572 0.124
NP_442262.1_10 Forward -180 -173 9.47889 0.187
NP_441689.1_5 Reverse -284 -294 8.53436 0.132
NP_441689.1_5 Forward -297 -287 5.78111 0.197
NP_441689.1_5 Reverse -23 -33 5.78111 0.197
NP_441689.1_5 Forward -36 -26 5.48612 0.251
NP_441814.1_5 Reverse -156 -175 6.78429 0.288
NP_442244.1_3 Forward -256 -237 9.0459 0.148
NP_440163.1_10 Reverse -283 -293 14.238 0.102
NP_440163.1_10 Reverse -22 -32 11.3864 0.169
NP_440163.1_10 Forward -163 -153 8.82982 0.26
NP_440344.1_10 Reverse -279 -296 -0.0594896 0.0381
NP_440531.1_6 Reverse -278 -297 2.0644 0.164
NP_440531.1_6 Reverse -1 -20 -4.42544 0.28
NP_440531.1_8 Reverse -155 -174 5.70265 0.249
NP_440189.1_10 Reverse -275 -294 3.6377 0.279
NP_441335.1_8 Reverse -232 -251 10.7175 0.204
NP_441965.1_3 Forward -305 -286 11.5042 0.0966
NP_441965.1_10 Reverse -283 -299 11.7599 0.107
NP_440297.1_9 Forward -294 -284 9.32148 0.0917
NP_440297.1_9 Reverse -173 -183 0.0783647 0.282
NP_440297.1_9 Forward -251 -241 -0.0199663 0.282
NP_440297.1_9 Reverse -287 -297 -0.118297 0.282
NP_440297.1_9 Forward -180 -170 -0.216628 0.282
NP_440297.1_9 Forward -33 -23 -0.511621 0.289
NP_440350.1_2 Forward -35 -16 6.39097 0.248
NP_441592.1_10 Reverse -146 -160 14.4536 0.279
NP_440999.1_2 Forward -324 -305 8.25926 0.292
NP_440999.1_9 Reverse -282 -296 2.2612 0.152
NP_440999.1_9 Reverse -168 -182 -3.34366 0.291
NP_440888.1_2 Forward -295 -281 13.9619 0.022
NP_440888.1_2 Reverse -286 -300 12.6836 0.0405
NP_440888.1_2 Forward -83 -69 9.83206 0.113
NP_440888.1_2 Reverse -157 -171 8.94708 0.142
NP_440600.1_4 Forward -42 -24 5.42735 0.105
NP_440600.1_9 Forward -219 -200 11.8883 0.285
NP_442033.1_10 Reverse -155 -174 -10.522 0.239
NP_441543.1_2 Forward -294 -285 18.486 0.00236
NP_441543.1_2 Reverse -287 -296 16.9127 0.00359
NP_441543.1_2 Reverse -26 -35 11.9961 0.047
NP_441543.1_2 Forward -33 -24 7.07956 0.131
NP_441543.1_2 Reverse -244 -253 6.78456 0.138
NP_442845.1_2 Forward -301 -287 15.6342 0.0694
NP_442845.1_2 Reverse -286 -300 7.37441 0.195
NP_442845.1_2 Reverse -253 -267 4.32615 0.261
NP_441319.1_8 Reverse -280 -298 8.67227 0.231
NP_441918.1_7 Forward -167 -148 2.45773 0.265
NP_441469.1_8 Reverse -285 -294 16.126 0.00797
NP_441469.1_8 Forward -296 -287 6.48957 0.227
NP_441469.1_8 Forward -253 -244 5.70292 0.257
NP_441548.1_2 Forward -75 -56 13.7658 0.212
NP_442315.1_1 Forward -388 -370 8.67227 0.21
NP_442315.1_2 Reverse -34 -46 9.18376 0.291
NP_443064.1_6 Reverse -286 -296 12.5669 0.0796
NP_443064.1_6 Forward -34 -24 8.88251 0.262
NP_442578.1_7 Reverse -26 -33 14.6904 0.026
NP_442578.1_7 Forward -294 -287 14.5921 0.026
NP_442578.1_7 Reverse -287 -294 14.5921 0.026
NP_440710.1_1 Reverse -278 -296 5.82068 0.113
NP_441462.1_2 Forward -295 -285 11.5831 0.00406
NP_441462.1_2 Reverse -286 -296 11.5831 0.00406
NP_441462.1_2 Reverse -25 -35 1.25834 0.0964
NP_441621.1_7 Reverse -241 -255 -5.40861 0.252
NP_441929.1_6 Forward -342 -323 4.32602 0.294
NP_443062.1_1 Forward -34 -16 16.5415 0.0308
NP_443062.1_1 Forward -295 -277 16.1515 0.0321
NP_443062.1_1 Forward -259 -241 10.0085 0.122
NP_440936.1_6 Reverse -380 -392 20.0979 0.057
NP_440939.1_5 Reverse -85 -101 14.4149 0.204
NP_440519.1_3 Forward -82 -63 13.8641 0.137
NP_440519.1_8 Forward -181 -165 3.59845 0.244
NP_442204.1_1 Forward -299 -288 6.94184 0.144
NP_442204.1_5 Forward -262 -243 12.2908 0.0673
NP_440516.1_2 Reverse -280 -298 -2.43913 0.299
NP_440516.1_6 Forward -166 -152 8.3571 0.247
NP_440516.1_6 Forward -361 -347 6.78381 0.289
NP_440516.1_8 Forward -295 -286 16.9127 0.00442
NP_440516.1_8 Reverse -286 -295 16.9127 0.00442
NP_440516.1_8 Reverse -25 -34 0.983037 0.13
NP_442080.1_7 Forward -300 -281 -4.6221 0.296
NP_442428.1_5 Forward -294 -287 15.8704 0.0124
NP_442428.1_5 Reverse -287 -294 15.8704 0.0124
NP_442428.1_5 Reverse -26 -33 6.13563 0.209
NP_442428.1_5 Forward -33 -26 6.0373 0.212
NP_442428.1_5 Forward -251 -244 4.66067 0.244
NP_442428.1_5 Forward -180 -173 4.66067 0.244
NP_440673.1_2 Forward -28 -9 8.1459 0.28
NP_440673.1_3 Forward -293 -286 12.4288 0.0426
NP_440673.1_3 Forward -32 -25 12.4288 0.0426
NP_440673.1_3 Reverse -288 -295 12.4288 0.0426
NP_441714.1_3 Forward -302 -284 16.7346 0.111
NP_441052.1_2 Reverse -286 -296 19.9412 0.00106
NP_441052.1_2 Forward -295 -285 10.5014 0.0285
NP_441052.1_2 Reverse -25 -35 6.76487 0.0863
NP_441052.1_2 Forward -34 -24 1.65166 0.233
NP_442219.1_8 Reverse -282 -301 16.7675 0.0782
NP_442219.1_9 Reverse -287 -296 17.7976 0.00718
NP_442219.1_9 Reverse -26 -35 8.75118 0.0681
NP_442219.1_9 Forward -294 -285 8.35786 0.0681
NP_442219.1_9 Forward -33 -24 7.96454 0.0696
NP_440436.1_4 Forward -294 -285 18.1905 0.00233
NP_440436.1_4 Reverse -287 -296 17.2072 0.00233
NP_440436.1_4 Reverse -158 -167 7.76745 0.124
NP_440436.1_4 Forward -33 -24 7.57079 0.124
NP_440436.1_4 Reverse -26 -35 6.39082 0.162
NP_440436.1_4 Reverse -244 -253 5.80084 0.182
NP_441884.1_8 Reverse -28 -47 -13.8652 0.294
NP_441884.1_9 Reverse -247 -266 -4.81876 0.0594
NP_441884.1_9 Reverse -283 -302 -13.4719 0.138
NP_441884.1_9 Reverse -154 -173 -22.9117 0.284
NP_441884.1_9 Reverse -121 -140 -24.9766 0.29
NP_441719.1_4 Forward -294 -287 16.3621 0.0124
NP_441719.1_4 Reverse -287 -294 16.3621 0.0124
NP_441719.1_4 Reverse -26 -33 13.5105 0.026
NP_441719.1_4 Forward -33 -26 6.52896 0.188
NP_441004.1_1 Reverse -70 -89 -8.55534 0.2
NP_441004.1_1 Reverse -229 -248 -11.0136 0.231
NP_441004.1_1 Forward -301 -282 -15.4385 0.275
NP_441004.1_2 Forward -177 -158 -3.44213 0.28
NP_441004.1_4 Reverse -232 -242 9.32148 0.259
NP_442813.1_4 Forward -79 -60 -6.88371 0.299
NP_442366.1_3 Reverse -285 -303 5.62401 0.0858
NP_442366.1_3 Reverse -242 -260 1.98577 0.137
NP_442366.1_5 Forward -298 -288 17.2858 0.0141
NP_442873.1_3 Reverse -276 -295 15.4366 0.102
NP_442206.1_10 Forward -295 -280 6.86307 0.178
NP_442206.1_10 Reverse -250 -265 -0.413427 0.292
NP_440328.1_4 Forward -301 -282 1.96607 0.213
NP_443054.1_2 Reverse -284 -298 1.76955 0.245
NP_443054.1_2 Forward -59 -45 0.392915 0.267
NP_440864.1_9 Forward -360 -341 -6.98204 0.28
NP_441851.1_10 Reverse -285 -295 16.008 0.00552
NP_441851.1_10 Forward -296 -286 15.8113 0.00552
NP_441851.1_10 Reverse -24 -34 13.0581 0.0372
NP_441851.1_10 Forward -253 -243 4.79825 0.247
NP_442622.1_3 Reverse -245 -264 -3.83545 0.271
NP_442011.1_1 Forward -253 -234 -1.37718 0.268
NP_441668.1_4 Forward -305 -286 -2.36049 0.288
NP_442515.1_1 Forward -296 -282 13.3726 0.0278
NP_442515.1_1 Forward -253 -239 -4.62196 0.298
NP_440593.1_3 Forward -171 -152 0.687771 0.193
NP_440593.1_3 Forward -300 -281 -4.32711 0.246
NP_440593.1_3 Forward -257 -238 -6.29373 0.272
NP_441982.1_6 Reverse -93 -102 12.1034 0.288
NP_441982.1_6 Reverse -59 -68 10.862 0.291
NP_441982.1_6 Reverse -14 -23 10.671 0.295
NP_441046.1_2 Reverse -146 -165 0.786102 0.262
NP_442689.1_8 Reverse -205 -222 1.31714 0.191
NP_442689.1_8 Forward -132 -115 -6.25434 0.28
NP_442689.1_8 Forward -219 -202 -8.0243 0.292
NP_441349.1_9 Forward -80 -62 11.8189 0.299
NP_441349.1_10 Reverse -15 -34 14.1591 0.0159
NP_441349.1_10 Forward -305 -286 -6.1954 0.223
NP_441349.1_10 Reverse -95 -114 -8.06369 0.266
NP_440432.1_9 Reverse -293 -308 4.30646 0.0714
NP_440432.1_9 Forward -294 -279 -1.10174 0.167
NP_440432.1_9 Reverse -26 -41 -3.26502 0.179
NP_441062.1_10 Forward -252 -233 11.7992 0.0996
NP_442843.1_1 Reverse -80 -99 -6.78538 0.245
NP_442843.1_1 Reverse -10 -29 -11.5053 0.291
NP_440474.1_8 Forward -294 -280 13.5686 0.0696
NP_441477.1_10 Forward -302 -284 6.41066 0.181
NP_441477.1_10 Forward -269 -251 0.0191479 0.286
NP_440431.1_3 Forward -200 -181 -9.24366 0.242
NP_442450.1_5 Reverse -284 -294 9.32148 0.115
NP_442450.1_5 Forward -297 -287 7.55152 0.13
NP_442450.1_5 Reverse -23 -33 6.07655 0.204
NP_440588.1_2 Forward -304 -285 7.7676 0.048
NP_442006.1_2 Reverse -241 -258 -15.7924 0.228
NP_442006.1_2 Forward -175 -158 -16.1858 0.243
NP_440483.1_1 Forward -257 -238 4.52268 0.154
NP_441570.1_1 Forward -34 -16 -1.55415 0.0578
NP_441570.1_1 Forward -295 -277 -5.19239 0.0752
NP_441570.1_1 Reverse -25 -43 -9.12563 0.129
NP_441570.1_1 Reverse -286 -304 -17.3854 0.273
NP_441078.1_4 Forward -295 -286 19.6659 0.0007
NP_441078.1_4 Reverse -286 -295 19.6659 0.0007
NP_441078.1_4 Reverse -25 -34 0.0980582 0.205
NP_441078.1_4 Forward -34 -25 0.0980582 0.205
NP_441078.1_4 Forward -166 -157 -1.57357 0.266
NP_441078.1_4 Forward -252 -243 -1.86856 0.272
NP_442729.1_8 Reverse -282 -295 18.8988 0.0312
NP_440526.1_3 Forward -165 -154 3.30311 0.267
NP_440526.1_3 Reverse -287 -298 0.943182 0.267
NP_440526.1_3 Forward -33 -22 0.54986 0.275
NP_441432.1_8 Forward -296 -287 16.8143 0.00595
NP_441432.1_8 Reverse -285 -294 8.25953 0.0755
NP_441432.1_8 Reverse -24 -33 7.27622 0.101
NP_441432.1_8 Forward -167 -158 5.3096 0.17
NP_443024.1_3 Reverse -46 -56 15.2213 0.255
NP_442320.1_8 Reverse -280 -294 4.32615 0.0511
NP_442320.1_8 Reverse -19 -33 1.96621 0.0801
NP_442320.1_8 Forward -301 -287 -4.13031 0.148
NP_442320.1_8 Forward -258 -244 -4.22864 0.151
NP_442320.1_8 Forward -40 -26 -6.19526 0.269
NP_441732.1_2 Reverse -282 -298 -6.92296 0.0558
NP_441732.1_2 Forward -299 -283 -7.51295 0.0859
NP_442815.1_2 Forward -171 -153 3.65739 0.259
NP_440760.1_1 Reverse -286 -305 4.81767 0.0154
NP_440760.1_1 Forward -295 -276 -18.4868 0.214
NP_442797.1_7 Reverse -285 -303 3.85406 0.234
NP_440199.1_10 Reverse -22 -32 16.7946 0.0381
NP_441057.1_4 Forward -182 -164 -3.32411 0.289
NP_442353.1_4 Forward -301 -282 12.585 0.0776
NP_441072.1_2 Reverse -282 -301 9.24257 0.22
NP_442489.1_2 Reverse -281 -300 5.11266 0.202
NP_442489.1_7 Forward -295 -286 20.1576 0.000695
NP_442489.1_7 Reverse -286 -295 20.1576 0.000695
NP_442489.1_7 Forward -34 -25 7.57121 0.057
NP_442489.1_7 Reverse -25 -34 0.589713 0.17
NP_442489.1_7 Forward -252 -243 -1.37691 0.195
NP_442489.1_7 Forward -166 -157 -1.37691 0.195
NP_442489.1_7 Reverse -157 -166 -2.06522 0.288
NP_442079.1_7 Forward -294 -275 0.491109 0.283
NP_440559.1_1 Reverse -287 -296 17.4043 0.00658
NP_440559.1_1 Reverse -26 -35 14.4544 0.0174
NP_440559.1_1 Forward -294 -285 8.75118 0.0586
NP_440559.1_1 Forward -33 -24 7.76787 0.0918
NP_441659.2_8 Reverse -286 -296 18.1713 0.00133
NP_441659.2_8 Forward -295 -285 11.9764 0.0147
NP_441659.2_8 Forward -34 -24 6.27322 0.0797
NP_441659.2_8 Reverse -157 -167 2.92996 0.181
NP_442913.1_10 Forward -175 -156 6.88262 0.0577
NP_442913.1_10 Forward -304 -285 2.45773 0.125
NP_441040.1_2 Forward -260 -241 -8.16202 0.236
NP_442346.1_5 Forward -296 -286 16.6963 0.00248
NP_442346.1_5 Reverse -285 -295 9.02648 0.118
NP_442346.1_5 Reverse -24 -34 7.05986 0.183
NP_442346.1_5 Forward -161 -151 5.68323 0.234
NP_442346.1_5 Reverse -156 -166 4.99491 0.267
NP_442346.1_5 Forward -35 -25 4.69992 0.276
NP_440352.1_5 Reverse -288 -307 12.0717 0.243
NP_440545.1_3 Forward -299 -282 9.87194 0.0368
NP_440545.1_3 Forward -170 -153 -4.68105 0.23
NP_440025.1_1 Forward -38 -19 13.0775 0.147
NP_440459.1_2 Reverse -284 -301 14.3952 0.119
NP_440459.1_2 Forward -304 -287 11.0519 0.183
NP_440459.1_2 Forward -261 -244 7.61033 0.285
NP_440010.1_4 Forward -176 -157 2.26028 0.225
NP_442551.1_4 Reverse -155 -170 -2.18338 0.256
NP_442603.1_7 Reverse -286 -300 14.0603 0.0733
NP_442603.1_7 Forward -295 -281 6.48882 0.24
NP_441233.1_1 Forward -258 -239 4.03102 0.28
NP_441888.1_7 Reverse -281 -295 2.85119 0.225
NP_441833.1_4 Forward -294 -287 15.9687 0.0124
NP_441833.1_4 Reverse -287 -294 15.9687 0.0124
NP_441833.1_4 Forward -33 -26 6.52896 0.0924
NP_441833.1_4 Reverse -26 -33 6.23397 0.163
NP_442699.1_8 Reverse -116 -135 -12.1936 0.24
NP_442162.1_9 Forward -294 -287 16.2637 0.0124
NP_442162.1_9 Reverse -287 -294 16.2637 0.0124
NP_442162.1_9 Reverse -26 -33 6.62729 0.142
NP_442162.1_9 Forward -33 -26 6.52896 0.178
NP_440671.1_4 Reverse -19 -33 11.5043 0.132
NP_442045.1_5 Reverse -154 -173 8.65258 0.182
NP_442140.1_3 Reverse -287 -297 12.2714 0.0632
NP_442140.1_3 Forward -294 -284 8.33817 0.119
NP_442140.1_3 Forward -251 -241 5.28991 0.216
NP_442140.1_3 Forward -180 -170 5.09324 0.227
NP_441692.1_2 Forward -327 -308 9.0459 0.0714
NP_441813.1_5 Reverse -284 -294 17.188 0.00979
NP_441813.1_5 Forward -297 -287 8.63316 0.0367
NP_441813.1_5 Reverse -23 -33 6.17489 0.1
NP_440590.1_4 Reverse -287 -300 19.4888 0.00651
NP_440590.1_4 Forward -258 -245 1.88757 0.108
NP_440590.1_4 Reverse -244 -257 0.60927 0.148
NP_440590.1_4 Forward -294 -281 -5.29059 0.277
NP_440567.1_1 Reverse -287 -301 13.3726 0.0213
NP_440567.1_1 Forward -294 -280 11.111 0.0302
NP_442497.1_10 Forward -294 -285 10.4228 0.0087
NP_442497.1_10 Reverse -287 -296 10.4228 0.0087
NP_442497.1_10 Forward -33 -24 0.589713 0.153
NP_442497.1_10 Reverse -26 -35 -1.18024 0.256
NP_440821.1_4 Reverse -284 -294 19.0562 0.00399
NP_440821.1_4 Forward -297 -287 9.41981 0.0286
NP_440821.1_4 Reverse -23 -33 8.53483 0.0468
NP_440821.1_4 Reverse -241 -251 -0.314959 0.251
NP_440821.1_4 Reverse -170 -180 -0.708283 0.287
NP_441239.1_9 Reverse -284 -296 13.3137 0.037
NP_441239.1_9 Forward -254 -242 10.2654 0.0834
NP_441239.1_9 Reverse -241 -253 8.20045 0.141
NP_441239.1_9 Forward -297 -285 5.93884 0.202
NP_441951.1_4 Forward -301 -282 1.57275 0.283
NP_441951.1_9 Forward -141 -122 -0.983855 0.283
NP_440156.1_4 Forward -243 -233 18.3674 0.176
NP_440156.1_4 Forward -156 -146 16.4991 0.176
NP_441892.1_1 Reverse -16 -33 4.85706 0.105
NP_441892.1_1 Forward -43 -26 3.18543 0.129
NP_441892.1_4 Reverse -156 -175 -2.36049 0.297
NP_440604.1_6 Forward -295 -276 0.392778 0.166
NP_441508.1_4 Reverse -61 -75 14.9084 0.258
NP_441017.1_6 Reverse -21 -35 12.3887 0.221
NP_440949.1_7 Reverse -278 -297 9.14342 0.264
NP_440546.1_4 Forward -295 -285 11.8882 0.0679
NP_440546.1_4 Reverse -286 -296 10.046 0.109
NP_440546.1_4 Forward -268 -258 9.07643 0.156
NP_442349.1_6 Forward -280 -261 -3.14714 0.281
NP_441509.1_8 Forward -52 -38 19.2718 0.0881
NP_440462.1_6 Reverse -284 -294 15.418 0.0142
NP_440462.1_6 Reverse -23 -33 4.50326 0.197
NP_440462.1_6 Reverse -248 -258 2.04498 0.294
NP_440462.1_6 Forward -297 -287 1.35667 0.294
NP_442340.1_3 Forward -266 -247 -7.96535 0.241
NP_440868.1_4 Reverse -282 -294 10.6587 0.0364
NP_440868.1_4 Forward -299 -287 8.6921 0.0582
NP_440401.1_9 Forward -44 -37 14.5917 0.287
NP_441497.1_6 Forward -224 -205 14.6508 0.259
NP_441474.1_1 Reverse -276 -295 -3.34455 0.298
NP_442402.1_4 Forward -30 -11 -2.06626 0.195
NP_442402.1_4 Reverse -327 -346 -10.031 0.296
NP_442402.1_9 Forward -73 -54 9.0459 0.277
NP_441848.1_4 Reverse -204 -220 7.64616 0.288
NP_440653.1_10 Reverse -244 -263 3.14605 0.285
NP_442460.1_2 Forward -72 -53 12.3892 0.127
NP_440696.1_3 Forward -262 -244 2.28076 0.216
NP_440696.1_6 Forward -376 -357 10.4225 0.207
NP_442358.1_1 Reverse -278 -296 19.6853 0.0871
NP_442039.1_4 Forward -294 -287 15.1821 0.0124
NP_442039.1_4 Reverse -287 -294 15.1821 0.0124
NP_442039.1_7 Forward -250 -240 7.15819 0.279
NP_441811.1_8 Forward -301 -287 7.66941 0.241
NP_440825.1_7 Reverse -287 -297 12.9096 0.152
NP_442837.1_3 Forward -294 -287 15.7721 0.0124
NP_442837.1_3 Reverse -287 -294 15.7721 0.0124
NP_442837.1_3 Forward -33 -26 12.1338 0.0702
NP_442837.1_3 Reverse -26 -33 6.0373 0.25
NP_442053.1_1 Forward -295 -286 18.3876 0.0007
NP_442053.1_1 Reverse -286 -295 18.3876 0.0007
NP_442053.1_1 Forward -34 -25 6.8829 0.111
NP_440505.1_3 Reverse -284 -294 13.8447 0.0247
NP_440505.1_3 Forward -297 -287 9.22315 0.122
NP_440505.1_3 Reverse -23 -33 7.45319 0.154
NP_440505.1_7 Reverse -329 -348 0.294447 0.259
NP_442360.1_5 Reverse -69 -79 13.2547 0.28
NP_442532.1_7 Forward -295 -281 4.52282 0.171
NP_442532.1_7 Forward -252 -238 2.2612 0.25
NP_440914.1_1 Reverse -286 -296 17.5935 0.000537
NP_440914.1_1 Forward -166 -156 12.9091 0.0435
NP_440914.1_1 Forward -295 -285 8.6151 0.186
NP_440914.1_1 Forward -34 -24 7.24882 0.242
NP_441011.1_8 Forward -294 -285 16.9127 0.00602
NP_441011.1_8 Reverse -287 -296 8.25953 0.144
NP_441011.1_8 Reverse -336 -345 7.57121 0.17
NP_442101.1_10 Forward -303 -284 -10.227 0.255
NP_442533.1_6 Forward -295 -286 17.2076 0.00137
NP_442533.1_6 Reverse -286 -295 17.2076 0.00137
NP_442533.1_6 Reverse -25 -34 5.40793 0.14
NP_442533.1_6 Reverse -243 -252 5.01461 0.16
NP_442533.1_6 Forward -18 -9 2.55633 0.25
NP_442541.1_10 Reverse -157 -171 2.06395 0.269
NP_440263.1_5 Forward -130 -116 7.17775 0.294
NP_442322.1_4 Forward -91 -74 -9.89323 0.297
NP_441482.1_7 Reverse -280 -294 -3.54032 0.129
NP_441482.1_7 Reverse -19 -33 -11.1118 0.237
NP_439944.1_9 Reverse -287 -297 10.5014 0.0887
NP_439944.1_9 Forward -294 -284 10.3048 0.0887
NP_439944.1_9 Forward -33 -23 9.22315 0.1
NP_441028.1_6 Reverse -272 -282 5.48612 0.255
NP_440116.1_5 Forward -298 -281 5.05372 0.176
NP_440115.1_6 Forward -298 -288 8.33817 0.13
NP_441602.1_3 Forward -264 -245 6.39097 0.132
NP_441106.1_1 Reverse -285 -294 18.191 0.0028
NP_441106.1_1 Forward -296 -287 9.63616 0.0311
NP_441106.1_1 Forward -253 -244 5.50626 0.145
NP_441825.1_4 Forward -73 -63 16.1063 0.186
NP_439903.1_6 Forward -304 -285 6.48849 0.167
NP_439903.1_6 Reverse -283 -302 0.0970122 0.271
NP_442588.1_6 Forward -80 -61 5.211 0.175
NP_442588.1_6 Forward -81 -62 4.916 0.175
NP_441286.1_1 Forward -296 -284 14.4936 0.00418
NP_441286.1_1 Reverse -285 -297 3.38223 0.0467
NP_441286.1_1 Forward -35 -23 2.39892 0.065
NP_441286.1_1 Reverse -156 -168 -0.551008 0.135
NP_441286.1_1 Forward -182 -170 -5.66422 0.213
NP_441286.1_1 Reverse -24 -36 -5.76255 0.223
NP_442058.1_5 Reverse -227 -246 16.9124 0.181
NP_440670.1_8 Forward -295 -286 18.3876 0.000699
NP_440670.1_8 Reverse -286 -295 18.3876 0.000699
NP_441479.1_1 Reverse -230 -249 6.68596 0.292
NP_440886.1_7 Reverse -285 -295 17.7774 0.0011
NP_440886.1_7 Forward -296 -286 7.94438 0.0805
NP_442614.1_2 Reverse -286 -300 6.19444 0.291
NP_442382.1_9 Reverse -153 -172 8.75009 0.281
NP_439995.1_5 Reverse -276 -295 14.7491 0.141
NP_442072.1_9 Reverse -285 -303 -12.4689 0.0852
NP_441753.1_10 Reverse -277 -296 4.32602 0.198
NP_441753.1_10 Forward -310 -291 3.93269 0.204
NP_440223.1_7 Reverse -140 -154 12.291 0.244
NP_440907.2_8 Forward -294 -284 7.84605 0.117
NP_440907.2_8 Reverse -287 -297 7.64939 0.117
NP_439967.1_7 Reverse -285 -303 9.16393 0.252
NP_441021.1_1 Reverse -173 -192 -11.8003 0.274
NP_441021.1_8 Forward -300 -282 1.78911 0.258
NP_441463.1_3 Reverse -276 -295 9.24257 0.0481
NP_441463.1_3 Reverse -15 -34 -4.03212 0.191
NP_441463.1_6 Reverse -155 -169 8.15534 0.25
NP_442893.1_4 Reverse -201 -220 1.47364 0.201
NP_441626.1_2 Forward -294 -287 15.7721 0.0124
NP_441626.1_2 Reverse -287 -294 15.7721 0.0124
NP_441626.1_2 Reverse -26 -33 6.13563 0.177
NP_441626.1_2 Forward -33 -26 5.93897 0.231
NP_441988.1_10 Forward -257 -245 18.4269 0.231
NP_442365.1_7 Forward -299 -280 7.86593 0.0918
NP_442365.1_7 Reverse -288 -307 -4.22878 0.238
NP_442238.1_7 Forward -55 -36 7.57013 0.248
NP_442794.1_1 Forward -299 -287 12.4287 0.0721
NP_441962.1_4 Forward -171 -152 5.80098 0.0932
NP_441962.1_4 Forward -300 -281 4.42435 0.0974
NP_441962.1_4 Reverse -167 -186 -13.3736 0.272
NP_440387.1_1 Forward -295 -279 22.6747 0.00191
NP_440387.1_1 Reverse -286 -302 14.6115 0.00635
NP_441488.1_8 Forward -300 -286 12.192 0.146
NP_441193.1_6 Reverse -26 -45 2.94938 0.246
NP_440634.1_4 Forward -303 -284 8.84924 0.257
NP_441993.1_1 Reverse -286 -305 3.99329 0.227
NP_440467.1_8 Forward -280 -261 11.4058 0.243
NP_440114.1_10 Forward -295 -281 11.406 0.115
NP_442698.1_10 Forward -299 -280 -0.688862 0.297
NP_440492.1_9 Forward -193 -179 10.4651 0.294
NP_441272.1_4 Forward -151 -132 0.982764 0.253
NP_440766.1_4 Forward -299 -285 8.75105 0.0871
NP_441237.1_9 Reverse -287 -297 14.828 0.0242
NP_442930.1_1 Reverse -213 -223 13.3526 0.239
NP_439910.1_2 Reverse -278 -295 -21.3973 0.183
NP_440457.1_1 Forward -299 -287 0.137309 0.25
NP_440457.1_1 Reverse -282 -294 -0.0593532 0.25
NP_440457.1_1 Reverse -21 -33 -0.256015 0.259
NP_440798.1_6 Reverse -287 -300 6.60746 0.14
NP_442297.1_4 Reverse -70 -89 15.8366 0.145
NP_441984.1_3 Reverse -239 -257 7.59063 0.245
NP_441436.1_8 Forward -296 -277 10.0292 0.262
NP_440473.1_1 Forward -298 -279 11.3538 0.276
NP_442509.1_9 Forward -295 -285 16.2041 0.00739
NP_442509.1_9 Reverse -286 -296 8.14104 0.192
NP_442936.1_10 Forward -111 -97 7.34979 0.283
NP_441159.1_1 Reverse -191 -210 -3.83545 0.286
NP_440554.1_4 Forward -294 -284 14.6313 0.02
NP_441885.1_5 Reverse -286 -296 20.9245 0.000538
NP_441885.1_5 Forward -295 -285 11.4848 0.00668
NP_441885.1_5 Reverse -25 -35 10.2065 0.012
NP_441885.1_5 Forward -34 -24 1.35667 0.11
NP_442228.1_7 Reverse -81 -95 18.6477 0.145
NP_442703.1_4 Reverse -48 -67 5.2102 0.282
NP_442703.1_9 Forward -224 -206 4.54237 0.249
NP_442341.1_7 Reverse -285 -299 17.6992 0.0111
NP_442341.1_7 Forward -296 -282 15.3392 0.0229
NP_442341.1_7 Forward -260 -246 10.1277 0.0682
NP_442341.1_9 Reverse -284 -298 13.1753 0.0878
NP_441756.1_5 Forward -254 -235 -4.6221 0.295
NP_440409.1_1 Forward -174 -155 -0.590531 0.216
NP_443000.1_7 Forward -297 -287 10.3048 0.0345
NP_443000.1_7 Reverse -284 -294 8.73149 0.0437
NP_443000.1_7 Reverse -23 -33 7.35486 0.0859
NP_441842.1_1 Reverse -288 -301 15.555 0.0619
NP_441842.1_10 Forward -259 -245 6.48943 0.286
NP_440275.1_3 Reverse -284 -294 8.4365 0.0602
NP_440275.1_3 Forward -297 -287 8.04317 0.0602
NP_440091.1_1 Reverse -21 -33 6.72548 0.0921
NP_440091.1_1 Forward -38 -26 1.7106 0.197
NP_440091.1_1 Reverse -282 -294 1.41561 0.197
NP_443060.1_5 Forward -303 -284 5.01354 0.271
NP_440679.1_10 Forward -293 -274 -8.65367 0.18
NP_442451.1_2 Forward -174 -155 1.17943 0.146
NP_442451.1_2 Forward -303 -284 -8.85033 0.254
NP_440149.1_8 Forward -295 -276 2.85105 0.104
NP_441105.1_3 Forward -306 -287 -4.52377 0.201
NP_441105.1_3 Forward -263 -244 -4.91709 0.209
NP_440216.1_1 Reverse -286 -300 0.491246 0.0284
NP_440216.1_1 Forward -295 -281 -2.55701 0.0521
NP_440216.1_1 Reverse -25 -39 -11.5051 0.192
NP_440216.1_9 Forward -235 -226 5.89959 0.289
NP_440172.1_1 Reverse -286 -296 15.0247 0.00945
NP_440172.1_1 Forward -295 -285 8.73149 0.0586
NP_440172.1_1 Reverse -25 -35 7.55152 0.0761
NP_440172.1_1 Forward -57 -47 7.45319 0.0789
NP_440172.1_6 Reverse -13 -32 4.22769 0.299
NP_442015.1_10 Forward -299 -286 20.2755 0.00366
NP_442015.1_10 Reverse -282 -295 0.707601 0.221
NP_442015.1_10 Reverse -69 -82 -0.0790467 0.25
NP_441226.1_7 Forward -294 -287 14.4934 0.0123
NP_441226.1_7 Reverse -287 -294 14.4934 0.0123
NP_441226.1_7 Reverse -293 -300 9.47853 0.147
NP_441111.1_7 Forward -294 -286 18.7023 0.00294
NP_441111.1_7 Reverse -287 -295 18.7023 0.00294
NP_441111.1_7 Forward -33 -25 8.86921 0.0589
NP_441111.1_7 Reverse -244 -252 -0.570565 0.233
NP_442379.1_10 Forward -302 -285 0.825489 0.223
NP_441766.1_2 Forward -295 -286 17.5026 0.00297
NP_441766.1_2 Reverse -286 -295 17.5026 0.00297
NP_441766.1_2 Reverse -25 -34 8.1612 0.0645
NP_442417.1_5 Forward -295 -281 12.6843 0.094
NP_440416.1_9 Reverse -156 -175 -10.9153 0.147
NP_440416.1_9 Forward -302 -283 -18.8801 0.266
NP_440416.1_9 Reverse -279 -298 -21.9284 0.298
NP_443052.1_8 Reverse -276 -295 -10.227 0.206
NP_443052.1_8 Reverse -233 -252 -12.6852 0.259
NP_443052.1_9 Forward -257 -238 -4.91709 0.262
NP_442116.1_6 Reverse -104 -121 5.78166 0.291
NP_442154.1_1 Forward -72 -54 -18.8604 0.286
NP_440261.1_5 Reverse -287 -300 -2.53732 0.0924
NP_440261.1_5 Forward -294 -281 -10.4038 0.201
NP_440261.1_5 Forward -180 -167 -12.3704 0.284
NP_440988.1_5 Forward -60 -41 14.9076 0.216
NP_440988.1_10 Reverse -155 -169 10.8044 0.187
NP_440988.1_10 Forward -168 -154 9.93309 0.19
NP_440988.1_10 Reverse -284 -298 8.09365 0.205
NP_440988.1_10 Forward -255 -241 4.80201 0.25
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACGCTTAATGTAAAGATTTGTACGGTTCTGATTATAGCTGACCCTGTTCGTGGTTAGGGGATAACTAACGGGCAATGCTCAACTAAAGGGCAACAATGAGCCGTTGGCGATCGCCGTAATGTGGGTAAGCAGACCCATGGTTTCCATCGGCGCTGGCACCATTTCGCCACGAAAGTCGAGAATTTGTACTAAAACTAGATACGCTACAGCTAAAATAATTGAGATGGCACCGGTGACAATGGCCACGATTTTGCCTGAATCCATAGTGAGTTTCGCCCCAATTTTCGTCGGGAGATTATTTTCGCCTAATCCTACCACGGCTTCCCCAGGGGTTTTTGGGTAGGCCAATTTCTCCTAACCCCAATTATCGATCGCCATTTTTAGCCAGCACCATTTGAGT

CDS

ATGACTCCTTCCCTAACCCTTCCCGCACCGGCATTTACTGAAGCAACCTCCTGGGAATGTTGGCGACAAATGCAACAAGTTTCCCTAACCATCCATGGCCCAGACCACCCCAGTGCCATCACCGTGGACACCAACTATATGGATGAAGGCCAGGGGGAACCCATGCTTTTTATACATGGCTTTGACAGTTCGGTGTTGGAGTTTCGTCGCCTACTGCCCCTAATCAAAAAAAATTTTCGGGCGATCGCCATTGATTTGCTGGGATTTGGTTTCACAACTAGATCCAAGATATTACTACCCACCCCAGCCAACATCAAAATTCACCTAGACCACTTTTGGCAAACAATTATTCAAGAACCCATTACCTTAGTGGGGGTATCCATGGGGGGAGCAGTGGCCCTAGATTTTTGCCTCAGCTTTCCCGAACGGGTCAAAAAACTAGTGCTAATAGATAGTGCTGGCCTCGCGAAACAACCCTTTGCCAGTCGGCTCATGTTTCCACCGTTGGACCGTTGGCTAACCAATTTTTTAGCCAGCCCACAGGTCAGACAAAGTATTGGCCAGACCGCCTATTACAACCGGAGTCTAGCCAGTGAAGATGCCCGCCTCTGTGCCGCTGCCCATTTAACCTGCCCGGGTTGGAGCGAAGGATTGATTGCCTTCAGCAAAAGTGGTGGTTATGGCTCCTTTGCCGAGCAATTGGGGCAAATTACTTTGCCTAGCCTAATTATTTGGGGTAAACAGGACAAAATTTTGGGTGTTAGAGCGGCTGAACGATTCCAAAATCTTTTGCCCCAGAGTCAATTAATCTGGCTTGATGCCTGTGGCCATGTGCCCCATCTGGAACAACCCGAAGCTACCGCCGCCGCCCTCAGACAATTTTGCCTATGA

Protein

MTPSLTLPAPAFTEATSWECWRQMQQVSLTIHGPDHPSAITVDTNYMDEGQGEPMLFIHGFDSSVLEFRRLLPLIKKNFRAIAIDLLGFGFTTRSKILLPTPANIKIHLDHFWQTIIQEPITLVGVSMGGAVALDFCLSFPERVKKLVLIDSAGLAKQPFASRLMFPPLDRWLTNFLASPQVRQSIGQTAYYNRSLASEDARLCAAAHLTCPGWSEGLIAFSKSGGYGSFAEQLGQITLPSLIIWGKQDKILGVRAAERFQNLLPQSQLIWLDACGHVPHLEQPEATAAALRQFCL