Your browser is old and dusty. Try Google Chrome!

Details for sll1123

ORF sll1123
Accession NP_440689.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -341 -355 15.4376 0.104
NP_442711.1_1 Reverse -153 -167 14.1593 0.153
NP_441061.1_2 Reverse -64 -78 13.0776 0.0424
NP_441061.1_2 Forward -349 -335 1.86788 0.181
NP_441061.1_2 Reverse -321 -335 0.294584 0.213
NP_441061.1_2 Reverse -252 -266 -0.787057 0.239
NP_441061.1_2 Forward -71 -57 -1.47537 0.262
NP_440557.1_1 Reverse -342 -361 6.88262 0.148
NP_440795.1_7 Forward -349 -342 14.6904 0.0123
NP_440795.1_7 Reverse -342 -349 14.6904 0.0123
NP_440795.1_7 Reverse -321 -328 10.2655 0.154
NP_440795.1_7 Forward -265 -258 8.39725 0.213
NP_441418.1_6 Forward -350 -331 7.37428 0.00614
NP_441418.1_6 Reverse -341 -360 -20.8467 0.129
NP_441418.1_6 Reverse -63 -82 -22.125 0.169
NP_441418.1_6 Forward -84 -65 -30.2865 0.267
NP_440897.1_2 Reverse -135 -154 23.5989 0.0215
NP_440897.1_6 Reverse -326 -345 1.08032 0.171
NP_441453.1_1 Reverse -334 -352 17.5212 0.063
NP_441453.1_1 Reverse -56 -74 10.7364 0.127
NP_441453.1_4 Reverse -341 -349 16.539 0.00633
NP_441453.1_4 Forward -350 -342 16.539 0.00633
NP_441453.1_4 Reverse -63 -71 14.7691 0.0119
NP_441453.1_4 Forward -72 -64 6.80426 0.121
NP_441453.1_4 Forward -329 -321 4.05099 0.268
NP_441623.1_1 Forward -253 -235 -5.09406 0.283
NP_442151.1_6 Forward -72 -58 11.6026 0.0956
NP_442151.1_6 Forward -78 -64 10.7177 0.118
NP_442151.1_6 Reverse -341 -355 10.4227 0.123
NP_442151.1_6 Reverse -63 -77 7.9644 0.184
NP_442151.1_6 Reverse -257 -271 7.86607 0.188
NP_442151.1_6 Reverse -69 -83 5.30946 0.284
NP_440561.1_6 Reverse -58 -77 18.6823 0.168
NP_441818.1_1 Forward -349 -338 8.51463 0.288
NP_441818.1_9 Reverse -157 -176 4.71934 0.156
NP_441818.1_9 Reverse -352 -371 -0.787193 0.196
NP_440758.1_2 Forward -81 -62 6.68596 0.131
NP_440226.1_1 Reverse -341 -360 5.11266 0.166
NP_442623.1_3 Reverse -64 -83 -9.53865 0.141
NP_440150.1_2 Reverse -65 -84 9.24175 0.22
NP_440150.1_6 Reverse -323 -342 6.88262 0.223
NP_440150.1_6 Forward -75 -56 2.85105 0.265
NP_440150.1_6 Reverse -174 -193 1.27776 0.295
NP_442173.1_1 Forward -349 -341 15.4574 0.00633
NP_442173.1_1 Reverse -342 -350 15.4574 0.00633
NP_442173.1_1 Forward -71 -63 12.0158 0.0316
NP_442173.1_1 Reverse -64 -72 12.0158 0.0316
NP_442752.1_4 Forward -350 -343 13.8055 0.0199
NP_442752.1_4 Reverse -341 -348 13.8055 0.0199
NP_442752.1_4 Forward -72 -65 13.8055 0.0199
NP_442752.1_4 Reverse -367 -374 10.8555 0.0846
NP_443027.1_4 Forward -352 -342 13.2547 0.0521
NP_443027.1_4 Reverse -339 -349 7.35486 0.24
NP_441745.1_3 Forward -347 -328 16.4199 0.211
NP_440784.1_7 Forward -349 -342 15.9687 0.0123
NP_440784.1_7 Reverse -342 -349 15.9687 0.0123
NP_440784.1_7 Forward -71 -64 6.23397 0.241
NP_440784.1_7 Reverse -64 -71 6.13563 0.241
NP_442909.1_7 Reverse -64 -78 9.14375 0.156
NP_440061.1_9 Forward -352 -338 11.4053 0.111
NP_440061.1_9 Forward -234 -220 5.89884 0.266
NP_440110.1_8 Reverse -160 -179 -3.14714 0.288
NP_441054.1_1 Forward -79 -65 19.6658 0.121
NP_441054.1_2 Reverse -378 -397 12.4875 0.229
NP_441054.1_4 Reverse -53 -71 -2.43913 0.234
NP_442062.1_8 Forward -350 -340 17.6796 0.00193
NP_442062.1_8 Reverse -341 -351 10.3048 0.0493
NP_442062.1_8 Forward -72 -62 8.23984 0.0793
NP_442062.1_8 Reverse -63 -73 7.55152 0.0946
NP_442062.1_8 Reverse -354 -364 4.40493 0.217
NP_440761.1_4 Forward -83 -64 -20.3551 0.287
NP_441859.1_3 Reverse -62 -81 9.83173 0.125
NP_440304.1_4 Reverse -339 -349 18.9579 0.00406
NP_440304.1_4 Forward -352 -342 10.8948 0.051
NP_440304.1_4 Reverse -61 -71 8.1415 0.0859
NP_442268.1_9 Reverse -352 -371 18.584 0.181
NP_442242.1_4 Forward -349 -342 14.3954 0.0124
NP_442242.1_4 Reverse -342 -349 14.3954 0.0124
NP_440044.1_8 Forward -349 -330 2.0644 0.158
NP_442762.1_10 Reverse -141 -160 -12.3902 0.284
NP_439918.1_2 Reverse -187 -206 -5.21209 0.298
NP_439918.1_3 Reverse -301 -320 10.0292 0.249
NP_441200.1_4 Forward -93 -74 5.89931 0.291
NP_441935.1_1 Reverse -178 -197 7.47261 0.24
NP_441208.1_9 Reverse -338 -352 8.65272 0.219
NP_441208.1_9 Forward -218 -204 6.09611 0.253
NP_441594.1_6 Forward -81 -62 11.7992 0.116
NP_441594.1_6 Reverse -66 -85 6.88262 0.182
NP_441594.1_6 Reverse -332 -351 4.81767 0.211
NP_440370.1_10 Reverse -332 -351 11.4058 0.186
NP_442276.1_2 Reverse -51 -70 2.55606 0.299
NP_440132.1_1 Forward -352 -334 16.3421 0.0864
NP_442110.1_7 Reverse -341 -355 12.3893 0.0586
NP_442110.1_7 Reverse -63 -77 8.06273 0.101
NP_442110.1_7 Reverse -186 -200 2.75286 0.222
NP_442110.1_7 Forward -350 -336 2.16287 0.222
NP_441925.1_4 Forward -194 -175 -15.3409 0.263
NP_441925.1_4 Forward -195 -176 -17.5041 0.296
NP_440273.1_1 Reverse -15 -34 13.0342 0.243
NP_440856.1_1 Forward -82 -63 -3.83545 0.231
NP_440856.1_4 Forward -357 -338 -0.787193 0.187
NP_440856.1_4 Forward -79 -60 -0.787193 0.187
NP_441083.1_5 Forward -350 -340 19.3512 0.000718
NP_441083.1_5 Reverse -63 -73 19.0562 0.00147
NP_441083.1_5 Forward -72 -62 16.7946 0.00546
NP_441083.1_5 Reverse -341 -351 11.2881 0.0159
NP_441083.1_5 Forward -237 -227 4.69992 0.134
NP_441083.1_5 Forward -186 -176 3.22496 0.178
NP_441083.1_5 Forward -376 -366 -0.0199663 0.251
NP_441083.1_5 Reverse -228 -238 -0.216628 0.261
NP_442827.1_8 Forward -358 -339 0.392004 0.21
NP_442827.1_8 Forward -80 -61 -0.787962 0.235
NP_441738.1_2 Forward -348 -341 15.28 0.0102
NP_441738.1_2 Reverse -343 -350 15.28 0.0102
NP_441738.1_2 Reverse -65 -72 15.28 0.0102
NP_441738.1_2 Forward -184 -177 8.29857 0.176
NP_441558.1_5 Reverse -339 -358 20.7473 0.00412
NP_441558.1_5 Forward -352 -333 10.1275 0.105
NP_441558.1_5 Forward -74 -55 4.71934 0.271
NP_441955.1_10 Reverse -355 -369 17.6992 0.243
NP_440209.1_1 Reverse -341 -349 18.1123 0.00295
NP_440209.1_1 Forward -350 -342 18.1123 0.00295
NP_440209.1_1 Forward -72 -64 8.57422 0.0425
NP_440209.1_1 Reverse -63 -71 8.47588 0.0457
NP_440209.1_1 Reverse -367 -375 5.13263 0.17
NP_441444.1_1 Reverse -281 -300 5.99764 0.26
NP_442765.1_1 Reverse -356 -375 21.5339 0.0202
NP_442889.1_8 Reverse -60 -74 6.19383 0.199
NP_440447.1_6 Reverse -55 -73 13.7855 0.0722
NP_440447.1_6 Reverse -333 -351 1.39578 0.266
NP_441713.1_1 Reverse -335 -354 -7.4737 0.13
NP_441713.1_1 Forward -356 -337 -14.9469 0.26
NP_441770.1_10 Reverse -61 -80 10.7175 0.23
NP_440178.1_7 Reverse -340 -359 -20.7484 0.199
NP_440178.1_7 Reverse -62 -81 -21.6334 0.232
NP_442570.1_3 Reverse -333 -352 -6.49039 0.258
NP_441792.1_6 Reverse -180 -198 11.8181 0.26
NP_440538.1_10 Forward -372 -353 21.1406 0.0366
NP_441716.1_1 Forward -350 -336 10.816 0.0936
NP_441716.1_1 Reverse -257 -271 9.63603 0.111
NP_443013.1_4 Reverse -58 -77 17.6007 0.0927
NP_441327.1_1 Reverse -14 -33 6.32778 0.25
NP_442111.1_4 Reverse -340 -354 20.1574 0.00327
NP_442111.1_4 Forward -351 -337 15.7325 0.0201
NP_442111.1_4 Reverse -62 -76 10.521 0.0535
NP_442111.1_4 Forward -73 -59 2.65453 0.268
NP_441163.1_1 Forward -324 -307 4.36469 0.289
NP_441163.1_1 Forward -70 -53 4.16803 0.291
NP_440906.1_5 Forward -349 -342 15.8704 0.0124
NP_440906.1_5 Reverse -342 -349 15.8704 0.0124
NP_440906.1_5 Forward -71 -64 6.23397 0.234
NP_440906.1_5 Reverse -64 -71 6.13563 0.241
NP_440747.1_10 Forward -353 -341 17.1486 0.000663
NP_440747.1_10 Reverse -338 -350 7.80712 0.00223
NP_440747.1_10 Forward -75 -63 7.51213 0.00286
NP_440747.1_10 Reverse -317 -329 -11.7607 0.142
NP_440747.1_10 Reverse -60 -72 -11.8591 0.161
NP_440747.1_10 Forward -341 -329 -12.1541 0.227
NP_440747.1_10 Reverse -254 -266 -12.5474 0.297
NP_441130.1_10 Reverse -339 -353 7.76774 0.149
NP_441130.1_10 Reverse -61 -75 5.01447 0.251
NP_441486.1_1 Forward -353 -339 -4.81863 0.209
NP_442850.1_8 Forward -354 -335 15.2449 0.243
NP_442634.1_4 Forward -352 -338 16.8142 0.01
NP_442634.1_4 Reverse -339 -353 6.6861 0.0489
NP_442634.1_4 Reverse -61 -75 2.94952 0.124
NP_442634.1_4 Reverse -318 -332 -3.83532 0.17
NP_441265.1_3 Reverse -335 -349 6.78443 0.181
NP_440470.1_5 Forward -35 -16 9.7875 0.21
NP_440403.1_10 Reverse -60 -79 6.88262 0.212
NP_440842.1_10 Reverse -60 -74 2.16287 0.277
NP_443017.1_1 Reverse -20 -39 15.0336 0.274
NP_441014.1_5 Reverse -58 -76 12.1139 0.251
NP_441014.1_8 Forward -200 -181 -7.96535 0.282
NP_442848.1_1 Forward -78 -64 -3.04867 0.263
NP_442848.1_1 Reverse -335 -349 -3.93365 0.275
NP_442848.1_5 Reverse -68 -86 12.0155 0.232
NP_442848.1_5 Forward -370 -352 7.78729 0.232
NP_441012.1_4 Forward -333 -320 8.18076 0.272
NP_443018.1_3 Forward -349 -342 14.8871 0.0123
NP_443018.1_3 Reverse -342 -349 14.8871 0.0123
NP_443018.1_3 Reverse -64 -71 11.7405 0.0655
NP_443018.1_3 Forward -71 -64 5.44732 0.193
NP_443018.1_3 Reverse -321 -328 4.36568 0.254
NP_443018.1_3 Reverse -368 -375 4.26735 0.267
NP_443018.1_3 Forward -375 -368 4.07068 0.299
NP_443018.1_3 Forward -328 -321 4.07068 0.299
NP_441316.1_7 Reverse -339 -354 7.45305 0.107
NP_441634.1_8 Forward -340 -326 4.91614 0.114
NP_440376.1_1 Forward -350 -341 19.4693 0.000692
NP_440376.1_1 Reverse -341 -350 19.4693 0.000692
NP_440376.1_1 Forward -72 -63 15.7327 0.00625
NP_440376.1_1 Reverse -63 -72 9.63616 0.0385
NP_440376.1_1 Reverse -228 -237 5.21127 0.144
NP_440376.1_1 Reverse -301 -310 1.08137 0.258
NP_440376.1_1 Reverse -55 -64 0.786375 0.26
NP_440376.1_1 Reverse -177 -186 -0.0986038 0.285
NP_442687.1_7 Reverse -340 -350 18.5646 0.0028
NP_442687.1_7 Forward -330 -320 10.9931 0.0994
NP_442687.1_7 Forward -351 -341 9.02648 0.0994
NP_442687.1_7 Reverse -62 -72 8.73149 0.101
NP_442687.1_7 Reverse -328 -338 7.55152 0.13
NP_442687.1_7 Forward -73 -63 6.66654 0.155
NP_442191.1_4 Reverse -80 -94 10.7022 0.288
NP_442485.1_3 Reverse -330 -349 16.2241 0.058
NP_442485.1_3 Reverse -324 -343 8.16093 0.133
NP_442485.1_3 Forward -340 -321 5.99764 0.167
NP_442583.1_8 Reverse -330 -349 9.24257 0.238
NP_440642.1_10 Reverse -282 -296 3.34225 0.275
NP_441013.1_2 Forward -355 -337 -2.43913 0.282
NP_441422.1_7 Reverse -61 -78 5.15205 0.105
NP_441422.1_7 Reverse -318 -335 -4.09106 0.238
NP_441422.1_7 Forward -340 -323 -7.33598 0.258
NP_442483.1_6 Forward -191 -172 21.3364 0.0405
NP_441950.1_7 Reverse -43 -62 0.687771 0.18
NP_441950.1_7 Reverse -160 -179 -7.57203 0.279
NP_441950.1_7 Reverse -157 -176 -9.14533 0.293
NP_441950.1_8 Forward -333 -319 5.50613 0.281
NP_442296.1_5 Forward -385 -366 4.32602 0.251
NP_442658.1_1 Reverse -339 -349 14.8275 0.0188
NP_442658.1_1 Forward -352 -342 14.2375 0.0237
NP_442658.1_1 Reverse -61 -71 8.04271 0.199
NP_442198.1_3 Reverse -156 -175 5.89931 0.259
NP_442198.1_7 Forward -353 -334 13.175 0.185
NP_442198.1_7 Forward -236 -217 11.2084 0.209
NP_442161.1_7 Forward -68 -49 6.4893 0.191
NP_440141.1_4 Forward -81 -62 -11.6036 0.298
NP_441855.2_4 Reverse -333 -352 12.8973 0.174
NP_442782.1_2 Reverse -341 -355 8.16106 0.198
NP_442782.1_2 Forward -329 -315 5.1128 0.247
NP_442782.1_2 Forward -350 -336 4.81781 0.25
NP_442205.1_9 Reverse -335 -351 -2.20308 0.268
NP_441414.1_9 Forward -72 -53 -6.1954 0.19
NP_441487.1_6 Forward -358 -339 1.47442 0.254
NP_441256.1_1 Forward -353 -334 -7.4737 0.239
NP_442937.1_5 Forward -77 -58 13.1758 0.095
NP_442937.1_5 Forward -83 -64 12.5858 0.105
NP_442937.1_5 Reverse -252 -271 9.53756 0.187
NP_442937.1_5 Forward -343 -324 8.75091 0.212
NP_442937.1_5 Reverse -321 -340 8.65258 0.216
NP_442937.1_5 Reverse -299 -318 5.99764 0.293
NP_441958.1_2 Reverse -332 -351 13.4708 0.203
NP_441958.1_5 Forward -351 -341 21.2195 0.000805
NP_441958.1_5 Reverse -340 -350 20.5312 0.000966
NP_441958.1_5 Reverse -62 -72 10.6981 0.0112
NP_441958.1_5 Forward -73 -63 10.0098 0.0167
NP_442836.1_10 Reverse -54 -64 18.0729 0.154
NP_440203.1_5 Reverse -66 -76 13.5492 0.114
NP_440203.1_5 Forward -373 -363 12.9592 0.135
NP_440203.1_5 Forward -347 -337 12.1726 0.164
NP_443001.1_7 Reverse -355 -374 6.09597 0.274
NP_440984.1_7 Reverse -58 -72 10.7177 0.122
NP_440984.1_7 Forward -355 -341 10.0294 0.126
NP_440984.1_7 Reverse -362 -376 9.5377 0.127
NP_440984.1_7 Forward -340 -326 6.48943 0.214
NP_441162.1_3 Forward -82 -63 8.25926 0.271
NP_439990.1_5 Forward -355 -342 10.639 0.128
NP_439990.1_5 Forward -83 -70 6.1158 0.255
NP_442376.1_2 Reverse -336 -355 7.47261 0.146
NP_442376.1_2 Forward -77 -58 -5.70374 0.286
NP_442690.1_1 Forward -35 -16 5.40766 0.0714
NP_442911.1_2 Reverse -53 -72 6.68596 0.0279
NP_442911.1_2 Forward -82 -63 5.40766 0.0341
NP_442911.1_2 Forward -360 -341 4.22769 0.0392
NP_442911.1_2 Reverse -331 -350 -1.86883 0.091
NP_440153.1_5 Reverse -342 -356 13.8643 0.0551
NP_440153.1_8 Forward -335 -322 6.01747 0.175
NP_440153.1_8 Reverse -69 -82 5.91914 0.175
NP_442536.1_7 Forward -344 -325 7.47261 0.273
NP_443055.1_6 Reverse -206 -224 11.3264 0.114
NP_443055.1_6 Forward -72 -54 2.96833 0.201
NP_443055.1_6 Reverse -55 -73 2.77167 0.203
NP_440993.1_2 Forward -355 -339 5.46674 0.234
NP_440993.1_3 Forward -360 -341 -1.67294 0.29
NP_440993.1_3 Forward -342 -323 -2.36125 0.299
NP_440993.1_4 Reverse -251 -268 8.49531 0.216
NP_442853.1_10 Forward -372 -353 9.14342 0.24
NP_441099.1_5 Forward -82 -63 -0.000545616 0.0865
NP_441099.1_5 Forward -360 -341 -7.67036 0.179
NP_441099.1_5 Reverse -53 -72 -11.4069 0.28
NP_441099.1_5 Reverse -331 -350 -12.2919 0.299
NP_442002.1_9 Reverse -340 -347 14.1004 0.074
NP_440809.1_9 Reverse -332 -350 -7.25734 0.225
NP_441294.1_7 Forward -380 -366 14.53 0.0409
NP_441294.1_7 Forward -373 -359 8.86667 0.274
NP_441646.1_1 Forward -79 -60 2.85105 0.211
NP_441646.1_1 Reverse -185 -204 -0.0988766 0.259
NP_442438.1_10 Reverse -336 -350 13.6676 0.0338
NP_442438.1_10 Forward -77 -63 10.7177 0.0491
NP_442438.1_10 Forward -355 -341 1.76955 0.188
NP_442438.1_10 Reverse -321 -335 1.27789 0.2
NP_442431.1_10 Reverse -355 -373 3.06741 0.225
NP_442431.1_10 Reverse -160 -178 0.707465 0.267
NP_441000.1_6 Reverse -340 -354 -3.04867 0.221
NP_442771.1_1 Forward -352 -334 6.01734 0.0626
NP_442771.1_1 Reverse -61 -79 3.55906 0.0672
NP_442771.1_1 Forward -74 -56 -4.8974 0.166
NP_442771.1_1 Reverse -339 -357 -7.55234 0.171
NP_440147.1_4 Reverse -339 -352 11.0324 0.0341
NP_440147.1_4 Forward -352 -339 10.5407 0.0355
NP_440147.1_4 Forward -74 -61 10.049 0.0355
NP_440147.1_4 Reverse -61 -74 3.5592 0.186
NP_441175.1_7 Reverse -341 -360 13.8641 0.113
NP_441550.1_8 Reverse -61 -71 18.8591 0.00654
NP_441550.1_8 Forward -352 -342 15.8108 0.0132
NP_441550.1_8 Forward -74 -64 15.5158 0.0132
NP_441550.1_8 Reverse -339 -349 15.4175 0.0132
NP_441916.1_7 Reverse -341 -351 18.9579 0.00144
NP_441916.1_7 Forward -350 -340 16.893 0.00407
NP_441916.1_7 Forward -72 -62 7.15819 0.0745
NP_441916.1_7 Reverse -320 -330 6.96153 0.0784
NP_441916.1_7 Forward -329 -319 5.5849 0.128
NP_440206.1_4 Forward -360 -341 4.32522 0.257
NP_440206.1_4 Reverse -316 -335 -0.591301 0.29
NP_440465.1_10 Reverse -60 -79 5.01433 0.218
NP_441041.1_4 Forward -350 -331 1.67108 0.0792
NP_441041.1_4 Forward -84 -65 -2.45882 0.112
NP_441041.1_4 Reverse -320 -339 -3.54046 0.123
NP_441041.1_4 Reverse -79 -98 -4.52377 0.138
NP_441041.1_4 Reverse -63 -82 -8.35868 0.2
NP_441041.1_7 Forward -353 -341 13.3454 0.0485
NP_441041.1_7 Reverse -338 -350 9.94422 0.104
NP_441041.1_7 Forward -75 -63 5.57123 0.25
NP_442004.1_6 Forward -350 -336 18.1908 0.0534
NP_442004.1_6 Reverse -63 -77 6.19444 0.181
NP_440703.1_9 Forward -259 -246 5.13193 0.293
NP_441725.1_4 Forward -355 -341 13.7653 0.0693
NP_441725.1_5 Forward -349 -339 21.0229 0.00533
NP_441725.1_5 Forward -71 -61 9.02648 0.0553
NP_441725.1_5 Reverse -342 -352 1.94665 0.115
NP_441725.1_5 Reverse -64 -74 -0.806614 0.271
NP_439966.1_7 Forward -352 -342 14.3359 0.0203
NP_439966.1_7 Reverse -339 -349 9.12434 0.119
NP_439966.1_7 Reverse -61 -71 7.15773 0.154
NP_439966.1_7 Forward -331 -321 5.38779 0.226
NP_439966.1_7 Forward -74 -64 5.09279 0.243
NP_439966.1_9 Forward -74 -65 0.884706 0.253
NP_439966.1_9 Reverse -327 -336 0.491382 0.288
NP_440736.1_3 Forward -359 -340 5.40766 0.223
NP_442941.1_3 Reverse -342 -352 19.2529 0.00262
NP_442941.1_3 Forward -349 -339 11.3864 0.0116
NP_442941.1_3 Reverse -64 -74 1.16001 0.15
NP_440289.1_2 Reverse -338 -351 6.31247 0.0604
NP_440289.1_2 Forward -353 -340 6.01747 0.0605
NP_440289.1_2 Reverse -60 -73 1.59258 0.122
NP_440289.1_2 Forward -75 -62 -4.79893 0.294
NP_440983.1_5 Reverse -63 -82 15.7324 0.0965
NP_440983.1_5 Forward -347 -328 -9.24366 0.3
NP_440260.1_8 Reverse -351 -369 9.45892 0.151
NP_440260.1_8 Reverse -332 -350 6.80398 0.154
NP_440260.1_8 Reverse -300 -318 -3.42244 0.252
NP_440260.1_8 Forward -81 -63 -7.06068 0.295
NP_441514.1_6 Forward -114 -107 14.2971 0.248
NP_441678.1_9 Reverse -212 -231 -3.54046 0.288
NP_442281.1_1 Forward -355 -341 16.5185 0.00772
NP_442281.1_1 Reverse -336 -350 11.1104 0.0507
NP_442281.1_1 Forward -77 -63 4.03056 0.21
NP_442281.1_1 Forward -164 -150 3.34225 0.235
NP_442281.1_1 Forward -334 -320 1.86729 0.285
NP_441334.1_7 Forward -352 -333 -11.0136 0.12
NP_441334.1_7 Reverse -61 -80 -19.6667 0.275
NP_442256.1_2 Reverse -339 -357 -7.84733 0.215
NP_440437.1_1 Forward -356 -337 0.392778 0.172
NP_442012.1_2 Forward -352 -333 1.76941 0.295
NP_442012.1_9 Reverse -23 -41 17.4573 0.194
NP_441556.1_4 Reverse -332 -351 14.5362 0.165
NP_440498.1_1 Reverse -332 -350 -1.75081 0.231
NP_442982.1_5 Forward -360 -341 6.39097 0.154
NP_441644.1_6 Reverse -341 -351 19.0557 0.000803
NP_441644.1_6 Reverse -63 -73 17.0891 0.00219
NP_441644.1_6 Forward -350 -340 15.7125 0.0048
NP_441644.1_6 Reverse -367 -377 9.321 0.0799
NP_441644.1_6 Forward -78 -68 7.55106 0.123
NP_441644.1_6 Forward -72 -62 6.0761 0.167
NP_441644.1_6 Forward -310 -300 4.7978 0.224
NP_441644.1_6 Forward -376 -366 4.10949 0.249
NP_441644.1_6 Forward -215 -205 3.71617 0.267
NP_441644.1_6 Reverse -320 -330 3.42118 0.282
NP_442215.1_1 Reverse -337 -356 7.57094 0.197
NP_442215.1_2 Forward -352 -336 -4.95634 0.242
NP_442029.1_1 Reverse -365 -384 -1.57384 0.163
NP_442029.1_6 Reverse -336 -355 2.85105 0.286
NP_440929.1_8 Forward -350 -341 19.2726 0.000701
NP_440929.1_8 Reverse -341 -350 19.2726 0.000701
NP_440929.1_8 Reverse -63 -72 16.5193 0.00413
NP_440929.1_8 Forward -72 -63 9.53783 0.0296
NP_440780.1_1 Reverse -12 -31 17.9998 0.194
NP_442933.1_10 Forward -350 -341 17.601 0.00325
NP_442933.1_10 Reverse -341 -350 17.601 0.00325
NP_442933.1_10 Reverse -63 -72 8.06287 0.0885
NP_442933.1_10 Forward -72 -63 7.96454 0.0937
NP_442933.1_10 Reverse -320 -329 5.11294 0.204
NP_441751.2_8 Forward -349 -335 15.2409 0.0119
NP_441751.2_8 Reverse -342 -356 7.57108 0.0339
NP_441751.2_8 Reverse -64 -78 5.40779 0.0436
NP_441751.2_8 Reverse -321 -335 -3.83532 0.156
NP_442926.1_3 Reverse -64 -83 4.03102 0.272
NP_439922.1_6 Reverse -349 -367 16.4404 0.285
NP_442554.1_8 Reverse -342 -352 17.2863 0.00543
NP_442554.1_8 Forward -349 -339 14.828 0.0108
NP_442554.1_8 Forward -71 -61 14.6313 0.0129
NP_442554.1_8 Reverse -64 -74 8.23984 0.0776
NP_442554.1_8 Reverse -70 -80 6.37155 0.12
NP_442554.1_8 Forward -375 -365 4.50326 0.184
NP_442554.1_8 Reverse -321 -331 3.32329 0.23
NP_441586.1_5 Forward -233 -214 2.65439 0.291
NP_441762.1_7 Reverse -340 -352 1.7106 0.0735
NP_441762.1_7 Reverse -62 -74 1.41561 0.0747
NP_441762.1_7 Forward -351 -339 -6.84419 0.284
NP_441762.1_7 Forward -73 -61 -7.13918 0.285
NP_442142.1_4 Reverse -338 -351 15.7516 0.0264
NP_442142.1_4 Forward -332 -319 6.80355 0.154
NP_442142.1_4 Forward -353 -340 6.21356 0.17
NP_442142.1_4 Forward -379 -366 5.23026 0.197
NP_442142.1_4 Forward -263 -250 3.85363 0.243
NP_442292.1_1 Reverse -342 -351 17.5026 0.00435
NP_442292.1_1 Forward -349 -340 9.53783 0.0183
NP_442292.1_1 Reverse -64 -73 8.65285 0.0335
NP_442292.1_1 Forward -375 -366 5.80125 0.129
NP_442292.1_1 Forward -71 -62 -0.196935 0.239
NP_441525.1_1 Reverse -75 -88 13.4906 0.241
NP_440895.1_6 Forward -78 -65 9.85238 0.214
NP_443009.1_5 Forward -351 -340 17.0694 0.00659
NP_443009.1_5 Reverse -340 -351 16.7744 0.00677
NP_443009.1_5 Forward -73 -62 6.05637 0.177
NP_442301.1_2 Forward -169 -150 8.25844 0.23
NP_442301.1_2 Forward -178 -159 5.40686 0.264
NP_441715.1_4 Reverse -342 -352 16.7946 0.0106
NP_441715.1_4 Forward -349 -339 7.25653 0.108
NP_440357.1_3 Reverse -52 -71 6.58763 0.236
NP_440015.1_9 Reverse -273 -291 -1.94747 0.298
NP_440730.1_4 Forward -237 -218 -1.86883 0.28
NP_440158.1_8 Reverse -142 -161 10.8159 0.249
NP_441198.1_8 Reverse -339 -349 13.076 0.108
NP_440379.1_5 Reverse -326 -345 -6.78538 0.238
NP_440379.1_5 Forward -87 -68 -7.96535 0.25
NP_441468.1_1 Forward -349 -342 15.8704 0.0124
NP_441468.1_1 Reverse -342 -349 15.8704 0.0124
NP_441468.1_1 Forward -71 -64 6.13563 0.209
NP_441468.1_1 Reverse -64 -71 6.0373 0.223
NP_441468.1_1 Reverse -321 -328 4.46401 0.224
NP_441468.1_1 Reverse -368 -375 3.97235 0.277
NP_441020.2_6 Forward -352 -335 13.8052 0.0663
NP_441020.2_6 Forward -74 -57 9.87194 0.159
NP_441020.2_6 Reverse -175 -192 6.23369 0.27
NP_441015.1_9 Forward -364 -351 15.4566 0.275
NP_441015.1_10 Reverse -321 -340 8.84924 0.0802
NP_441015.1_10 Forward -83 -64 7.27595 0.0996
NP_441015.1_10 Forward -265 -246 -3.04881 0.184
NP_441015.1_10 Forward -77 -58 -7.17871 0.264
NP_441015.1_10 Reverse -336 -355 -11.3086 0.294
NP_441673.1_1 Forward -350 -341 20.8459 0.000698
NP_441673.1_1 Reverse -341 -350 20.8459 0.000698
NP_441673.1_1 Forward -72 -63 11.1111 0.0121
NP_441673.1_1 Reverse -63 -72 11.0128 0.018
NP_441673.1_1 Reverse -320 -329 -8.06341 0.254
NP_441731.1_3 Forward -80 -61 4.32602 0.159
NP_441016.2_1 Forward -328 -309 16.9124 0.27
NP_442253.1_5 Forward -338 -321 -1.73112 0.268
NP_441826.1_2 Forward -356 -342 7.66941 0.085
NP_441826.1_2 Forward -78 -64 5.99778 0.0946
NP_441826.1_2 Reverse -335 -349 3.44117 0.11
NP_441826.1_2 Reverse -63 -77 2.75286 0.12
NP_441826.1_2 Reverse -251 -265 -4.52363 0.296
NP_441330.1_1 Forward -355 -336 -4.6221 0.0986
NP_442490.1_9 Reverse -329 -348 2.75272 0.165
NP_442868.1_6 Forward -352 -342 10.4031 0.038
NP_442868.1_6 Reverse -339 -349 9.22315 0.0527
NP_442868.1_6 Forward -74 -64 7.74818 0.0697
NP_442868.1_6 Reverse -61 -71 6.96153 0.0919
NP_441056.1_1 Reverse -63 -82 3.53937 0.131
NP_441056.1_1 Reverse -329 -348 -4.6221 0.255
NP_441056.1_1 Forward -350 -331 -8.752 0.283
NP_442227.1_2 Reverse -286 -305 -3.04881 0.289
NP_442427.1_8 Reverse -54 -73 11.3075 0.152
NP_442808.1_1 Reverse -62 -72 9.321 0.0481
NP_442808.1_1 Reverse -340 -350 8.73102 0.0481
NP_442808.1_1 Forward -351 -341 8.73102 0.0481
NP_442808.1_1 Forward -377 -367 5.28945 0.162
NP_442808.1_1 Reverse -227 -237 5.19112 0.168
NP_442808.1_1 Forward -65 -55 3.91283 0.218
NP_442808.1_1 Forward -189 -179 1.84789 0.281
NP_441101.1_10 Forward -354 -335 0.392778 0.175
NP_442775.1_6 Forward -83 -64 10.1275 0.279
NP_440145.1_3 Forward -123 -104 1.86774 0.122
NP_440145.1_3 Forward -360 -341 -4.91709 0.254
NP_442542.1_2 Reverse -61 -74 10.1474 0.129
NP_442542.1_2 Forward -352 -339 9.65572 0.133
NP_442542.1_2 Reverse -136 -149 4.54251 0.3
NP_442050.1_5 Forward -352 -342 15.9091 0.0091
NP_442050.1_5 Reverse -339 -349 15.8108 0.0091
NP_442050.1_5 Reverse -61 -71 12.7626 0.0516
NP_442342.1_9 Reverse -61 -77 11.5633 0.119
NP_442342.1_9 Reverse -77 -93 3.40179 0.26
NP_440558.1_2 Reverse -332 -351 -0.787193 0.204
NP_440558.1_2 Reverse -66 -85 -2.26216 0.225
NP_440558.1_2 Forward -269 -250 -3.54046 0.236
NP_440923.1_4 Forward -162 -143 3.93269 0.197
NP_441878.1_6 Reverse -340 -350 20.2362 0.0046
NP_441878.1_6 Forward -351 -341 10.5014 0.0176
NP_441878.1_6 Reverse -62 -72 10.4031 0.0176
NP_441878.1_6 Forward -73 -63 0.668351 0.139
NP_441878.1_6 Reverse -250 -260 -0.118297 0.167
NP_441878.1_6 Reverse -319 -329 -7.0998 0.204
NP_441878.1_6 Reverse -227 -237 -7.49312 0.231
NP_441878.1_6 Forward -216 -206 -7.78811 0.266
NP_441036.1_8 Forward -351 -341 15.713 0.00724
NP_441036.1_8 Reverse -340 -350 8.4365 0.174
NP_441036.1_8 Forward -73 -63 7.05986 0.21
NP_442650.1_2 Reverse -63 -77 7.07942 0.13
NP_441557.1_5 Forward -350 -341 19.9609 0.000699
NP_441557.1_5 Reverse -341 -350 19.9609 0.000699
NP_441557.1_5 Forward -72 -63 10.2261 0.0144
NP_441557.1_5 Reverse -63 -72 10.1278 0.0188
NP_441557.1_5 Forward -329 -320 -0.68859 0.229
NP_441557.1_8 Forward -236 -226 10.6976 0.28
NP_441445.1_1 Reverse -332 -351 13.3725 0.0607
NP_441445.1_1 Forward -81 -62 5.60432 0.166
NP_441445.1_1 Forward -87 -68 1.76941 0.247
NP_441445.1_1 Reverse -147 -166 1.57275 0.252
NP_441445.1_1 Forward -275 -256 1.0811 0.262
NP_441445.1_1 Forward -338 -319 -0.590531 0.297
NP_441590.1_4 Forward -63 -44 14.4533 0.177
NP_441590.1_4 Forward -309 -290 2.55527 0.293
NP_442066.2_4 Reverse -341 -360 -6.1954 0.247
NP_442066.2_9 Reverse -59 -72 11.4257 0.154
NP_442419.1_2 Forward -355 -336 -0.787193 0.246
NP_442419.1_2 Forward -349 -330 -4.6221 0.291
NP_440738.1_5 Forward -372 -353 6.29264 0.246
NP_440101.1_3 Reverse -324 -343 15.7324 0.0613
NP_440101.1_3 Reverse -336 -355 14.3558 0.067
NP_442183.1_1 Forward -72 -58 8.65272 0.112
NP_442183.1_1 Forward -350 -336 8.25939 0.119
NP_442166.1_7 Forward -328 -314 11.406 0.19
NP_442397.1_9 Reverse -328 -347 1.86774 0.283
NP_440979.1_3 Forward -349 -331 10.0489 0.277
NP_441819.1_5 Forward -35 -16 14.6576 0.195
NP_442135.1_8 Forward -361 -343 8.67227 0.3
NP_441574.1_1 Forward -84 -65 -3.3438 0.238
NP_441574.1_1 Reverse -63 -82 -5.11376 0.26
NP_442444.1_8 Forward -88 -69 20.3531 0.192
NP_441549.1_7 Forward -304 -285 18.8781 0.106
NP_441549.1_9 Forward -354 -336 5.42735 0.0925
NP_441549.1_9 Reverse -59 -77 -1.35749 0.165
NP_441549.1_9 Reverse -337 -355 -8.14232 0.221
NP_441549.1_9 Reverse -300 -318 -9.32229 0.245
NP_442347.1_2 Reverse -64 -73 10.3245 0.058
NP_442347.1_2 Forward -349 -340 3.34298 0.284
NP_442347.1_2 Reverse -342 -351 3.34298 0.284
NP_440547.1_1 Reverse -73 -92 8.35677 0.264
NP_440547.1_1 Forward -89 -70 7.27514 0.294
NP_442888.1_6 Forward -361 -342 3.04771 0.244
NP_441037.1_4 Reverse -61 -71 14.9194 0.028
NP_441037.1_4 Reverse -339 -349 9.65667 0.21
NP_441037.1_4 Forward -352 -342 7.22024 0.237
NP_442047.1_2 Reverse -202 -216 12.586 0.256
NP_440151.1_2 Forward -154 -136 14.178 0.277
NP_442317.1_6 Reverse -201 -220 9.14423 0.211
NP_441633.1_3 Forward -352 -339 5.62415 0.0481
NP_441633.1_3 Forward -74 -61 3.46087 0.0699
NP_441633.1_3 Forward -188 -175 -4.79893 0.212
NP_440136.1_2 Forward -349 -342 15.9687 0.0123
NP_440136.1_2 Reverse -342 -349 15.9687 0.0123
NP_440136.1_2 Forward -71 -64 6.23397 0.171
NP_440136.1_2 Reverse -64 -71 6.13563 0.193
NP_442590.1_9 Reverse -299 -318 5.89931 0.267
NP_442590.1_10 Reverse -63 -82 5.99764 0.254
NP_442590.1_10 Reverse -341 -360 5.70265 0.258
NP_442590.1_10 Reverse -313 -332 3.24438 0.294
NP_442590.1_10 Reverse -334 -353 3.14605 0.295
NP_442998.1_10 Forward -348 -341 15.5754 0.0102
NP_442998.1_10 Reverse -343 -350 15.5754 0.0102
NP_442998.1_10 Reverse -65 -72 15.5754 0.0102
NP_442998.1_10 Forward -374 -367 6.13563 0.181
NP_442998.1_10 Forward -70 -63 5.84064 0.235
NP_440299.1_1 Reverse -337 -350 15.3583 0.017
NP_440299.1_1 Forward -76 -63 12.3101 0.0398
NP_440299.1_1 Forward -354 -341 11.1301 0.0518
NP_440299.1_1 Forward -333 -320 5.82024 0.162
NP_440299.1_1 Reverse -71 -84 2.08368 0.299
NP_441799.1_1 Reverse -337 -351 15.1419 0.0203
NP_441799.1_1 Reverse -59 -73 9.73373 0.0857
NP_441799.1_1 Forward -380 -366 7.17714 0.149
NP_441799.1_1 Forward -333 -319 3.73557 0.284
NP_441007.1_10 Reverse -362 -375 5.32916 0.182
NP_441007.1_10 Reverse -336 -349 1.78924 0.203
NP_441007.1_10 Forward -77 -64 1.69091 0.203
NP_441007.1_10 Reverse -58 -71 1.59258 0.203
NP_441007.1_10 Forward -355 -342 1.29759 0.203
NP_441007.1_10 Reverse -296 -309 -0.275709 0.273
NP_442333.2_5 Reverse -330 -349 -13.3736 0.255
NP_440256.1_1 Forward -353 -334 10.6192 0.0177
NP_440256.1_1 Forward -91 -72 4.42435 0.0442
NP_440256.1_1 Reverse -313 -332 -3.54046 0.135
NP_440256.1_1 Reverse -338 -357 -6.49039 0.213
NP_441229.1_4 Reverse -330 -349 14.6508 0.293
NP_441512.1_4 Forward -380 -361 10.2259 0.237
NP_442283.1_4 Forward -328 -309 17.8957 0.2
NP_441559.1_8 Forward -355 -341 10.9143 0.0574
NP_441559.1_8 Reverse -315 -329 -0.983719 0.18
NP_441559.1_8 Reverse -275 -289 -5.31028 0.259
NP_441559.1_8 Forward -191 -177 -5.60527 0.267
NP_441559.1_8 Reverse -173 -187 -6.68692 0.279
NP_440915.1_6 Forward -76 -62 21.1407 0.0049
NP_440915.1_6 Forward -354 -340 18.3875 0.0114
NP_440915.1_6 Reverse -337 -351 11.996 0.023
NP_440915.1_6 Forward -241 -227 -1.37704 0.233
NP_440915.1_6 Reverse -51 -65 -1.96703 0.254
NP_442158.1_4 Reverse -358 -368 10.6981 0.283
NP_442866.1_1 Reverse -336 -355 -9.63698 0.296
NP_441464.1_8 Forward -72 -58 13.6676 0.142
NP_441464.1_10 Reverse -155 -169 8.75105 0.27
NP_440702.1_2 Reverse -154 -173 -8.55534 0.299
NP_440695.1_5 Forward -350 -331 11.4058 0.15
NP_440695.1_5 Forward -249 -230 2.75272 0.252
NP_441939.1_3 Reverse -342 -361 14.2574 0.0777
NP_441199.1_6 Forward -76 -57 7.07928 0.12
NP_441199.1_6 Forward -354 -335 4.03102 0.175
NP_441494.1_6 Reverse -172 -185 7.59077 0.254
NP_441494.1_6 Forward -355 -342 6.01747 0.289
NP_442993.1_1 Forward -72 -56 -10.9545 0.231
NP_442993.1_1 Reverse -320 -336 -12.4295 0.271
NP_442993.1_1 Reverse -301 -317 -13.8061 0.295
NP_442386.1_5 Forward -367 -348 16.9115 0.0848
NP_442386.1_9 Forward -351 -342 6.39082 0.219
NP_442386.1_9 Reverse -340 -349 6.39082 0.219
NP_442386.1_9 Forward -330 -321 5.0142 0.27
NP_440570.1_4 Reverse -212 -230 3.16574 0.238
NP_441750.1_4 Forward -139 -120 5.60432 0.185
NP_441750.1_4 Forward -354 -335 5.40766 0.186
NP_441340.1_5 Forward -349 -342 15.6737 0.0124
NP_441340.1_5 Reverse -342 -349 15.6737 0.0124
NP_441340.1_5 Forward -71 -64 13.5105 0.0314
NP_441340.1_5 Reverse -64 -71 5.84064 0.208
NP_441340.1_5 Forward -328 -321 3.97235 0.274
NP_442484.1_2 Forward -349 -330 3.44104 0.208
NP_442791.1_5 Reverse -71 -90 -7.67036 0.279
NP_440168.1_4 Forward -270 -251 -5.40875 0.255
NP_442240.1_2 Reverse -342 -361 -1.18052 0.0609
NP_440161.1_3 Forward -331 -312 7.47261 0.299
NP_440586.1_1 Reverse -297 -316 -5.60541 0.286
NP_440586.1_8 Forward -349 -342 13.2151 0.026
NP_440586.1_8 Reverse -342 -349 13.2151 0.026
NP_440586.1_8 Reverse -64 -71 9.47853 0.146
NP_440586.1_8 Reverse -368 -375 7.70858 0.227
NP_440586.1_8 Forward -71 -64 5.74197 0.283
NP_442251.1_6 Forward -349 -342 15.2804 0.0124
NP_442251.1_6 Reverse -342 -349 15.2804 0.0124
NP_440684.1_9 Forward -87 -73 9.14437 0.221
NP_440684.1_9 Forward -335 -321 8.84938 0.223
NP_441262.1_3 Reverse -341 -348 14.7888 0.0223
NP_441262.1_3 Forward -350 -343 14.7888 0.0223
NP_441262.1_3 Forward -72 -65 14.7888 0.0223
NP_441262.1_3 Reverse -367 -374 5.25066 0.215
NP_440027.1_3 Reverse -69 -87 13.4897 0.128
NP_440027.1_3 Forward -187 -169 4.14829 0.262
NP_440027.1_8 Reverse -338 -357 8.75009 0.246
NP_443051.1_1 Forward -351 -342 19.5676 0.00335
NP_443051.1_1 Reverse -340 -349 18.0926 0.00402
NP_443051.1_1 Reverse -62 -71 8.25953 0.0414
NP_443051.1_1 Forward -73 -64 7.47288 0.0571
NP_439996.1_6 Reverse -288 -307 13.8411 0.169
NP_441232.1_10 Reverse -330 -349 3.04771 0.236
NP_439937.1_9 Reverse -62 -79 -7.72996 0.165
NP_439937.1_9 Forward -178 -161 -10.9749 0.237
NP_439937.1_9 Forward -189 -172 -13.9248 0.287
NP_439937.1_9 Reverse -227 -244 -16.8747 0.289
NP_440408.1_7 Forward -376 -357 9.43923 0.259
NP_440408.1_7 Reverse -329 -348 6.78429 0.299
NP_440439.1_1 Forward -353 -340 20.0788 0.0105
NP_440439.1_1 Forward -75 -62 8.27909 0.0547
NP_440439.1_1 Reverse -338 -351 7.09911 0.0693
NP_442239.1_8 Reverse -348 -367 7.37428 0.258
NP_439943.1_7 Reverse -336 -355 3.53937 0.29
NP_440372.1_2 Forward -349 -342 16.3621 0.0124
NP_440372.1_2 Reverse -342 -349 16.3621 0.0124
NP_440372.1_2 Forward -71 -64 13.8055 0.0214
NP_440372.1_2 Reverse -64 -71 6.52896 0.188
NP_441138.1_5 Forward -29 -16 4.16793 0.297
NP_441789.1_7 Forward -371 -352 6.09517 0.193
NP_441789.1_7 Forward -231 -212 -5.21283 0.294
NP_441789.1_7 Reverse -110 -129 -5.60616 0.299
NP_440316.1_10 Forward -79 -69 7.74818 0.246
NP_441803.1_2 Reverse -67 -86 6.98095 0.146
NP_441803.1_2 Reverse -64 -83 0.0977854 0.26
NP_439977.1_5 Reverse -57 -76 0.884433 0.199
NP_439977.1_5 Forward -78 -59 -1.37718 0.25
NP_440139.1_1 Reverse -335 -354 2.06362 0.24
NP_441572.1_7 Forward -356 -337 24.5822 0.00663
NP_441572.1_7 Reverse -335 -354 -2.45882 0.196
NP_440267.1_2 Forward -355 -341 11.5037 0.125
NP_440267.1_2 Reverse -336 -350 6.48882 0.228
NP_442384.1_10 Reverse -341 -354 18.8988 0.00338
NP_442384.1_10 Forward -350 -337 17.0305 0.0065
NP_442384.1_10 Reverse -63 -76 8.18076 0.0685
NP_442384.1_10 Reverse -79 -92 7.98409 0.0711
NP_442384.1_10 Reverse -320 -333 3.16588 0.199
NP_442384.1_10 Forward -72 -59 0.60927 0.286
NP_442384.1_10 Forward -237 -224 0.510939 0.289
NP_442035.1_7 Reverse -353 -372 15.4978 0.287
NP_441877.1_9 Forward -38 -21 1.61214 0.297
NP_441018.1_7 Forward -82 -63 10.6192 0.201
NP_441018.1_7 Forward -354 -335 10.1275 0.217
NP_442790.1_4 Forward -81 -62 -10.3253 0.206
NP_442790.1_4 Forward -246 -227 -12.4886 0.248
NP_442262.1_10 Forward -349 -342 14.1988 0.0123
NP_442262.1_10 Reverse -342 -349 14.1988 0.0123
NP_442262.1_10 Reverse -64 -71 13.2155 0.0213
NP_441689.1_5 Reverse -339 -349 8.63269 0.132
NP_441689.1_5 Forward -352 -342 8.3377 0.132
NP_440163.1_10 Reverse -72 -82 15.9097 0.0762
NP_440163.1_10 Forward -332 -322 15.6147 0.0762
NP_440344.1_10 Reverse -334 -351 -2.61609 0.0703
NP_440344.1_10 Reverse -56 -73 -12.3509 0.25
NP_440282.1_3 Forward -368 -349 8.45592 0.21
NP_440282.1_10 Reverse -331 -350 1.0811 0.182
NP_440531.1_6 Reverse -77 -96 -1.67217 0.237
NP_440531.1_8 Reverse -212 -231 10.1275 0.206
NP_442832.1_7 Reverse -356 -375 21.8289 0.102
NP_442529.1_4 Reverse -332 -351 11.7992 0.175
NP_442693.1_6 Reverse -335 -354 4.12936 0.278
NP_440297.1_9 Forward -349 -339 19.0562 0.0359
NP_440297.1_9 Forward -71 -61 -0.216628 0.282
NP_440297.1_9 Reverse -342 -352 -0.216628 0.282
NP_440297.1_9 Reverse -321 -331 -0.41329 0.283
NP_440350.1_5 Forward -29 -10 -6.98204 0.299
NP_442187.1_3 Reverse -366 -376 13.5497 0.245
NP_442187.1_3 Forward -339 -329 13.2547 0.274
NP_441896.1_3 Reverse -54 -73 4.52268 0.142
NP_440894.1_10 Reverse -58 -77 21.9273 0.0278
NP_440999.1_9 Reverse -325 -339 10.521 0.0516
NP_440999.1_9 Forward -354 -340 7.9644 0.0802
NP_440999.1_9 Forward -339 -325 5.50613 0.111
NP_440999.1_9 Forward -76 -62 0.88457 0.174
NP_440888.1_2 Reverse -341 -355 15.9285 0.00837
NP_440888.1_2 Reverse -63 -77 15.8302 0.00862
NP_440888.1_2 Forward -350 -336 7.17714 0.205
NP_440888.1_2 Forward -329 -315 5.80051 0.262
NP_440888.1_2 Reverse -69 -83 5.50552 0.276
NP_440803.1_3 Forward -240 -221 11.7008 0.154
NP_442557.1_2 Reverse -60 -78 15.1621 0.156
NP_440179.1_6 Forward -71 -52 6.09597 0.22
NP_440491.1_1 Reverse -338 -357 14.8111 0.097
NP_440491.1_1 Reverse -326 -345 14.2263 0.113
NP_442277.1_4 Forward -359 -340 10.6184 0.0942
NP_442277.1_4 Forward -242 -223 3.04693 0.231
NP_442277.1_4 Forward -372 -353 2.16195 0.254
NP_442277.1_7 Reverse -14 -30 -1.52107 0.278
NP_442033.1_10 Reverse -61 -80 -10.522 0.239
NP_441543.1_2 Reverse -342 -351 15.9293 0.00518
NP_441543.1_2 Forward -349 -340 9.34117 0.0818
NP_441543.1_2 Reverse -64 -73 7.07956 0.131
NP_441543.1_2 Forward -375 -366 4.91628 0.213
NP_441543.1_3 Forward -190 -176 8.65209 0.256
NP_442845.1_2 Forward -78 -64 17.4042 0.0608
NP_442845.1_2 Forward -350 -336 10.4227 0.151
NP_442845.1_2 Reverse -361 -375 8.45605 0.195
NP_442845.1_2 Forward -356 -342 6.48943 0.209
NP_442845.1_2 Reverse -63 -77 5.21113 0.24
NP_441551.1_5 Reverse -337 -353 16.9707 0.0569
NP_441551.1_5 Forward -333 -317 7.72766 0.241
NP_441178.1_6 Forward -379 -360 9.43841 0.245
NP_441918.1_7 Forward -261 -242 -1.57384 0.297
NP_442710.1_7 Reverse -14 -33 -6.54997 0.294
NP_441469.1_8 Reverse -340 -349 13.3727 0.073
NP_441469.1_8 Forward -351 -342 6.5879 0.227
NP_441469.1_8 Forward -330 -321 5.3096 0.277
NP_443064.1_6 Forward -350 -340 13.8273 0.0796
NP_443064.1_6 Forward -72 -62 12.6639 0.0796
NP_443064.1_6 Reverse -341 -351 10.8217 0.13
NP_443064.1_6 Reverse -63 -73 10.4338 0.153
NP_442337.1_8 Reverse -181 -200 -1.47551 0.284
NP_441306.1_10 Forward -327 -313 13.8636 0.25
NP_442578.1_7 Forward -349 -342 14.5921 0.026
NP_442578.1_7 Reverse -342 -349 14.5921 0.026
NP_442578.1_7 Forward -71 -64 6.0373 0.18
NP_440710.1_1 Forward -358 -340 -8.24065 0.261
NP_440071.1_1 Forward -377 -360 13.3128 0.223
NP_440071.1_5 Forward -353 -334 7.17762 0.29
NP_440071.1_5 Reverse -317 -336 7.07928 0.291
NP_441462.1_2 Reverse -341 -351 20.2362 0.000805
NP_441462.1_2 Forward -350 -340 20.1379 0.000967
NP_441462.1_2 Forward -72 -62 18.3679 0.0036
NP_441462.1_2 Forward -329 -319 7.94484 0.048
NP_441462.1_2 Reverse -63 -73 1.74999 0.0811
NP_441462.1_2 Reverse -367 -377 -1.19994 0.291
NP_441462.1_2 Forward -237 -227 -1.29827 0.299
NP_441621.1_7 Reverse -61 -75 4.91614 0.0934
NP_441621.1_7 Reverse -339 -353 2.75286 0.123
NP_441621.1_7 Forward -331 -317 -6.39192 0.29
NP_443062.1_1 Reverse -341 -359 8.93595 0.145
NP_443062.1_6 Reverse -333 -352 5.11266 0.209
NP_441410.1_3 Reverse -332 -351 13.1758 0.154
NP_442204.1_1 Forward -354 -343 21.1015 0.0035
NP_442204.1_1 Forward -76 -65 2.41861 0.266
NP_442204.1_1 Forward -117 -106 0.845319 0.281
NP_442204.1_1 Reverse -337 -348 0.0586712 0.284
NP_442204.1_2 Forward -360 -341 8.35759 0.255
NP_442204.1_5 Reverse -357 -376 -0.688862 0.296
NP_441560.1_10 Reverse -333 -352 14.0608 0.113
NP_442487.1_5 Forward -351 -332 9.63507 0.198
NP_442487.1_5 Reverse -319 -338 1.96529 0.3
NP_442872.1_1 Reverse -109 -128 -11.9969 0.252
NP_440516.1_8 Forward -350 -341 16.9127 0.00442
NP_440516.1_8 Reverse -341 -350 16.9127 0.00442
NP_440516.1_8 Forward -72 -63 16.9127 0.00442
NP_440516.1_8 Reverse -63 -72 14.8477 0.00685
NP_440516.1_8 Reverse -367 -376 7.96454 0.0463
NP_442428.1_4 Forward -351 -332 3.24438 0.244
NP_442428.1_5 Forward -349 -342 15.8704 0.0124
NP_442428.1_5 Reverse -342 -349 15.8704 0.0124
NP_442428.1_5 Forward -71 -64 6.13563 0.209
NP_442428.1_5 Reverse -64 -71 6.0373 0.212
NP_442428.1_5 Reverse -321 -328 4.759 0.223
NP_442428.1_5 Reverse -368 -375 4.36568 0.271
NP_442859.1_2 Reverse -342 -361 6.19431 0.199
NP_442859.1_2 Reverse -241 -260 4.42435 0.217
NP_440618.1_1 Reverse -335 -354 -11.3086 0.297
NP_442120.1_10 Reverse -206 -225 -10.9153 0.261
NP_442120.1_10 Forward -369 -350 -16.2252 0.297
NP_440673.1_2 Forward -88 -69 17.9011 0.0464
NP_440673.1_3 Forward -348 -341 12.4288 0.0426
NP_440673.1_3 Reverse -343 -350 12.4288 0.0426
NP_440673.1_3 Reverse -65 -72 12.4288 0.0426
NP_440673.1_3 Forward -374 -367 11.6422 0.0724
NP_440673.1_7 Reverse -343 -362 6.58763 0.155
NP_441714.1_3 Forward -383 -365 14.473 0.184
NP_440865.1_9 Reverse -335 -354 2.16274 0.116
NP_441052.1_2 Forward -266 -256 11.0914 0.0285
NP_441052.1_2 Forward -350 -340 10.4031 0.0285
NP_441052.1_2 Reverse -341 -351 10.4031 0.0285
NP_441052.1_2 Reverse -63 -73 10.1081 0.0295
NP_441052.1_2 Forward -376 -366 7.74818 0.0642
NP_441052.1_2 Reverse -69 -79 4.79825 0.145
NP_441052.1_2 Forward -335 -325 1.94665 0.221
NP_441052.1_2 Forward -72 -62 0.865012 0.256
NP_441052.1_2 Reverse -329 -339 -0.806614 0.299
NP_442219.1_8 Forward -82 -63 13.4819 0.153
NP_442219.1_8 Reverse -331 -350 7.58731 0.267
NP_442219.1_9 Forward -349 -340 8.25953 0.0681
NP_442219.1_9 Reverse -342 -351 8.25953 0.0681
NP_442219.1_9 Reverse -64 -73 7.96454 0.0696
NP_440436.1_4 Forward -349 -340 15.9289 0.00508
NP_440436.1_4 Forward -375 -366 11.0124 0.0655
NP_440436.1_4 Reverse -342 -351 9.24241 0.0871
NP_440436.1_4 Reverse -64 -73 7.57079 0.124
NP_440436.1_4 Forward -71 -62 6.39082 0.162
NP_440436.1_4 Reverse -214 -223 5.11253 0.222
NP_441884.1_9 Reverse -320 -339 -20.4534 0.189
NP_441884.1_9 Reverse -60 -79 -23.6983 0.284
NP_442086.1_3 Forward -349 -330 8.35759 0.231
NP_440689.1_4 Forward -83 -65 19.292 0.141
NP_440689.1_5 Forward -310 -291 20.8456 0.0801
NP_440689.1_7 Forward -191 -173 15.653 0.299
NP_440314.1_9 Forward -71 -52 -5.70374 0.225
NP_440314.1_9 Forward -194 -175 -7.67036 0.241
NP_440314.1_9 Reverse -229 -248 -7.96535 0.243
NP_440648.1_1 Reverse -341 -360 3.6377 0.242
NP_442907.1_9 Reverse -336 -355 2.94938 0.171
NP_441719.1_4 Forward -349 -342 16.3621 0.0124
NP_441719.1_4 Reverse -342 -349 16.3621 0.0124
NP_441719.1_4 Forward -71 -64 6.82395 0.0855
NP_441719.1_4 Reverse -64 -71 6.52896 0.188
NP_441733.1_10 Forward -75 -62 13.884 0.0857
NP_441733.1_10 Forward -353 -340 4.05085 0.276
NP_440746.1_3 Forward -74 -55 2.3594 0.252
NP_441004.1_1 Reverse -355 -374 -7.4737 0.198
NP_441004.1_1 Forward -322 -303 -12.8819 0.251
NP_441004.1_1 Reverse -159 -178 -13.0786 0.253
NP_441004.1_1 Reverse -348 -367 -14.2585 0.265
NP_441004.1_1 Reverse -361 -380 -16.9135 0.287
NP_441004.1_1 Reverse -336 -355 -17.0118 0.288
NP_441004.1_1 Reverse -160 -179 -17.6018 0.292
NP_442366.1_3 Reverse -340 -358 2.57575 0.127
NP_442366.1_3 Reverse -62 -80 -5.88071 0.298
NP_440129.1_10 Reverse -68 -82 4.42448 0.185
NP_442873.1_2 Reverse -322 -341 11.11 0.262
NP_440296.1_10 Reverse -338 -357 -14.0619 0.269
NP_441115.1_4 Reverse -340 -358 8.57317 0.244
NP_442206.1_4 Reverse -342 -361 7.86593 0.259
NP_442206.1_9 Forward -55 -36 15.4366 0.28
NP_442854.1_6 Reverse -341 -360 4.81767 0.249
NP_440328.1_4 Forward -356 -337 8.06259 0.114
NP_443054.1_2 Reverse -204 -218 6.48943 0.191
NP_443054.1_2 Reverse -205 -219 0.687908 0.256
NP_442430.1_10 Forward -360 -341 14.1583 0.163
NP_441851.1_10 Reverse -340 -350 17.4829 0.0027
NP_441851.1_10 Forward -351 -341 8.53483 0.114
NP_441851.1_10 Reverse -62 -72 7.64985 0.135
NP_441851.1_10 Forward -73 -63 6.17489 0.182
NP_442001.1_4 Forward -174 -155 13.47 0.189
NP_442856.1_7 Forward -344 -325 12.7825 0.0601
NP_442856.1_7 Reverse -248 -267 -3.83545 0.251
NP_442515.1_1 Forward -73 -59 15.7325 0.0234
NP_442515.1_1 Reverse -227 -241 2.2612 0.14
NP_442515.1_1 Forward -351 -337 -4.03198 0.298
NP_442515.1_1 Reverse -340 -354 -4.7203 0.298
NP_440593.1_3 Reverse -58 -77 -5.80207 0.266
NP_440593.1_3 Reverse -321 -340 -7.67036 0.298
NP_440463.1_8 Forward -345 -326 8.2744 0.264
NP_440463.1_8 Forward -156 -137 7.49989 0.264
NP_442709.1_3 Reverse -334 -353 10.3242 0.121
NP_441046.1_2 Forward -89 -70 -2.16383 0.295
NP_442689.1_8 Forward -31 -14 1.21881 0.191
NP_440940.1_7 Reverse -331 -349 19.4878 0.0313
NP_441349.1_10 Forward -323 -304 -5.70374 0.21
NP_441409.1_6 Reverse -335 -354 -5.31042 0.102
NP_442314.1_1 Forward -346 -328 -1.65248 0.231
NP_440389.1_3 Forward -341 -322 12.0942 0.271
NP_440432.1_9 Reverse -342 -357 -4.34667 0.207
NP_442843.1_1 Reverse -170 -189 -10.227 0.277
NP_439960.1_10 Reverse -250 -268 4.9357 0.161
NP_439960.1_10 Forward -345 -327 3.06741 0.165
NP_440474.1_8 Reverse -321 -335 5.60385 0.246
NP_441477.1_5 Forward -153 -134 10.3242 0.268
NP_441477.1_10 Reverse -319 -337 1.19912 0.264
NP_441124.1_5 Forward -38 -28 12.9127 0.215
NP_442450.1_5 Reverse -339 -349 19.1546 0.0103
NP_440588.1_2 Reverse -248 -267 0.786102 0.144
NP_440588.1_2 Forward -359 -340 -0.197208 0.15
NP_440588.1_2 Reverse -358 -377 -2.26216 0.163
NP_440954.1_1 Reverse -348 -367 -11.0136 0.289
NP_442006.1_2 Reverse -137 -154 -15.5958 0.228
NP_442006.1_2 Forward -302 -285 -17.3657 0.274
NP_442006.1_3 Forward -78 -60 3.65739 0.237
NP_442243.1_1 Forward -356 -338 1.98502 0.208
NP_442243.1_1 Forward -78 -60 -1.06322 0.266
NP_441570.1_1 Forward -350 -332 8.96727 0.0125
NP_440078.1_10 Reverse -320 -339 2.45773 0.269
NP_441078.1_4 Forward -350 -341 19.6659 0.0007
NP_441078.1_4 Reverse -341 -350 19.6659 0.0007
NP_441078.1_4 Forward -72 -63 9.93116 0.0203
NP_441078.1_4 Reverse -63 -72 9.83282 0.0226
NP_441078.1_4 Forward -237 -228 5.80125 0.104
NP_441078.1_4 Reverse -320 -329 -1.77023 0.266
NP_442729.1_5 Reverse -366 -376 17.9746 0.0748
NP_442729.1_8 Reverse -59 -72 10.1474 0.125
NP_440539.1_9 Forward -327 -308 5.211 0.23
NP_441663.1_8 Forward -356 -337 19.764 0.028
NP_442348.1_2 Reverse -177 -186 14.1594 0.167
NP_442348.1_2 Forward -43 -34 7.86621 0.28
NP_440707.1_6 Forward -358 -339 11.8967 0.239
NP_442443.1_1 Forward -80 -61 -6.49039 0.294
NP_440526.1_3 Forward -349 -338 8.61296 0.118
NP_440526.1_3 Reverse -64 -75 8.12131 0.126
NP_440526.1_3 Forward -71 -60 2.22148 0.267
NP_440526.1_3 Reverse -70 -81 0.746521 0.271
NP_441432.1_8 Forward -351 -342 16.8143 0.00595
NP_441432.1_8 Forward -73 -64 14.0611 0.0258
NP_441432.1_8 Reverse -340 -349 8.35786 0.0755
NP_441432.1_8 Reverse -54 -63 7.27622 0.101
NP_441432.1_8 Reverse -366 -375 4.42462 0.213
NP_441432.1_8 Forward -238 -229 3.14632 0.259
NP_441432.1_8 Reverse -205 -214 2.85133 0.281
NP_442320.1_8 Forward -78 -64 -2.75368 0.0966
NP_441732.1_2 Forward -354 -338 -6.62797 0.0495
NP_441732.1_2 Forward -76 -60 -15.9694 0.164
NP_441732.1_2 Reverse -337 -353 -17.1494 0.24
NP_441732.1_2 Forward -317 -301 -17.2477 0.247
NP_440760.1_1 Reverse -341 -360 -11.7019 0.0878
NP_440760.1_1 Reverse -63 -82 -14.6519 0.134
NP_440760.1_1 Forward -72 -53 -20.945 0.226
NP_442797.1_7 Reverse -334 -352 3.85406 0.234
NP_442797.1_7 Reverse -62 -80 -0.177514 0.282
NP_442797.1_9 Forward -219 -201 9.95058 0.258
NP_440578.1_8 Reverse -153 -172 12.5858 0.238
NP_441057.1_4 Reverse -351 -369 -2.93078 0.276
NP_440913.1_1 Forward -352 -334 17.7187 0.0951
NP_440913.1_3 Reverse -69 -82 17.5222 0.184
NP_440913.1_3 Forward -335 -322 16.7355 0.185
NP_442400.1_10 Reverse -28 -41 9.80195 0.27
NP_440713.1_4 Reverse -331 -350 15.6341 0.0778
NP_440713.1_4 Forward -348 -329 10.2259 0.13
NP_440713.1_4 Forward -82 -63 7.17762 0.184
NP_440713.1_4 Reverse -310 -329 3.24438 0.248
NP_442489.1_7 Forward -350 -341 20.1576 0.000695
NP_442489.1_7 Reverse -341 -350 20.1576 0.000695
NP_442489.1_7 Reverse -63 -72 10.5211 0.0102
NP_442489.1_7 Forward -72 -63 10.4228 0.0151
NP_442489.1_7 Reverse -320 -329 -1.27858 0.185
NP_442489.1_7 Reverse -367 -376 -1.6719 0.235
NP_442079.1_7 Forward -349 -330 11.3075 0.102
NP_440559.1_1 Forward -349 -340 17.306 0.00658
NP_440559.1_1 Forward -71 -62 14.5527 0.0154
NP_440559.1_1 Reverse -342 -351 8.65285 0.0586
NP_440559.1_1 Reverse -64 -73 7.76787 0.0918
NP_440559.1_1 Forward -375 -366 4.52295 0.26
NP_441659.2_8 Reverse -341 -351 20.9245 0.000805
NP_441659.2_8 Forward -350 -340 19.3512 0.000966
NP_441659.2_8 Reverse -63 -73 15.0247 0.00732
NP_441659.2_8 Forward -72 -62 9.81313 0.0269
NP_441659.2_8 Forward -329 -319 6.27322 0.0797
NP_441659.2_8 Forward -310 -300 3.32329 0.164
NP_442749.1_5 Forward -44 -27 11.5015 0.182
NP_441092.1_3 Reverse -343 -362 14.9458 0.0583
NP_442913.1_10 Forward -344 -325 -3.63879 0.214
NP_441040.1_2 Forward -80 -61 -11.4069 0.255
NP_439956.1_7 Reverse -181 -200 12.1925 0.184
NP_442008.1_2 Reverse -338 -357 16.0274 0.0806
NP_442008.1_2 Reverse -60 -79 6.4893 0.219
NP_441807.1_5 Forward -361 -342 13.8641 0.117
NP_441185.1_2 Forward -331 -312 7.86593 0.239
NP_442346.1_5 Reverse -340 -350 17.9746 0.00128
NP_442346.1_5 Forward -351 -341 16.303 0.00248
NP_442346.1_5 Reverse -62 -72 8.1415 0.146
NP_442346.1_5 Forward -73 -63 7.55152 0.165
NP_442346.1_5 Reverse -68 -78 7.05986 0.183
NP_442346.1_5 Reverse -366 -376 6.07655 0.216
NP_442346.1_5 Forward -267 -257 4.99491 0.267
NP_442346.1_10 Reverse -324 -343 -2.36049 0.294
NP_440545.1_3 Reverse -337 -354 17.0501 0.0111
NP_440545.1_3 Forward -354 -337 13.7068 0.0167
NP_440545.1_3 Forward -76 -59 6.72535 0.0541
NP_440545.1_3 Reverse -322 -339 -2.02611 0.179
NP_440545.1_3 Reverse -59 -76 -6.94266 0.293
NP_441856.1_3 Reverse -338 -357 3.6377 0.175
NP_440025.1_3 Forward -67 -53 17.3877 0.107
NP_440831.1_3 Forward -81 -62 17.9393 0.0642
NP_441629.1_3 Forward -357 -338 -4.22953 0.29
NP_440459.1_2 Forward -378 -361 12.2319 0.156
NP_440459.1_2 Forward -372 -355 10.4619 0.198
NP_440459.1_2 Forward -365 -348 7.80699 0.278
NP_440010.1_3 Reverse -289 -308 -7.4737 0.278
NP_440010.1_4 Forward -342 -323 6.98015 0.197
NP_440010.1_4 Forward -270 -251 4.81688 0.216
NP_440010.1_4 Reverse -316 -335 3.83357 0.22
NP_440010.1_10 Forward -322 -303 10.3242 0.209
NP_440010.1_10 Reverse -349 -368 7.96426 0.221
NP_440010.1_10 Reverse -51 -70 4.22769 0.246
NP_440010.1_10 Reverse -329 -348 1.47442 0.299
NP_442551.1_4 Reverse -324 -339 4.60145 0.245
NP_442551.1_4 Forward -80 -65 2.92983 0.245
NP_442603.1_7 Forward -72 -58 15.3386 0.0485
NP_442603.1_7 Reverse -341 -355 10.5204 0.125
NP_442603.1_7 Reverse -63 -77 7.57046 0.202
NP_441233.1_9 Reverse -71 -90 12.6841 0.283
NP_441585.1_5 Forward -169 -150 1.96529 0.282
NP_441888.1_7 Forward -355 -341 3.8345 0.225
NP_441050.1_5 Reverse -170 -188 6.50899 0.188
NP_441948.1_4 Reverse -334 -352 7.29564 0.0623
NP_439970.1_4 Forward -51 -32 -4.72043 0.293
NP_441833.1_4 Forward -349 -342 15.9687 0.0124
NP_441833.1_4 Reverse -342 -349 15.9687 0.0124
NP_441833.1_4 Reverse -64 -71 6.52896 0.0924
NP_441833.1_4 Forward -71 -64 6.23397 0.163
NP_441329.1_6 Reverse -13 -32 -1.28956 0.292
NP_441895.1_3 Forward -373 -354 -17.3068 0.298
NP_442162.1_9 Forward -349 -342 16.2637 0.0124
NP_442162.1_9 Reverse -342 -349 16.2637 0.0124
NP_442162.1_9 Forward -71 -64 12.9205 0.0282
NP_442162.1_9 Reverse -64 -71 12.9205 0.0282
NP_442055.1_2 Reverse -151 -170 17.404 0.0588
NP_440671.1_1 Forward -38 -19 4.5998 0.267
NP_440671.1_2 Reverse -344 -358 14.1593 0.28
NP_440671.1_4 Forward -78 -64 12.291 0.114
NP_440671.1_4 Forward -356 -342 10.0294 0.165
NP_440671.1_4 Reverse -335 -349 9.93102 0.168
NP_440224.1_1 Reverse -330 -349 -0.197208 0.14
NP_440204.1_1 Reverse -349 -368 4.42435 0.278
NP_440204.1_4 Reverse -349 -368 2.94938 0.238
NP_441915.1_4 Reverse -325 -344 6.09517 0.293
NP_441915.1_4 Forward -88 -69 5.40686 0.3
NP_442140.1_3 Reverse -64 -74 11.4848 0.0757
NP_442140.1_3 Reverse -368 -378 5.97822 0.189
NP_442140.1_3 Forward -349 -339 5.68323 0.198
NP_442140.1_3 Forward -71 -61 5.5849 0.202
NP_442140.1_3 Reverse -342 -352 4.69992 0.238
NP_441671.1_10 Reverse -334 -353 1.27776 0.273
NP_440875.1_9 Reverse -343 -353 16.5483 0.0145
NP_440875.1_9 Reverse -65 -75 9.3454 0.233
NP_441813.1_5 Forward -352 -342 18.1713 0.00743
NP_441813.1_5 Reverse -339 -349 16.1063 0.01
NP_441813.1_5 Reverse -61 -71 5.78156 0.109
NP_441813.1_7 Forward -370 -356 10.8154 0.23
NP_440594.1_8 Forward -71 -58 10.3434 0.168
NP_442089.1_6 Reverse -341 -360 7.86593 0.185
NP_440590.1_4 Reverse -342 -355 4.44418 0.0601
NP_440590.1_4 Reverse -64 -77 3.16588 0.0756
NP_440590.1_4 Forward -71 -58 2.96921 0.0783
NP_440590.1_4 Forward -375 -362 -2.93064 0.251
NP_440590.1_4 Reverse -70 -83 -6.07724 0.299
NP_440590.1_9 Reverse -326 -344 10.7372 0.257
NP_440567.1_1 Forward -349 -335 17.3058 0.0153
NP_440567.1_1 Reverse -64 -78 6.6861 0.0816
NP_440567.1_1 Reverse -342 -356 5.80112 0.0959
NP_442497.1_10 Forward -349 -340 19.8626 0.00532
NP_442497.1_10 Reverse -342 -351 17.601 0.00813
NP_442497.1_10 Forward -71 -62 10.1278 0.0166
NP_442497.1_10 Reverse -64 -73 0.589713 0.153
NP_440821.1_4 Reverse -339 -349 19.8429 0.00399
NP_440821.1_4 Reverse -61 -71 9.7148 0.0274
NP_440821.1_4 Forward -74 -64 8.23984 0.053
NP_440821.1_4 Forward -352 -342 2.24165 0.131
NP_440821.1_4 Forward -331 -321 -0.314959 0.251
NP_440227.1_2 Forward -34 -18 17.7581 0.188
NP_441239.1_9 Forward -352 -340 16.5586 0.0166
NP_441239.1_9 Reverse -61 -73 13.2153 0.0386
NP_441239.1_9 Reverse -339 -351 11.7404 0.0551
NP_441239.1_9 Reverse -318 -330 4.5622 0.251
NP_441951.1_4 Reverse -63 -82 1.0811 0.288
NP_441727.1_3 Reverse -56 -75 2.55606 0.299
NP_440400.1_1 Forward -194 -175 -1.77127 0.285
NP_441892.1_1 Reverse -332 -349 4.16874 0.115
NP_441892.1_1 Forward -385 -368 2.30045 0.141
NP_441892.1_1 Forward -338 -321 -3.50107 0.242
NP_441892.1_1 Forward -359 -342 -3.79607 0.249
NP_441892.1_1 Forward -81 -64 -3.79607 0.249
NP_441892.1_4 Reverse -68 -87 4.42435 0.199
NP_440665.1_1 Forward -347 -328 -15.7335 0.275
NP_440604.1_6 Forward -350 -331 -3.3438 0.225
NP_442044.1_1 Forward -77 -58 -3.63879 0.176
NP_442044.1_9 Reverse -341 -360 4.22769 0.23
NP_442044.1_9 Forward -350 -331 2.26107 0.283
NP_442643.1_1 Reverse -335 -354 -0.000545616 0.143
NP_442629.1_3 Reverse -359 -378 5.40766 0.272
NP_440833.1_6 Reverse -24 -38 10.0287 0.255
NP_441526.1_6 Forward -80 -61 3.83436 0.271
NP_442138.1_9 Forward -363 -344 20.3531 0.13
NP_442138.1_10 Reverse -341 -360 -2.26216 0.199
NP_442138.1_10 Forward -350 -331 -8.06369 0.296
NP_440500.1_2 Reverse -152 -171 19.8623 0.0866
NP_440546.1_4 Forward -72 -62 13.8273 0.0459
NP_440546.1_4 Reverse -341 -351 13.5365 0.0459
NP_440546.1_4 Forward -350 -340 12.8578 0.0572
NP_440546.1_4 Reverse -367 -377 12.0821 0.0679
NP_440546.1_4 Reverse -63 -73 7.42815 0.241
NP_441230.1_5 Forward -355 -336 8.55425 0.142
NP_440675.1_1 Reverse -351 -370 3.93269 0.246
NP_440462.1_6 Forward -352 -342 18.7612 0.00454
NP_440462.1_6 Reverse -339 -349 7.84651 0.0699
NP_440462.1_6 Reverse -61 -71 7.45319 0.0788
NP_441184.1_3 Forward -353 -334 5.40766 0.257
NP_441184.1_3 Forward -92 -73 1.17943 0.296
NP_442340.1_3 Reverse -77 -96 -2.55715 0.205
NP_440868.1_4 Forward -354 -342 8.00379 0.0602
NP_440868.1_4 Reverse -337 -349 6.52882 0.0878
NP_440868.1_4 Forward -76 -64 4.8572 0.109
NP_440868.1_4 Reverse -325 -337 0.923956 0.196
NP_441848.1_4 Reverse -16 -32 8.79206 0.288
NP_440696.1_3 Forward -88 -70 6.31233 0.188
NP_440696.1_3 Reverse -75 -93 1.78911 0.217
NP_440696.1_3 Reverse -146 -164 -2.43913 0.274
NP_442039.1_4 Forward -349 -342 15.1821 0.0124
NP_442039.1_4 Reverse -342 -349 15.1821 0.0124
NP_442039.1_4 Forward -71 -64 11.6422 0.0747
NP_441811.1_8 Reverse -57 -71 5.89945 0.289
NP_441811.1_8 Reverse -335 -349 5.80112 0.289
NP_442380.1_10 Forward -88 -70 8.96727 0.262
NP_442829.1_2 Reverse -15 -31 8.14109 0.287
NP_441926.1_3 Reverse -341 -357 6.84337 0.17
NP_442696.1_6 Forward -191 -172 -2.36049 0.147
NP_442837.1_3 Forward -349 -342 15.7721 0.0124
NP_442837.1_3 Reverse -342 -349 15.7721 0.0124
NP_442837.1_3 Forward -71 -64 6.0373 0.25
NP_442837.1_3 Reverse -64 -71 6.0373 0.25
NP_440160.1_2 Forward -239 -220 -8.85033 0.291
NP_442053.1_1 Forward -350 -341 18.3876 0.0007
NP_442053.1_1 Reverse -341 -350 18.3876 0.0007
NP_442053.1_1 Reverse -63 -72 16.6177 0.00257
NP_442053.1_1 Forward -72 -63 8.65285 0.0741
NP_440505.1_3 Forward -352 -342 17.188 0.00332
NP_440505.1_3 Forward -74 -64 15.0247 0.0149
NP_440505.1_3 Reverse -339 -349 7.55152 0.151
NP_441959.1_10 Reverse -212 -230 13.3563 0.186
NP_441102.1_1 Reverse -342 -361 5.01433 0.256
NP_441203.1_1 Forward -349 -330 -12.8819 0.146
NP_441203.1_1 Reverse -342 -361 -13.0786 0.153
NP_440914.1_1 Reverse -341 -351 16.3248 0.00196
NP_440914.1_1 Reverse -63 -73 15.6417 0.00456
NP_440914.1_1 Forward -350 -340 8.51751 0.186
NP_441011.1_1 Reverse -309 -328 11.3075 0.27
NP_441011.1_8 Reverse -342 -351 16.6177 0.00602
NP_441011.1_8 Forward -349 -340 14.356 0.0249
NP_441011.1_8 Forward -71 -62 10.8161 0.094
NP_442101.1_10 Forward -358 -339 2.45773 0.0714
NP_442533.1_1 Reverse -160 -179 -16.3235 0.265
NP_442533.1_1 Reverse -170 -189 -16.4218 0.268
NP_442533.1_6 Forward -350 -341 17.2076 0.00137
NP_442533.1_6 Reverse -341 -350 17.2076 0.00137
NP_442533.1_6 Reverse -63 -72 14.2577 0.0132
NP_442533.1_6 Reverse -326 -335 11.3078 0.0442
NP_442533.1_6 Forward -72 -63 7.47288 0.0898
NP_442533.1_6 Forward -329 -320 6.09625 0.118
NP_442533.1_6 Forward -78 -69 4.52295 0.179
NP_442533.1_6 Forward -260 -251 4.32629 0.184
NP_442533.1_6 Reverse -320 -329 3.83464 0.202
NP_442533.1_6 Forward -310 -301 2.55633 0.25
NP_442232.1_3 Reverse -318 -337 -10.7186 0.273
NP_442232.1_3 Reverse -333 -352 -12.1936 0.282
NP_442232.1_3 Forward -80 -61 -15.8318 0.296
NP_442322.1_4 Forward -189 -172 -9.69657 0.296
NP_442322.1_4 Forward -352 -335 -10.0899 0.298
NP_441482.1_7 Reverse -335 -349 9.73436 0.0155
NP_441482.1_7 Forward -356 -342 6.98109 0.0257
NP_441482.1_7 Forward -78 -64 -8.65353 0.193
NP_441482.1_7 Forward -344 -330 -11.9968 0.288
NP_441482.1_7 Reverse -57 -71 -12.2918 0.292
NP_439944.1_9 Forward -349 -339 17.3846 0.00516
NP_439944.1_9 Reverse -64 -74 9.32148 0.1
NP_439944.1_9 Reverse -342 -352 9.12481 0.1
NP_439944.1_9 Forward -71 -61 8.1415 0.116
NP_441697.1_5 Forward -45 -26 -11.7937 0.299
NP_440116.1_8 Forward -71 -52 -7.96535 0.242
NP_440115.1_6 Forward -75 -65 18.9579 0.0139
NP_440115.1_6 Forward -353 -343 14.0414 0.0615
NP_440115.1_6 Reverse -338 -348 9.7148 0.115
NP_440007.1_9 Reverse -337 -351 10.1277 0.163
NP_440007.1_9 Forward -354 -340 1.96621 0.281
NP_439965.1_1 Reverse -332 -351 -1.57384 0.168
NP_441602.1_3 Forward -77 -58 -1.47551 0.227
NP_441602.1_3 Forward -242 -223 -4.03212 0.258
NP_441972.1_5 Forward -349 -330 -2.85214 0.192
NP_441106.1_1 Forward -351 -342 18.486 0.0028
NP_441106.1_1 Reverse -340 -349 9.73449 0.0311
NP_441106.1_1 Forward -330 -321 5.60459 0.141
NP_441106.1_1 Reverse -319 -328 5.01461 0.191
NP_441420.1_1 Forward -73 -54 -1.7705 0.283
NP_439903.1_6 Forward -353 -334 14.4533 0.0705
NP_439903.1_6 Reverse -60 -79 -0.39464 0.282
NP_439903.1_6 Reverse -338 -357 -1.08295 0.292
NP_442588.1_8 Reverse -214 -233 7.86593 0.238
NP_442306.1_10 Reverse -201 -220 -3.93378 0.11
NP_442306.1_10 Reverse -58 -77 -20.1584 0.202
NP_442306.1_10 Forward -355 -336 -20.2567 0.202
NP_442306.1_10 Reverse -315 -334 -21.535 0.277
NP_441286.1_1 Forward -73 -61 14.7886 0.00418
NP_441286.1_1 Forward -351 -339 14.4936 0.00418
NP_441286.1_1 Reverse -62 -74 2.39892 0.065
NP_441286.1_1 Reverse -340 -352 -3.50094 0.145
NP_440670.1_8 Forward -350 -341 18.3876 0.000699
NP_440670.1_8 Reverse -341 -350 18.3876 0.000699
NP_440670.1_8 Forward -72 -63 18.0926 0.00136
NP_440670.1_8 Reverse -63 -72 15.831 0.00494
NP_441479.1_9 Forward -302 -284 13.2938 0.281
NP_441647.1_8 Forward -153 -134 14.9449 0.248
NP_441930.1_1 Forward -321 -302 8.84924 0.235
NP_441930.1_3 Reverse -14 -33 6.61707 0.263
NP_440886.1_7 Forward -351 -341 8.04271 0.0805
NP_440886.1_7 Reverse -340 -350 8.04271 0.0805
NP_440886.1_7 Forward -330 -320 7.15773 0.103
NP_440886.1_7 Reverse -62 -72 6.76441 0.114
NP_442614.1_2 Forward -350 -336 16.5192 0.0675
NP_442614.1_2 Forward -72 -58 8.94771 0.242
NP_442382.1_7 Forward -363 -344 4.52268 0.253
NP_442072.1_9 Reverse -340 -358 15.8504 0.0023
NP_442072.1_9 Reverse -62 -80 -21.9087 0.215
NP_442401.1_3 Reverse -367 -386 11.5042 0.296
NP_440907.2_8 Forward -71 -61 9.91099 0.103
NP_440907.2_8 Forward -349 -339 9.81266 0.103
NP_440907.2_8 Reverse -342 -352 9.616 0.103
NP_440907.2_8 Reverse -64 -74 9.12434 0.113
NP_442264.1_2 Forward -82 -65 7.80699 0.228
NP_441021.1_1 Reverse -342 -361 -11.9969 0.279
NP_440176.1_3 Forward -345 -331 13.1753 0.261
NP_442459.1_8 Reverse -336 -355 10.5209 0.199
NP_441463.1_2 Forward -31 -13 7.77111 0.14
NP_441463.1_3 Reverse -331 -350 6.98095 0.0573
NP_441463.1_3 Reverse -65 -84 -7.96535 0.262
NP_441463.1_6 Forward -352 -338 5.44959 0.287
NP_442842.1_4 Reverse -342 -361 12.1925 0.185
NP_441626.1_2 Forward -349 -342 15.7721 0.0124
NP_441626.1_2 Reverse -342 -349 15.7721 0.0124
NP_441626.1_2 Forward -71 -64 12.2322 0.0511
NP_441626.1_2 Reverse -64 -71 5.93897 0.231
NP_441901.1_1 Reverse -317 -336 -1.37718 0.298
NP_442365.1_7 Forward -354 -335 -2.85214 0.205
NP_442209.1_6 Forward -328 -309 12.7825 0.268
NP_442794.1_1 Forward -354 -342 10.5604 0.0721
NP_442794.1_1 Forward -76 -64 3.2839 0.286
NP_442615.1_1 Reverse -332 -350 12.1139 0.015
NP_442615.1_1 Reverse -54 -72 -6.56903 0.252
NP_441962.1_4 Forward -77 -58 3.14605 0.102
NP_441962.1_4 Reverse -64 -83 -5.50708 0.169
NP_441962.1_4 Reverse -223 -242 -12.7836 0.265
NP_441962.1_4 Reverse -321 -340 -14.9469 0.296
NP_441742.1_7 Forward -354 -335 20.1573 0.215
NP_440387.1_1 Reverse -341 -357 7.92501 0.0282
NP_440387.1_1 Forward -350 -334 5.56507 0.0315
NP_440387.1_1 Reverse -63 -79 4.3851 0.0426
NP_440387.1_1 Forward -72 -56 -2.00642 0.145
NP_440387.1_1 Forward -64 -48 -2.89139 0.152
NP_441431.1_2 Forward -328 -314 9.53707 0.183
NP_441431.1_2 Forward -353 -339 7.57046 0.238
NP_441431.1_2 Forward -75 -61 5.70218 0.291
NP_441488.1_7 Reverse -57 -76 6.58763 0.139
NP_441488.1_8 Forward -355 -341 9.73373 0.146
NP_441836.1_1 Forward -83 -64 11.5967 0.298
NP_441836.1_2 Reverse -57 -76 7.27595 0.11
NP_441836.1_2 Reverse -323 -342 3.04771 0.16
NP_441836.1_2 Forward -341 -322 0.392778 0.202
NP_441836.1_2 Reverse -314 -333 -4.22878 0.255
NP_441993.1_1 Forward -78 -59 7.69667 0.16
NP_441993.1_1 Reverse -207 -226 6.62464 0.178
NP_441993.1_1 Forward -221 -202 6.52718 0.179
NP_441993.1_1 Reverse -63 -82 5.74752 0.195
NP_441993.1_1 Reverse -206 -225 4.96787 0.21
NP_441993.1_1 Reverse -147 -166 4.18821 0.223
NP_441993.1_1 Reverse -341 -360 3.70092 0.23
NP_441993.1_1 Forward -335 -316 0.972113 0.288
NP_440114.1_10 Forward -72 -58 10.816 0.134
NP_440114.1_10 Forward -350 -336 9.5377 0.169
NP_440114.1_10 Forward -147 -133 8.16106 0.213
NP_440114.1_10 Reverse -206 -220 6.48943 0.269
NP_442437.1_8 Forward -343 -324 7.96426 0.242
NP_442698.1_10 Reverse -322 -341 7.17762 0.233
NP_442323.1_7 Forward -355 -336 17.2065 0.042
NP_441510.2_7 Forward -369 -355 10.422 0.28
NP_441720.1_2 Reverse -90 -109 3.44025 0.236
NP_440293.1_3 Forward -80 -61 0.982764 0.21
NP_440293.1_3 Reverse -346 -365 -4.72043 0.264
NP_440293.1_3 Reverse -169 -188 -5.99873 0.285
NP_440293.1_9 Reverse -246 -260 14.05 0.206
NP_440293.1_9 Reverse -321 -335 11.9241 0.257
NP_440766.1_4 Forward -76 -62 17.4042 0.0256
NP_440766.1_4 Forward -354 -340 5.21113 0.113
NP_439988.1_3 Reverse -342 -356 6.19444 0.278
NP_439988.1_3 Reverse -51 -65 4.42448 0.295
NP_441237.1_9 Forward -71 -61 14.533 0.0323
NP_441237.1_9 Forward -375 -365 10.2065 0.241
NP_442743.1_5 Forward -349 -330 9.3409 0.148
NP_442930.1_1 Reverse -26 -36 10.1076 0.278
NP_441133.1_1 Reverse -157 -176 15.0441 0.2
NP_440457.1_1 Reverse -337 -349 20.6885 0.0344
NP_440457.1_1 Forward -76 -64 8.88877 0.101
NP_440457.1_1 Forward -354 -342 7.70879 0.101
NP_440213.1_8 Reverse -70 -89 19.6648 0.135
NP_442940.1_2 Forward -350 -331 1.47442 0.295
NP_440798.1_6 Forward -349 -336 2.18257 0.186
NP_440798.1_6 Reverse -342 -355 2.08423 0.186
NP_441801.1_4 Forward -359 -349 2.7333 0.262
NP_440801.1_8 Forward -326 -307 9.3409 0.134
NP_440801.1_9 Reverse -31 -45 14.2897 0.257
NP_442297.1_4 Reverse -224 -243 11.9461 0.294
NP_441984.1_3 Reverse -59 -77 6.60732 0.269
NP_442509.1_9 Forward -350 -340 17.3841 0.00128
NP_442509.1_9 Forward -72 -62 14.6309 0.0263
NP_442509.1_9 Reverse -341 -351 8.04271 0.192
NP_442509.1_9 Forward -186 -176 8.04271 0.192
NP_441489.1_3 Reverse -18 -32 6.98253 0.287
NP_442439.1_8 Forward -267 -248 9.63589 0.253
NP_442514.1_5 Forward -268 -249 1.17865 0.178
NP_440734.1_9 Forward -335 -316 10.4225 0.281
NP_440554.1_4 Reverse -342 -352 17.9746 0.0131
NP_440554.1_4 Forward -328 -318 7.55152 0.103
NP_440554.1_4 Forward -349 -339 6.96153 0.107
NP_440554.1_4 Reverse -64 -74 3.42162 0.23
NP_441885.1_5 Forward -350 -340 11.3864 0.00668
NP_441885.1_5 Reverse -341 -351 11.3864 0.00668
NP_441885.1_5 Reverse -63 -73 11.0914 0.00874
NP_441885.1_5 Forward -72 -62 9.12481 0.0238
NP_441885.1_5 Forward -237 -227 5.5849 0.0681
NP_440478.1_4 Forward -76 -57 11.0125 0.264
NP_440478.1_9 Reverse -333 -352 9.63589 0.255
NP_442128.1_2 Reverse -356 -374 8.7706 0.219
NP_441428.1_8 Forward -337 -318 5.40766 0.227
NP_441428.1_8 Reverse -333 -352 4.12936 0.243
NP_442341.1_7 Reverse -62 -76 16.1259 0.0186
NP_442341.1_7 Forward -73 -59 11.2093 0.0567
NP_442341.1_7 Reverse -227 -241 8.35772 0.0881
NP_442341.1_7 Forward -240 -226 6.58777 0.123
NP_442341.1_9 Forward -352 -338 22.5167 0.00232
NP_442341.1_9 Forward -378 -364 5.1122 0.279
NP_441756.1_5 Reverse -337 -356 4.62101 0.199
NP_441756.1_5 Forward -354 -335 -1.96717 0.267
NP_441756.1_5 Forward -270 -251 -5.21209 0.299
NP_442395.2_4 Reverse -62 -81 2.45694 0.223
NP_440423.1_6 Reverse -321 -340 -15.6352 0.229
NP_443000.1_7 Forward -352 -342 20.3345 0.00223
NP_443000.1_7 Reverse -339 -349 8.82982 0.0437
NP_443000.1_7 Reverse -318 -328 0.668351 0.293
NP_443000.1_7 Forward -74 -64 0.668351 0.293
NP_440076.1_5 Reverse -334 -353 18.0915 0.081
NP_440507.2_3 Reverse -317 -336 7.57013 0.274
NP_440507.2_3 Forward -81 -62 7.37347 0.281
NP_441842.1_10 Reverse -334 -348 7.37441 0.258
NP_441842.1_10 Reverse -360 -374 6.78443 0.272
NP_440275.1_3 Forward -352 -342 16.1063 0.0155
NP_440275.1_3 Forward -74 -64 15.123 0.0182
NP_440275.1_3 Reverse -339 -349 10.0098 0.0454
NP_440275.1_3 Reverse -61 -71 9.91146 0.046
NP_440091.1_1 Reverse -337 -349 1.51394 0.197
NP_440091.1_1 Forward -163 -151 -0.74767 0.286
NP_442354.1_8 Reverse -344 -363 11.8975 0.223
NP_440679.1_10 Reverse -322 -341 -20.2567 0.283
NP_441359.1_5 Reverse -338 -357 5.30933 0.196
NP_442451.1_2 Forward -371 -352 4.81767 0.121
NP_442451.1_2 Forward -80 -61 -1.37718 0.172
NP_442451.1_2 Forward -194 -175 -5.80207 0.226
NP_441122.1_1 Reverse -356 -371 2.73316 0.298
NP_439962.1_4 Reverse -321 -340 -5.50708 0.28
NP_439962.1_4 Forward -80 -61 -8.26035 0.292
NP_442495.1_4 Reverse -345 -355 16.303 0.0771
NP_440149.1_10 Forward -363 -344 -12.0953 0.285
NP_441105.1_3 Forward -361 -342 13.3725 0.0297
NP_441105.1_3 Reverse -246 -265 8.75091 0.0472
NP_441105.1_3 Forward -83 -64 -6.39206 0.234
NP_441105.1_3 Forward -340 -321 -7.76869 0.259
NP_440216.1_1 Reverse -341 -355 17.1092 0.00188
NP_440216.1_1 Forward -350 -336 6.88276 0.0116
NP_440216.1_1 Forward -237 -223 -11.7018 0.212
NP_440216.1_1 Forward -72 -58 -12.1934 0.247
NP_440216.1_1 Forward -329 -315 -12.6851 0.296
NP_440216.1_1 Reverse -63 -77 -12.6851 0.296
NP_440701.1_2 Forward -214 -195 16.1257 0.153
NP_440172.1_1 Reverse -341 -351 17.5813 0.00421
NP_440172.1_1 Forward -350 -340 16.303 0.00854
NP_440172.1_1 Reverse -63 -73 12.0747 0.0322
NP_440172.1_1 Forward -72 -62 6.56821 0.102
NP_440172.1_1 Reverse -367 -377 5.97822 0.121
NP_440167.1_3 Reverse -218 -237 9.14423 0.26
NP_442015.1_10 Forward -354 -341 13.4906 0.0354
NP_442015.1_10 Reverse -337 -350 10.049 0.0415
NP_442015.1_10 Forward -76 -63 2.67422 0.187
NP_442329.1_8 Reverse -355 -374 9.43923 0.17
NP_441226.1_7 Forward -349 -342 14.4934 0.0123
NP_441226.1_7 Reverse -342 -349 14.4934 0.0123
NP_441226.1_7 Forward -71 -64 12.7234 0.0312
NP_441226.1_7 Reverse -64 -71 11.5435 0.0757
NP_440198.1_2 Forward -364 -345 17.6301 0.206
NP_442446.1_7 Forward -310 -291 -1.57384 0.294
NP_442834.1_9 Reverse -365 -384 7.86593 0.195
NP_441757.1_3 Forward -351 -332 3.44104 0.155
NP_441757.1_3 Forward -73 -54 -2.75381 0.288
NP_441111.1_7 Forward -349 -341 18.7023 0.00294
NP_441111.1_7 Reverse -342 -350 18.7023 0.00294
NP_441111.1_7 Forward -71 -63 8.96754 0.0463
NP_441111.1_7 Reverse -64 -72 8.86921 0.0589
NP_441111.1_7 Reverse -321 -329 -0.472234 0.131
NP_442379.1_10 Forward -357 -340 11.3469 0.0787
NP_442379.1_10 Reverse -334 -351 4.75873 0.141
NP_442379.1_10 Forward -79 -62 0.825489 0.223
NP_441766.1_2 Forward -350 -341 17.5026 0.00297
NP_441766.1_2 Reverse -341 -350 17.5026 0.00297
NP_441766.1_2 Reverse -63 -72 13.9627 0.0114
NP_441766.1_2 Forward -72 -63 7.76787 0.0714
NP_442417.1_5 Reverse -341 -355 14.3559 0.0633
NP_442417.1_5 Forward -230 -216 8.94771 0.142
NP_440416.1_9 Reverse -334 -353 3.73603 0.0362
NP_440416.1_9 Forward -79 -60 -5.60541 0.0813
NP_440416.1_9 Forward -357 -338 -6.98204 0.0951
NP_440416.1_9 Reverse -68 -87 -8.35868 0.114
NP_440416.1_9 Forward -345 -326 -16.7168 0.22
NP_440416.1_9 Forward -336 -317 -17.5035 0.241
NP_443052.1_8 Reverse -331 -350 -2.0655 0.0864
NP_443052.1_9 Forward -157 -138 -3.63879 0.251
NP_443052.1_9 Forward -374 -355 -6.09707 0.276
NP_442552.1_9 Forward -80 -61 17.109 0.103
NP_442116.1_6 Reverse -15 -32 14.0895 0.171
NP_441940.1_2 Reverse -247 -266 11.2092 0.248
NP_441940.1_4 Forward -352 -333 28.4171 0.00114
NP_440591.1_9 Forward -79 -61 3.85406 0.295
NP_442154.1_1 Reverse -151 -169 -10.8956 0.211
NP_442154.1_1 Reverse -359 -377 -15.3205 0.218
NP_440261.1_5 Reverse -342 -355 6.70579 0.0318
NP_440261.1_5 Forward -71 -58 6.60746 0.0318
NP_440261.1_5 Forward -349 -336 -0.865694 0.0655
NP_440261.1_5 Reverse -64 -77 -10.8955 0.221
NP_440261.1_5 Reverse -321 -334 -12.0754 0.27
NP_440988.1_10 Forward -80 -66 11.4821 0.187
NP_440988.1_10 Reverse -67 -81 10.998 0.187
NP_440988.1_10 Reverse -61 -75 7.41596 0.216
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AGGGCCCAAATTCGCACCGTGGTACACCATCGCCAACAGCAAAAGCCCCAGGCGATCGCCCTGCCGGTCACGGCCACCGCTTGGCAAGAAGCCCGCCGCCTCAAGGAAGCAGAGGAATACCGACTACTCTACGTCGCTATGACCAGGGCCAAGCGTTTATTGTGGCTATCCGCCGCCCAGGAAGGGCCCTTTGCCTGGAACCAAATGCAAGCCCGCAAATCCCCCCGACTACAACCCAAACAACCATCCCAGGCCCTATTGGCCCTACAAAAGCGTTTTGGTTCCTAGGGGAAGGACTATAATCGGATCCAAGGGCATCAGTGGCCGTGGCGATCGGCCCAAAGCCTCACTCCACAACGGTCTTGGTAAATTTTTGTCTAGATTTTTGGTTCGCTTGACA

CDS

GTGCTATTTTTGTGCAACTTGCTTTGGCTAGGGATCGCAAGATCTCCCACTTTGGCCGAATCACTGCCTGACCGATGGGAAGCCTATCCCCAGTGGTCTAATTTGCCCACCCTAGAGCAAAGAAAGGGAGAAATTCGTTATCCTGAATGGTTTGCCGGCACATGGCAGGTCACCAGTACTCTTGTCGAACAACTAGCCCCCCTGGCCCCGGATATCGTCAGCCCCGGCTTTGCTAAGAATGCCGCCTATCTGGAGCAACCAATAGAATTTCCCGTCAGATTCATCGACCAAACCCCCCTGCCGGAATTTAACTGGGCCCTATCGGATTTGGTCAACAATGAACCAGTTATTGTGCCCGATCGCCGTTTTAACGCTGAAGCCATCACCCAGGCTTATTTGGGTAAGGACGGAGAAGAAATAAATGTTACTGTCCAGGTTAAAGAACAACCCAGTCCCCGCCTAGTCACCGTTTTTCCCCAACATCAACGACTAGTTTCCACTGTCCTAGGTTACAGCCAAAGGAGTCCCGACCCGGAGCACTTTCTCGCCACGGAGCTGACCAACCAACAATTTATTGCTGGCAGTACCCAATACCTCAACCAGGTGGAAACTACCACTGACTATCACCATGTTGGCCCGGGAAAAATCAGCGCCAGTCAAGTTACCGCCGTATACTTGTCCCCCACGGACCCCGATTATTTCGCCGCTGGCCACCAACCCATTGCCCTATATCGCTATGAACTTACCCTAGAAGCTGTGCCAGAACTATGA

Protein

MLFLCNLLWLGIARSPTLAESLPDRWEAYPQWSNLPTLEQRKGEIRYPEWFAGTWQVTSTLVEQLAPLAPDIVSPGFAKNAAYLEQPIEFPVRFIDQTPLPEFNWALSDLVNNEPVIVPDRRFNAEAITQAYLGKDGEEINVTVQVKEQPSPRLVTVFPQHQRLVSTVLGYSQRSPDPEHFLATELTNQQFIAGSTQYLNQVETTTDYHHVGPGKISASQVTAVYLSPTDPDYFAAGHQPIALYRYELTLEAVPEL