Your browser is old and dusty. Try Google Chrome!

Details for sll1101

ORF sll1101
Accession NP_441640.1
Symbol rps10
Category Ribosomal proteins: synthesis and modification
Definition 30S ribosomal protein S10
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -73 -59 2.35953 0.177
NP_441061.1_2 Reverse -169 -183 -2.36035 0.29
NP_441061.1_2 Reverse -221 -235 -2.65535 0.3
NP_441418.1_6 Forward -178 -159 -23.895 0.198
NP_441418.1_6 Forward -198 -179 -28.0249 0.203
NP_441418.1_6 Reverse -220 -239 -28.4182 0.205
NP_441453.1_4 Reverse -220 -228 6.80426 0.121
NP_441453.1_4 Forward -229 -221 6.11594 0.121
NP_442151.1_6 Forward -229 -215 8.65272 0.167
NP_440561.1_4 Reverse -175 -194 20.797 0.0916
NP_441818.1_1 Forward -228 -217 15.2011 0.0343
NP_441818.1_9 Forward -110 -91 5.211 0.153
NP_441818.1_9 Forward -116 -97 0.0977854 0.191
NP_441818.1_9 Forward -171 -152 -8.06369 0.274
NP_441818.1_9 Reverse -304 -323 -10.0303 0.292
NP_440226.1_1 Reverse -220 -239 5.50599 0.154
NP_441098.1_3 Reverse -39 -58 -3.15222 0.28
NP_442287.1_1 Forward -75 -65 14.6309 0.256
NP_442173.1_1 Forward -228 -220 12.0158 0.0316
NP_442173.1_1 Reverse -221 -229 4.83764 0.241
NP_442752.1_4 Forward -264 -257 15.0838 0.0199
NP_442752.1_4 Reverse -220 -227 13.8055 0.0199
NP_442752.1_4 Forward -211 -204 9.18389 0.116
NP_441812.1_3 Reverse -219 -233 8.94771 0.248
NP_442975.1_10 Forward -394 -380 5.60385 0.216
NP_442975.1_10 Forward -233 -219 2.35894 0.276
NP_440784.1_7 Reverse -221 -228 6.23397 0.241
NP_440784.1_7 Forward -228 -221 6.13563 0.241
NP_439979.1_9 Forward -182 -164 8.67227 0.26
NP_442062.1_3 Forward -22 -3 -2.26216 0.269
NP_441900.1_1 Reverse -282 -301 10.0752 0.273
NP_440839.1_8 Reverse -63 -76 22.3404 0.0384
NP_441781.1_7 Forward -229 -210 0.982764 0.239
NP_439918.1_2 Forward -280 -261 -4.81876 0.287
NP_442276.1_2 Reverse -208 -227 6.29264 0.291
NP_440132.1_6 Forward -298 -279 15.0441 0.117
NP_441925.1_4 Reverse -91 -110 -15.0459 0.263
NP_441925.1_4 Reverse -94 -113 -16.2258 0.281
NP_441083.1_5 Forward -229 -219 17.7779 0.00336
NP_441083.1_5 Reverse -255 -265 -0.511621 0.269
NP_441083.1_5 Reverse -220 -230 -1.00328 0.289
NP_441978.1_8 Reverse -286 -305 10.0292 0.299
NP_441738.1_2 Forward -227 -220 15.28 0.0102
NP_441738.1_2 Reverse -257 -264 11.7401 0.0647
NP_441558.1_5 Forward -180 -161 6.29264 0.22
NP_440209.1_1 Reverse -220 -228 8.57422 0.0425
NP_440209.1_1 Forward -229 -221 5.52596 0.0821
NP_440209.1_1 Forward -264 -256 5.13263 0.17
NP_442765.1_1 Forward -203 -184 8.75091 0.217
NP_442889.1_8 Reverse -187 -201 5.01387 0.243
NP_442889.1_8 Forward -232 -218 3.53891 0.275
NP_441713.1_7 Reverse -221 -240 13.1758 0.293
NP_440906.1_5 Forward -263 -256 8.79057 0.149
NP_440906.1_5 Reverse -221 -228 6.23397 0.234
NP_440906.1_5 Forward -228 -221 6.13563 0.241
NP_440747.1_10 Forward -267 -255 -2.71429 0.0639
NP_440747.1_10 Reverse -217 -229 -11.9574 0.178
NP_441130.1_10 Reverse -167 -181 5.40779 0.231
NP_441486.1_1 Reverse -217 -231 -5.11362 0.222
NP_442330.1_9 Reverse -190 -209 8.94757 0.237
NP_443017.1_2 Forward -46 -27 17.8957 0.0493
NP_442848.1_1 Reverse -214 -228 -2.75368 0.263
NP_443018.1_3 Forward -228 -221 11.7405 0.0655
NP_443018.1_3 Forward -222 -215 8.49558 0.141
NP_443018.1_3 Reverse -221 -228 5.44732 0.193
NP_440376.1_1 Reverse -220 -229 5.99792 0.111
NP_440376.1_1 Reverse -65 -74 4.42462 0.159
NP_440376.1_1 Forward -229 -220 -0.196935 0.285
NP_441588.1_4 Forward -227 -217 8.63316 0.14
NP_442958.1_3 Forward -308 -289 6.4893 0.188
NP_441013.1_3 Reverse -304 -323 6.88262 0.276
NP_441682.1_2 Forward -79 -60 0.786102 0.259
NP_441422.1_3 Reverse -349 -368 15.58 0.228
NP_440667.1_2 Reverse -295 -314 -3.44213 0.232
NP_441950.1_2 Forward -54 -35 18.2882 0.171
NP_442658.1_1 Reverse -253 -263 6.46942 0.229
NP_442658.1_1 Reverse -281 -291 6.0761 0.238
NP_442782.1_2 Forward -280 -266 1.86788 0.281
NP_442782.1_2 Forward -210 -196 0.294584 0.291
NP_441414.1_9 Reverse -220 -239 -1.37718 0.0996
NP_441958.1_5 Forward -230 -220 1.55333 0.095
NP_441958.1_5 Reverse -219 -229 0.865012 0.12
NP_441127.1_1 Forward -192 -178 8.25939 0.3
NP_440984.1_3 Reverse -353 -372 12.8808 0.283
NP_439990.1_5 Reverse -215 -228 10.2457 0.128
NP_439990.1_5 Forward -269 -256 8.86907 0.158
NP_439990.1_8 Reverse -71 -90 11.1109 0.0977
NP_440153.1_5 Forward -177 -163 1.86788 0.245
NP_440827.1_3 Reverse -209 -228 10.8159 0.291
NP_440809.1_9 Forward -238 -220 2.87075 0.118
NP_442438.1_10 Reverse -283 -297 1.57289 0.191
NP_442431.1_10 Forward -303 -285 6.01734 0.195
NP_442431.1_10 Forward -171 -153 -0.7675 0.294
NP_440147.1_4 Forward -76 -63 1.49425 0.226
NP_441550.1_8 Reverse -218 -228 11.091 0.0555
NP_441550.1_8 Forward -231 -221 8.43603 0.124
NP_441041.1_4 Forward -229 -210 -4.81876 0.143
NP_441041.1_4 Forward -297 -278 -8.06369 0.196
NP_441547.1_2 Forward -275 -257 8.18062 0.215
NP_441725.1_5 Forward -228 -218 1.455 0.135
NP_441725.1_5 Reverse -221 -231 -0.511621 0.26
NP_439966.1_7 Forward -231 -221 14.5325 0.0203
NP_439966.1_7 Reverse -218 -228 6.0761 0.195
NP_442941.1_3 Forward -228 -218 10.1081 0.024
NP_442941.1_3 Reverse -221 -231 0.766681 0.171
NP_442941.1_3 Reverse -256 -266 -0.0199663 0.244
NP_440289.1_2 Reverse -217 -230 -4.50394 0.288
NP_440983.1_5 Reverse -96 -115 -8.26035 0.294
NP_440260.1_8 Forward -208 -190 -6.76569 0.295
NP_442281.1_1 Forward -79 -65 4.62054 0.187
NP_441334.1_7 Reverse -175 -194 -20.5517 0.277
NP_440177.1_9 Forward -237 -218 11.9958 0.239
NP_442012.1_5 Forward -298 -279 5.89931 0.256
NP_442012.1_5 Reverse -288 -307 1.96607 0.275
NP_440375.1_6 Reverse -228 -247 17.3057 0.128
NP_441644.1_6 Forward -229 -219 14.4342 0.0126
NP_441644.1_6 Reverse -169 -179 6.96107 0.141
NP_441644.1_6 Reverse -220 -230 5.68278 0.18
NP_441644.1_6 Reverse -381 -391 3.61784 0.272
NP_443049.1_6 Reverse -219 -229 14.4711 0.114
NP_440652.1_1 Reverse -187 -206 4.42435 0.278
NP_442029.1_6 Forward -297 -278 4.32602 0.271
NP_440253.1_2 Forward -229 -211 -3.32411 0.291
NP_440929.1_8 Forward -229 -220 7.07956 0.0713
NP_440430.1_4 Forward -307 -288 12.3883 0.276
NP_441751.2_8 Reverse -256 -270 -4.91696 0.187
NP_441751.2_8 Forward -228 -214 -5.40861 0.206
NP_442554.1_8 Forward -228 -218 6.07655 0.126
NP_442554.1_8 Reverse -221 -231 5.09324 0.161
NP_442554.1_8 Forward -177 -167 2.83163 0.253
NP_442313.1_6 Forward -88 -69 10.8159 0.251
NP_442142.1_4 Reverse -159 -172 9.5568 0.0929
NP_442292.1_1 Forward -228 -219 8.65285 0.0335
NP_441715.1_4 Forward -228 -218 4.99491 0.24
NP_441468.1_1 Reverse -66 -73 6.72562 0.126
NP_441468.1_1 Reverse -221 -228 6.13563 0.209
NP_441468.1_1 Forward -228 -221 6.0373 0.223
NP_441618.1_9 Forward -292 -273 17.6346 0.216
NP_441020.2_6 Reverse -218 -235 10.8552 0.133
NP_441020.2_6 Reverse -296 -313 7.70866 0.222
NP_441015.1_10 Reverse -289 -308 -0.590531 0.169
NP_441673.1_1 Reverse -220 -229 1.37636 0.114
NP_441673.1_1 Forward -229 -220 1.1797 0.163
NP_441673.1_1 Reverse -381 -390 -7.86675 0.187
NP_441673.1_1 Forward -390 -381 -7.96508 0.206
NP_442253.1_5 Reverse -62 -79 0.727158 0.203
NP_441826.1_2 Forward -229 -215 -0.393733 0.212
NP_441826.1_2 Reverse -214 -228 -3.73699 0.286
NP_441826.1_5 Reverse -289 -308 7.07928 0.222
NP_442868.1_6 Forward -299 -289 0.373358 0.234
NP_442868.1_6 Reverse -218 -228 0.176696 0.247
NP_442868.1_6 Forward -266 -256 -0.314959 0.284
NP_442227.1_2 Forward -364 -345 4.916 0.202
NP_443058.1_7 Reverse -219 -238 3.6377 0.26
NP_442808.1_1 Forward -230 -220 9.71433 0.0481
NP_442808.1_1 Reverse -189 -199 5.19112 0.168
NP_441101.1_10 Forward -301 -282 -4.81876 0.281
NP_442542.1_9 Reverse -162 -176 4.62054 0.292
NP_442050.1_5 Forward -231 -221 14.9258 0.0175
NP_442050.1_5 Reverse -218 -228 6.76441 0.282
NP_442342.1_9 Forward -76 -60 2.51681 0.286
NP_440558.1_2 Forward -83 -64 -7.57203 0.296
NP_441878.1_6 Reverse -64 -74 0.963343 0.128
NP_441878.1_6 Forward -75 -65 -0.0199663 0.163
NP_441036.1_8 Reverse -349 -359 6.96153 0.213
NP_441557.1_5 Reverse -220 -229 1.08137 0.0794
NP_441557.1_5 Forward -229 -220 0.589713 0.134
NP_441557.1_8 Forward -73 -63 10.501 0.286
NP_442356.1_1 Reverse -364 -383 8.25926 0.268
NP_442066.2_9 Forward -233 -220 9.45906 0.175
NP_442579.1_9 Reverse -158 -177 6.4893 0.227
NP_441308.1_8 Reverse -253 -263 10.7964 0.22
NP_442183.1_1 Reverse -220 -234 18.1908 0.00836
NP_442347.1_2 Forward -228 -219 10.3245 0.058
NP_442347.1_2 Reverse -256 -265 7.17789 0.13
NP_441037.1_4 Reverse -167 -177 9.94904 0.21
NP_440136.1_2 Reverse -221 -228 6.23397 0.171
NP_440136.1_2 Forward -228 -221 6.13563 0.193
NP_442998.1_10 Forward -227 -220 15.5754 0.0102
NP_442998.1_10 Reverse -257 -264 5.74231 0.255
NP_442998.1_10 Forward -361 -354 3.97235 0.297
NP_440299.1_1 Reverse -176 -189 2.57534 0.284
NP_441799.1_1 Forward -233 -219 6.48882 0.17
NP_441007.1_10 Forward -234 -221 -1.06236 0.3
NP_442333.2_5 Reverse -158 -177 -14.0619 0.271
NP_440256.1_1 Reverse -217 -236 -0.4922 0.0936
NP_440256.1_1 Forward -214 -195 -7.67036 0.243
NP_442007.1_8 Reverse -182 -200 11.2281 0.258
NP_442302.1_6 Reverse -55 -74 11.1109 0.274
NP_440915.1_6 Reverse -216 -230 11.996 0.023
NP_440915.1_6 Reverse -61 -75 8.84938 0.0499
NP_442452.1_8 Forward -229 -215 14.9452 0.273
NP_440748.1_5 Reverse -285 -304 -1.86883 0.27
NP_440748.1_5 Reverse -104 -123 -2.16383 0.271
NP_441464.1_8 Forward -387 -373 6.09611 0.247
NP_441464.1_10 Forward -112 -98 13.5693 0.199
NP_440695.1_6 Reverse -82 -96 9.1509 0.296
NP_442386.1_9 Forward -230 -221 4.52254 0.297
NP_441340.1_5 Reverse -221 -228 13.5105 0.0314
NP_441340.1_5 Forward -228 -221 5.84064 0.208
NP_441947.1_4 Forward -197 -178 12.8808 0.226
NP_440161.1_3 Reverse -218 -237 9.63589 0.238
NP_441027.1_1 Forward -240 -226 10.1271 0.299
NP_440586.1_8 Forward -228 -221 9.47853 0.146
NP_440586.1_8 Reverse -221 -228 5.74197 0.283
NP_440192.1_5 Forward -298 -279 5.89931 0.228
NP_441262.1_3 Reverse -220 -227 14.7888 0.0223
NP_440027.1_8 Reverse -262 -281 7.4718 0.261
NP_440027.1_8 Reverse -199 -218 4.52188 0.287
NP_443051.1_1 Reverse -219 -228 7.47288 0.0571
NP_443051.1_1 Forward -230 -221 0.29472 0.195
NP_439937.1_9 Reverse -179 -196 -15.1047 0.287
NP_440372.1_2 Reverse -221 -228 13.8055 0.0214
NP_440372.1_2 Forward -228 -221 6.52896 0.188
NP_440372.1_3 Forward -16 -2 15.1948 0.165
NP_441789.1_7 Forward -317 -298 2.06362 0.237
NP_441803.1_2 Reverse -157 -176 6.39097 0.154
NP_441803.1_2 Forward -79 -60 0.294447 0.255
NP_440139.1_1 Forward -184 -165 1.76863 0.249
NP_442384.1_10 Reverse -255 -268 5.52582 0.127
NP_440364.1_6 Forward -172 -159 13.2934 0.282
NP_441018.1_7 Forward -115 -96 6.39097 0.289
NP_442790.1_4 Reverse -372 -391 -10.9153 0.219
NP_442790.1_4 Reverse -211 -230 -14.0619 0.271
NP_442262.1_10 Forward -228 -221 13.2155 0.0213
NP_442262.1_10 Forward -222 -215 8.59391 0.22
NP_441689.1_5 Reverse -218 -228 12.7626 0.113
NP_441689.1_5 Forward -231 -221 8.53436 0.132
NP_440163.1_10 Reverse -217 -227 11.3864 0.169
NP_440344.1_10 Forward -236 -219 -9.59759 0.15
NP_442832.1_7 Forward -203 -184 18.584 0.223
NP_441640.1_1 Forward -279 -260 32.1537 0.000104
NP_441640.1_2 Forward -207 -188 34.1203 0.0000403
NP_441640.1_3 Forward -360 -341 34.1194 0.0000289
NP_441640.1_4 Forward -186 -167 32.3503 0.0000773
NP_441640.1_5 Forward -339 -320 33.9236 0.0000191
NP_441640.1_6 Forward -387 -368 34.4153 0.0000143
NP_441640.1_7 Forward -251 -232 27.8271 0.0015
NP_441640.1_8 Forward -228 -209 32.9403 0.0000272
NP_441640.1_9 Forward -165 -146 26.7455 0.00268
NP_441640.1_10 Forward -309 -290 24.8772 0.0102
NP_440297.1_9 Forward -228 -218 -0.511621 0.289
NP_442187.1_3 Reverse -219 -229 15.6147 0.105
NP_442280.1_10 Forward -84 -66 6.62323 0.27
NP_440894.1_4 Reverse -209 -228 2.3594 0.224
NP_440937.1_5 Forward -117 -98 17.6007 0.249
NP_440999.1_9 Reverse -380 -394 1.27789 0.168
NP_440888.1_2 Forward -229 -215 15.1419 0.0122
NP_440888.1_2 Forward -74 -60 14.2569 0.0193
NP_440888.1_2 Reverse -202 -216 5.1122 0.293
NP_442892.1_1 Reverse -39 -58 4.52268 0.282
NP_441771.1_8 Forward -33 -14 8.92807 0.153
NP_440600.1_4 Forward -237 -219 6.50899 0.0974
NP_441543.1_2 Forward -228 -219 7.07956 0.131
NP_442845.1_2 Reverse -214 -228 12.291 0.114
NP_442845.1_2 Reverse -59 -73 8.94771 0.183
NP_442315.1_1 Forward -121 -103 7.68896 0.239
NP_442578.1_7 Reverse -221 -228 6.0373 0.18
NP_440071.1_1 Forward -305 -288 10.5595 0.253
NP_441462.1_2 Reverse -220 -230 16.2046 0.00406
NP_441462.1_2 Reverse -381 -391 -0.41329 0.225
NP_443062.1_1 Forward -229 -211 5.32818 0.231
NP_441601.1_4 Reverse -284 -303 -1.08219 0.293
NP_442204.1_1 Forward -190 -179 6.15519 0.173
NP_442204.1_1 Reverse -216 -227 0.353664 0.281
NP_442204.1_5 Forward -202 -183 3.04771 0.198
NP_442487.1_6 Forward -205 -186 14.6499 0.196
NP_440516.1_8 Reverse -220 -229 18.9776 0.00442
NP_440516.1_8 Forward -229 -220 5.01461 0.118
NP_441785.1_1 Reverse -265 -279 11.7688 0.285
NP_442428.1_5 Reverse -221 -228 6.13563 0.209
NP_442428.1_5 Forward -228 -221 6.0373 0.212
NP_440673.1_3 Forward -227 -220 12.4288 0.0426
NP_441052.1_2 Forward -229 -219 10.6981 0.0285
NP_441052.1_2 Forward -74 -64 5.5849 0.111
NP_441052.1_2 Reverse -255 -265 -0.216628 0.269
NP_442219.1_9 Forward -228 -219 7.96454 0.0696
NP_442219.1_9 Reverse -256 -265 5.11294 0.186
NP_440436.1_4 Reverse -256 -265 11.0124 0.0655
NP_440436.1_4 Forward -228 -219 7.57079 0.124
NP_441719.1_4 Reverse -221 -228 6.82395 0.0855
NP_441719.1_4 Forward -228 -221 6.52896 0.188
NP_441004.1_1 Forward -286 -267 -13.1769 0.255
NP_441004.1_1 Forward -198 -179 -14.0619 0.263
NP_441004.1_2 Forward -291 -272 0.392778 0.236
NP_441004.1_2 Reverse -317 -336 -4.6221 0.293
NP_442206.1_10 Reverse -220 -235 5.87976 0.178
NP_441851.1_10 Forward -265 -255 4.60159 0.259
NP_442011.1_1 Reverse -219 -238 2.26107 0.256
NP_442515.1_1 Reverse -380 -394 -0.492064 0.224
NP_440593.1_3 Reverse -60 -79 3.04771 0.164
NP_441982.1_7 Forward -364 -345 18.1907 0.252
NP_441349.1_10 Forward -274 -255 -2.85214 0.127
NP_441409.1_6 Forward -235 -216 -14.8485 0.269
NP_441409.1_6 Reverse -249 -268 -15.3402 0.29
NP_441394.1_10 Reverse -98 -116 9.94979 0.263
NP_439960.1_10 Forward -307 -289 -3.12744 0.267
NP_442450.1_5 Forward -76 -66 11.1898 0.115
NP_442168.1_5 Forward -185 -166 6.39097 0.192
NP_440588.1_2 Reverse -211 -230 -5.31042 0.247
NP_441570.1_1 Reverse -220 -238 -6.96235 0.0829
NP_441570.1_1 Forward -280 -262 -16.3038 0.242
NP_441078.1_4 Reverse -220 -229 0.196389 0.205
NP_441078.1_4 Forward -229 -220 -0.000272808 0.205
NP_441078.1_4 Forward -74 -65 -1.6719 0.266
NP_441078.1_4 Reverse -65 -74 -1.86856 0.272
NP_442729.1_5 Forward -193 -183 8.23984 0.248
NP_440526.1_3 Forward -73 -62 10.1862 0.0646
NP_440526.1_3 Reverse -256 -267 4.77807 0.267
NP_440526.1_3 Forward -228 -217 0.54986 0.275
NP_441432.1_8 Reverse -219 -228 14.0611 0.0258
NP_442320.1_8 Reverse -214 -228 4.71948 0.0472
NP_441732.1_2 Forward -394 -378 -16.2644 0.165
NP_441732.1_2 Forward -397 -381 -16.3627 0.165
NP_442003.1_4 Forward -228 -209 11.7992 0.272
NP_440760.1_7 Forward -208 -189 4.32522 0.232
NP_440199.1_10 Reverse -217 -227 16.7946 0.0381
NP_440713.1_4 Reverse -210 -229 2.55606 0.26
NP_442489.1_7 Forward -229 -220 0.688044 0.152
NP_442489.1_7 Reverse -220 -229 0.688044 0.152
NP_442489.1_7 Reverse -65 -74 -1.37691 0.195
NP_442079.1_7 Reverse -221 -240 8.94757 0.118
NP_440559.1_1 Forward -228 -219 7.76787 0.0918
NP_440559.1_1 Reverse -256 -265 4.32629 0.288
NP_441659.2_8 Forward -229 -219 5.48657 0.106
NP_441659.2_8 Forward -264 -254 4.50326 0.132
NP_441659.2_8 Reverse -384 -394 2.7333 0.19
NP_441659.2_8 Reverse -220 -230 1.84832 0.224
NP_441659.2_8 Reverse -169 -179 -0.216628 0.292
NP_441022.1_1 Forward -155 -146 10.9707 0.284
NP_442849.1_1 Reverse -362 -376 15.8309 0.201
NP_442776.1_1 Reverse -36 -55 8.35759 0.197
NP_442346.1_1 Forward -177 -158 10.7175 0.27
NP_442346.1_5 Forward -265 -255 4.40493 0.29
NP_440545.1_3 Forward -391 -374 -3.40274 0.203
NP_440545.1_3 Forward -301 -284 -3.99273 0.215
NP_440459.1_8 Forward -226 -208 9.95058 0.258
NP_441653.1_2 Forward -308 -289 13.193 0.0959
NP_441653.1_3 Reverse -307 -321 14.0609 0.265
NP_442603.1_7 Forward -229 -215 7.86545 0.193
NP_442603.1_7 Reverse -220 -234 7.17714 0.211
NP_441833.1_4 Forward -228 -221 6.52896 0.0924
NP_441833.1_4 Reverse -221 -228 6.23397 0.163
NP_441329.1_6 Reverse -144 -163 -0.907597 0.286
NP_442162.1_9 Forward -228 -221 12.9205 0.0282
NP_442162.1_9 Reverse -221 -228 12.9205 0.0282
NP_440671.1_4 Reverse -214 -228 15.7325 0.039
NP_442140.1_3 Reverse -170 -180 8.04317 0.124
NP_441813.1_5 Forward -231 -221 12.7631 0.0192
NP_441813.1_5 Reverse -218 -228 6.17489 0.1
NP_441259.1_8 Reverse -180 -199 12.4867 0.254
NP_440590.1_4 Forward -177 -164 8.9674 0.0402
NP_440590.1_4 Forward -228 -215 4.73917 0.0594
NP_440590.1_4 Forward -198 -185 -1.75067 0.228
NP_440590.1_4 Forward -73 -60 -6.07724 0.299
NP_440567.1_1 Reverse -221 -235 1.47456 0.204
NP_442497.1_10 Forward -228 -219 0.589713 0.153
NP_442497.1_10 Reverse -221 -230 -1.18024 0.256
NP_440821.1_4 Reverse -218 -228 8.53483 0.0468
NP_441239.1_9 Forward -231 -219 10.5604 0.076
NP_441239.1_9 Reverse -63 -75 5.34885 0.223
NP_441239.1_9 Reverse -167 -179 3.87389 0.272
NP_441009.1_4 Forward -309 -290 11.3075 0.257
NP_442044.1_1 Reverse -169 -188 -5.01543 0.18
NP_442270.1_9 Reverse -209 -228 -9.14533 0.228
NP_442629.1_3 Reverse -305 -324 0.0977854 0.294
NP_441526.1_6 Forward -174 -155 3.04771 0.271
NP_441617.1_6 Forward -152 -133 -2.95047 0.262
NP_440546.1_4 Reverse -220 -230 15.6695 0.0459
NP_442041.1_5 Reverse -163 -182 -1.67217 0.29
NP_440462.1_6 Forward -231 -221 12.9597 0.0319
NP_442611.1_3 Forward -121 -103 12.6055 0.264
NP_440868.1_4 Forward -233 -221 0.0389777 0.234
NP_442402.1_2 Reverse -270 -284 10.422 0.292
NP_442402.1_6 Forward -285 -276 14.4544 0.241
NP_440696.1_9 Reverse -205 -224 12.29 0.296
NP_440843.1_8 Forward -280 -261 12.7825 0.297
NP_442023.1_2 Reverse -72 -91 4.62101 0.286
NP_442039.1_4 Reverse -221 -228 11.6422 0.0747
NP_441811.1_1 Forward -238 -219 3.93269 0.299
NP_442837.1_3 Forward -228 -221 6.0373 0.25
NP_442837.1_3 Reverse -221 -228 6.0373 0.25
NP_442053.1_1 Forward -229 -220 14.4544 0.0114
NP_442053.1_1 Reverse -220 -229 7.86621 0.0863
NP_440505.1_3 Forward -266 -256 16.303 0.00696
NP_440505.1_3 Reverse -218 -228 14.7297 0.0176
NP_440520.1_2 Forward -281 -263 12.6055 0.0632
NP_442532.1_7 Reverse -220 -234 1.27789 0.296
NP_440914.1_1 Forward -229 -219 13.1043 0.0386
NP_440914.1_1 Reverse -220 -230 10.8597 0.118
NP_440914.1_1 Reverse -255 -265 6.3705 0.283
NP_441011.1_8 Reverse -221 -230 11.5045 0.0778
NP_441011.1_8 Forward -198 -189 7.07956 0.179
NP_441011.1_8 Forward -273 -264 5.60459 0.247
NP_442533.1_6 Forward -74 -65 14.1594 0.0149
NP_442533.1_6 Forward -229 -220 4.42462 0.179
NP_442533.1_6 Reverse -381 -390 2.65466 0.246
NP_442541.1_10 Forward -80 -66 5.21053 0.248
NP_442541.1_10 Forward -367 -353 1.27731 0.287
NP_443016.1_5 Forward -375 -356 5.40686 0.266
NP_441482.1_7 Forward -235 -221 -7.37523 0.193
NP_439944.1_9 Forward -228 -218 9.22315 0.1
NP_440116.1_8 Forward -228 -209 6.78429 0.0528
NP_440115.1_6 Forward -267 -257 6.27322 0.191
NP_440007.1_9 Reverse -216 -230 16.3225 0.163
NP_439965.1_1 Forward -273 -254 -8.85033 0.278
NP_441602.1_3 Forward -183 -164 -1.08219 0.226
NP_441972.1_5 Forward -302 -283 -3.24547 0.199
NP_441286.1_1 Reverse -219 -231 3.97222 0.0397
NP_441286.1_1 Forward -265 -253 -6.74586 0.278
NP_440670.1_8 Reverse -220 -229 8.75118 0.0606
NP_440670.1_8 Forward -229 -220 6.19458 0.124
NP_440670.1_8 Reverse -255 -264 3.63797 0.239
NP_440670.1_8 Forward -178 -169 3.14632 0.296
NP_440886.1_7 Reverse -383 -393 10.6976 0.0805
NP_440886.1_7 Forward -230 -220 6.76441 0.114
NP_442072.1_9 Forward -179 -161 -16.3038 0.199
NP_442072.1_9 Forward -75 -57 -22.1053 0.22
NP_440513.1_4 Reverse -220 -239 13.1758 0.19
NP_441753.1_10 Reverse -279 -298 0.392778 0.294
NP_441808.1_8 Forward -183 -164 7.66927 0.277
NP_440907.2_8 Forward -263 -253 4.69947 0.25
NP_441021.1_1 Forward -73 -54 -9.047 0.206
NP_441021.1_8 Forward -398 -380 4.6407 0.222
NP_441463.1_3 Forward -239 -220 -0.787193 0.133
NP_441463.1_3 Reverse -278 -297 -5.40875 0.226
NP_441626.1_2 Reverse -221 -228 12.2322 0.0511
NP_441626.1_2 Forward -228 -221 5.93897 0.231
NP_442221.1_4 Reverse -285 -304 5.70265 0.299
NP_441901.1_9 Forward -194 -175 8.25926 0.244
NP_442365.1_7 Reverse -216 -235 -4.52377 0.245
NP_441962.1_4 Reverse -284 -303 -11.4069 0.241
NP_440387.1_1 Forward -390 -374 4.18844 0.0455
NP_440387.1_1 Reverse -220 -236 -3.8747 0.169
NP_440387.1_1 Reverse -381 -397 -4.66135 0.194
NP_441488.1_8 Reverse -215 -229 9.93039 0.146
NP_442647.1_7 Forward -72 -59 7.78743 0.239
NP_441993.1_1 Forward -116 -97 8.86616 0.136
NP_442805.1_5 Reverse -98 -117 -1.96793 0.262
NP_440114.1_10 Reverse -220 -234 12.1926 0.0885
NP_442437.1_4 Reverse -227 -246 7.27595 0.28
NP_442733.1_9 Forward -43 -24 14.1591 0.242
NP_440293.1_9 Reverse -60 -74 13.6635 0.215
NP_440766.1_4 Reverse -216 -230 12.291 0.0556
NP_439988.1_7 Reverse -179 -193 13.077 0.292
NP_441237.1_9 Forward -222 -212 11.4848 0.176
NP_441979.1_5 Forward -198 -179 -17.7985 0.255
NP_440457.1_1 Reverse -216 -228 9.28209 0.0929
NP_440457.1_1 Forward -290 -278 2.89058 0.205
NP_440457.1_1 Forward -268 -256 0.530633 0.25
NP_442297.1_4 Forward -268 -249 12.9187 0.255
NP_441984.1_1 Forward -171 -153 10.5406 0.204
NP_440054.1_3 Reverse -244 -263 18.0924 0.184
NP_440524.1_2 Forward -227 -208 11.0125 0.14
NP_442936.1_7 Forward -101 -82 2.45773 0.299
NP_440554.1_4 Forward -228 -218 4.10993 0.201
NP_442862.1_3 Forward -90 -73 4.26707 0.29
NP_441845.1_6 Reverse -208 -226 16.1454 0.0973
NP_441885.1_2 Reverse -279 -298 13.2741 0.252
NP_441885.1_5 Forward -229 -219 1.25834 0.11
NP_441885.1_5 Reverse -220 -230 -0.0199663 0.186
NP_441885.1_5 Forward -74 -64 -0.0199663 0.186
NP_441885.1_5 Reverse -255 -265 -0.904945 0.241
NP_440478.1_4 Reverse -210 -229 15.0441 0.158
NP_442341.1_9 Forward -231 -217 10.9137 0.133
NP_443000.1_7 Reverse -218 -228 7.35486 0.0859
NP_443000.1_7 Forward -266 -256 0.57002 0.294
NP_440275.1_3 Reverse -253 -263 6.07655 0.126
NP_440275.1_3 Reverse -175 -185 6.07655 0.126
NP_440275.1_3 Reverse -218 -228 5.5849 0.14
NP_440275.1_3 Forward -180 -170 1.84832 0.282
NP_440275.1_3 Forward -299 -289 1.55333 0.289
NP_440091.1_1 Reverse -216 -228 -0.846001 0.293
NP_441122.1_1 Forward -203 -188 3.22482 0.283
NP_441207.1_7 Reverse -45 -59 8.57771 0.282
NP_440149.1_8 Forward -280 -261 3.34271 0.096
NP_442373.1_10 Reverse -288 -307 5.30933 0.288
NP_440172.1_1 Reverse -220 -230 8.82982 0.0586
NP_440172.1_1 Forward -229 -219 2.24165 0.279
NP_441226.1_7 Reverse -221 -228 12.7234 0.0312
NP_441226.1_7 Forward -228 -221 11.5435 0.0757
NP_441111.1_7 Forward -228 -220 8.86921 0.0589
NP_441766.1_2 Forward -229 -220 14.7494 0.00772
NP_440416.1_1 Forward -110 -91 -8.35868 0.243
NP_440416.1_9 Reverse -281 -300 -13.6686 0.169
NP_442552.1_7 Reverse -94 -113 20.0581 0.116
NP_442154.1_1 Reverse -299 -317 -17.1888 0.249
NP_442046.1_8 Forward -183 -164 10.3242 0.293
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GAAAGAAGAAGGTGGCCGCCACACTCCTTTCTTTGCCAACTACCGCCCTCAGTTCTATGTACGGACCACTGACGTAACCGGTACCATCAAAAGCTACACCGCTGACGACGGCAGTGCTGTGGAAATGGTTATGCCTGGGGATCGTATCAAAATGACCGTTGAGCTCATTAACCCGATCGCCATTGAACAGGGGATGCGTTTTGCTATCCGCGAAGGTGGTCGTACCATCGGCGCCGGTGTTGTTTCTAAGATTTTGAAGTAGTCCTTAGAACAACATTCATGATGTAGTTGGTGTTGGGTTGGTTACGGTAAGTTTTTTCTGACTGGGCCAGCCCCACTGACTATTCAACTTTCTGAACCTTGACAATTAAACAGTCCGCTAATTCTGAGTTAAATTTCC

CDS

ATGGCAACATTGCAACAACAAAAAATCCGTATCCGCCTCAAAGCCTTTGACCGTCGCCTCCTCGATACATCCTGCGACAAAATTGTTGATACCGCTAATCGTACTAATGCCGCCGCTGTGGGGCCGATTCCTTTGCCCACCAAACGGAAAATTTATTGTGTGTTGCGCTCTCCCCACGTGGATAAGGATTCCCGGGAACATTTTGAAACCCGCACCCACCGCCGCATTATCGACATTTATCAGCCTTCTTCCAAGACCATTGACGCTCTGATGAAGTTGGATCTCCCTGCCGGGGTTGATATCGAAGTCAAGCTATAG

Protein

MATLQQQKIRIRLKAFDRRLLDTSCDKIVDTANRTNAAAVGPIPLPTKRKIYCVLRSPHVDKDSREHFETRTHRRIIDIYQPSSKTIDALMKLDLPAGVDIEVKL