Your browser is old and dusty. Try Google Chrome!

Details for sll1095

ORF sll1095
Accession NP_441645.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -259 -273 10.3243 0.287
NP_441061.1_2 Reverse -250 -264 2.16287 0.178
NP_441061.1_2 Forward -257 -243 0.687908 0.202
NP_441061.1_2 Reverse -188 -202 0.294584 0.213
NP_440795.1_7 Forward -257 -250 14.6904 0.0123
NP_440795.1_7 Reverse -250 -257 14.6904 0.0123
NP_441418.1_6 Reverse -249 -268 -20.0601 0.103
NP_441418.1_6 Forward -258 -239 -21.83 0.16
NP_441418.1_6 Reverse -208 -227 -28.7132 0.208
NP_442291.1_5 Forward -259 -243 6.45005 0.0694
NP_441453.1_1 Forward -265 -247 4.14829 0.263
NP_441453.1_4 Reverse -249 -257 16.539 0.00633
NP_441453.1_4 Forward -258 -250 16.539 0.00633
NP_441453.1_4 Forward -179 -171 6.80426 0.121
NP_441453.1_4 Forward -202 -194 5.0343 0.209
NP_441453.1_4 Reverse -187 -195 4.24765 0.259
NP_441960.1_4 Reverse -327 -343 11.0709 0.279
NP_442151.1_6 Forward -258 -244 9.73436 0.141
NP_442151.1_6 Reverse -249 -263 9.14437 0.157
NP_440561.1_1 Reverse -244 -263 11.0117 0.26
NP_441818.1_1 Forward -257 -246 13.1362 0.0861
NP_441818.1_1 Reverse -188 -199 9.98959 0.232
NP_441818.1_9 Reverse -118 -137 -4.32711 0.235
NP_440226.1_1 Forward -258 -239 21.5339 0.00635
NP_440150.1_6 Reverse -130 -149 0.884433 0.295
NP_440996.1_2 Forward -88 -79 15.241 0.248
NP_442655.1_10 Reverse -246 -265 -19.6667 0.282
NP_442173.1_1 Forward -257 -249 15.4574 0.00633
NP_442173.1_1 Reverse -250 -258 15.4574 0.00633
NP_442173.1_1 Reverse -171 -179 5.72262 0.203
NP_442173.1_1 Reverse -194 -202 4.93597 0.241
NP_442173.1_1 Reverse -188 -196 4.93597 0.241
NP_442173.1_1 Forward -178 -170 4.54265 0.27
NP_442752.1_4 Forward -258 -251 13.8055 0.0199
NP_442752.1_4 Reverse -249 -256 13.8055 0.0199
NP_442752.1_4 Forward -179 -172 13.8055 0.0199
NP_442752.1_4 Reverse -183 -190 7.90559 0.144
NP_443027.1_4 Forward -260 -250 14.828 0.0437
NP_443027.1_4 Reverse -247 -257 13.1564 0.0521
NP_443027.1_4 Forward -181 -171 8.04317 0.219
NP_441812.1_3 Reverse -248 -262 8.06273 0.254
NP_442975.1_10 Forward -262 -248 14.0603 0.0459
NP_442975.1_10 Reverse -245 -259 2.75226 0.269
NP_441470.1_6 Reverse -235 -254 8.55425 0.161
NP_440784.1_7 Forward -257 -250 15.9687 0.0123
NP_440784.1_7 Reverse -250 -257 15.9687 0.0123
NP_440784.1_7 Forward -178 -171 6.23397 0.241
NP_440784.1_7 Reverse -171 -178 6.13563 0.241
NP_442909.1_7 Forward -257 -243 9.24208 0.156
NP_440061.1_9 Forward -260 -246 16.9119 0.0201
NP_440061.1_9 Forward -144 -130 10.422 0.124
NP_440110.1_4 Forward -213 -194 4.916 0.176
NP_441054.1_4 Reverse -239 -257 -0.570838 0.186
NP_440631.1_6 Reverse -253 -272 18.0924 0.211
NP_440878.1_9 Forward -268 -249 2.65439 0.176
NP_442062.1_8 Reverse -249 -259 19.4496 0.000558
NP_442062.1_8 Forward -258 -248 17.3846 0.00193
NP_442062.1_8 Forward -179 -169 14.533 0.0128
NP_442062.1_8 Reverse -187 -197 9.61647 0.0587
NP_441859.1_3 Forward -180 -161 9.34008 0.129
NP_441859.1_3 Forward -259 -240 5.01354 0.209
NP_440304.1_4 Forward -260 -250 10.8948 0.051
NP_440304.1_4 Reverse -247 -257 9.91146 0.051
NP_440304.1_4 Forward -337 -327 4.3066 0.271
NP_442242.1_4 Forward -257 -250 14.3954 0.0124
NP_442242.1_4 Reverse -250 -257 14.3954 0.0124
NP_442242.1_4 Reverse -171 -178 10.8555 0.127
NP_441208.1_9 Reverse -246 -260 5.40779 0.267
NP_441594.1_6 Reverse -10 -29 1.47442 0.268
NP_442110.1_7 Reverse -249 -263 3.53951 0.21
NP_442110.1_7 Forward -202 -188 2.2612 0.222
NP_442110.1_7 Reverse -187 -201 -0.000409212 0.27
NP_441925.1_4 Forward -334 -315 -8.06442 0.203
NP_441083.1_5 Forward -258 -248 20.3345 0.00053
NP_441083.1_5 Reverse -249 -259 11.3864 0.0159
NP_441083.1_5 Forward -179 -169 0.0783647 0.245
NP_442827.1_8 Forward -266 -247 -0.197979 0.222
NP_441434.1_1 Reverse -69 -83 7.17351 0.288
NP_441434.1_7 Reverse -172 -186 12.8809 0.106
NP_441738.1_2 Forward -256 -249 15.28 0.0102
NP_441738.1_2 Reverse -251 -258 15.28 0.0102
NP_441738.1_2 Reverse -172 -179 15.28 0.0102
NP_441558.1_5 Reverse -168 -187 5.11266 0.26
NP_441558.1_5 Reverse -247 -266 4.12936 0.29
NP_441645.1_5 Forward -44 -25 17.994 0.214
NP_441645.1_6 Forward -19 -5 17.0102 0.193
NP_440209.1_1 Reverse -249 -257 18.1123 0.00295
NP_440209.1_1 Forward -258 -250 18.1123 0.00295
NP_440209.1_1 Forward -179 -171 8.57422 0.0425
NP_440209.1_1 Reverse -170 -178 5.23096 0.145
NP_442889.1_8 Forward -182 -168 10.2254 0.0882
NP_442889.1_8 Forward -261 -247 4.42388 0.267
NP_440447.1_1 Forward -184 -166 9.45892 0.194
NP_442398.1_4 Forward -285 -266 9.83173 0.214
NP_440178.1_7 Forward -259 -240 -2.45882 0.0369
NP_442706.1_10 Reverse -172 -190 16.5388 0.229
NP_442461.1_3 Forward -85 -71 20.1604 0.0825
NP_441792.1_5 Forward -170 -154 11.3666 0.19
NP_441716.1_1 Reverse -249 -263 12.9793 0.0689
NP_441716.1_1 Forward -258 -244 8.55439 0.138
NP_441327.1_4 Reverse -242 -256 16.4209 0.282
NP_442111.1_4 Reverse -248 -262 19.6658 0.00373
NP_442111.1_4 Reverse -169 -183 8.94771 0.0661
NP_441163.1_1 Forward -266 -249 11.6411 0.183
NP_440343.1_3 Forward -334 -316 17.3246 0.0832
NP_440906.1_5 Forward -257 -250 15.8704 0.0124
NP_440906.1_5 Reverse -250 -257 15.8704 0.0124
NP_440906.1_5 Forward -178 -171 6.23397 0.234
NP_440906.1_5 Reverse -171 -178 6.13563 0.241
NP_440747.1_10 Forward -261 -249 7.70879 0.00236
NP_440747.1_10 Reverse -246 -258 7.4138 0.00422
NP_440747.1_10 Reverse -342 -354 -12.1541 0.227
NP_440747.1_10 Forward -182 -170 -12.2524 0.254
NP_441130.1_10 Forward -260 -246 11.2093 0.107
NP_441486.1_1 Forward -261 -247 4.42448 0.0446
NP_441486.1_1 Forward -199 -185 4.22782 0.0475
NP_441486.1_1 Reverse -246 -260 2.65453 0.079
NP_441486.1_1 Reverse -184 -198 -0.393733 0.154
NP_442634.1_4 Reverse -247 -261 6.19444 0.0508
NP_440842.1_6 Forward -359 -340 13.6666 0.197
NP_441014.1_8 Forward -271 -252 -5.70374 0.274
NP_441014.1_10 Reverse -186 -205 4.32522 0.197
NP_442848.1_1 Reverse -243 -257 7.47274 0.0791
NP_442848.1_1 Forward -202 -188 3.73617 0.124
NP_442848.1_1 Forward -264 -250 -0.983719 0.263
NP_441012.1_4 Forward -200 -187 11.229 0.252
NP_441012.1_4 Forward -262 -249 7.19745 0.272
NP_443018.1_3 Forward -257 -250 14.8871 0.0123
NP_443018.1_3 Reverse -250 -257 14.8871 0.0123
NP_443018.1_3 Forward -178 -171 12.6255 0.0471
NP_443018.1_3 Reverse -188 -195 10.7572 0.0907
NP_443018.1_3 Reverse -171 -178 5.25066 0.214
NP_443018.1_3 Forward -195 -188 4.56234 0.241
NP_441316.1_7 Forward -260 -245 -3.26502 0.273
NP_441634.1_8 Reverse -247 -261 -3.04867 0.295
NP_440376.1_1 Forward -258 -249 19.4693 0.000692
NP_440376.1_1 Reverse -249 -258 19.4693 0.000692
NP_440376.1_1 Reverse -345 -354 2.06468 0.236
NP_440376.1_1 Forward -179 -170 0.0980582 0.285
NP_440376.1_1 Reverse -170 -179 -0.196935 0.285
NP_441002.1_5 Reverse -275 -294 16.1257 0.135
NP_441588.1_4 Forward -256 -246 6.37155 0.2
NP_442687.1_7 Forward -259 -249 15.8113 0.0125
NP_442687.1_7 Reverse -248 -258 8.92815 0.0994
NP_442191.1_4 Reverse -250 -264 18.168 0.0103
NP_441846.1_10 Reverse -2 -21 -22.42 0.259
NP_440642.1_10 Forward -277 -263 4.12889 0.26
NP_441013.1_2 Reverse -334 -352 0.21581 0.254
NP_441422.1_7 Forward -260 -243 -1.82945 0.194
NP_441422.1_7 Forward -204 -187 -7.33598 0.258
NP_440533.1_9 Reverse -249 -268 1.96607 0.294
NP_441950.1_5 Reverse -321 -340 17.1627 0.222
NP_440360.1_10 Forward -177 -163 2.45787 0.265
NP_442658.1_1 Forward -260 -250 15.9091 0.00966
NP_442658.1_1 Reverse -247 -257 9.616 0.147
NP_442658.1_1 Forward -181 -171 7.35439 0.214
NP_441855.2_4 Forward -266 -247 12.2225 0.2
NP_440662.1_2 Reverse -318 -337 -4.91709 0.276
NP_442782.1_2 Reverse -249 -263 0.982901 0.282
NP_442205.1_9 Reverse -177 -193 -3.97304 0.3
NP_441414.1_9 Forward -258 -239 -0.787193 0.0943
NP_441414.1_9 Reverse -170 -189 -10.227 0.279
NP_439968.1_2 Forward -334 -315 12.0933 0.297
NP_441487.1_9 Forward -259 -240 4.22769 0.15
NP_442937.1_5 Reverse -244 -263 20.1573 0.0152
NP_441958.1_5 Forward -259 -249 12.2714 0.00183
NP_441958.1_5 Reverse -248 -258 12.2714 0.00183
NP_441958.1_5 Reverse -169 -179 0.865012 0.12
NP_441958.1_5 Forward -180 -170 -6.31315 0.28
NP_440984.1_7 Reverse -244 -258 8.84938 0.134
NP_441162.1_5 Reverse -313 -331 20.767 0.101
NP_439990.1_5 Forward -263 -250 11.3273 0.128
NP_442911.1_2 Reverse -239 -258 6.88262 0.0277
NP_442911.1_2 Forward -268 -249 6.78429 0.0277
NP_442911.1_2 Reverse -160 -179 -3.54046 0.114
NP_441580.1_6 Forward -190 -171 -6.39206 0.235
NP_440153.1_5 Forward -257 -243 7.86607 0.15
NP_440153.1_5 Reverse -171 -185 2.85119 0.219
NP_440153.1_5 Reverse -250 -264 0.88457 0.288
NP_443055.1_6 Reverse -241 -259 8.08151 0.15
NP_440993.1_2 Reverse -244 -260 1.92682 0.272
NP_440993.1_4 Forward -354 -337 2.49712 0.3
NP_440827.1_3 Reverse -182 -201 12.0942 0.261
NP_441348.1_3 Reverse -244 -263 7.17762 0.265
NP_441099.1_5 Reverse -239 -258 -0.197208 0.0896
NP_441099.1_5 Reverse -335 -354 -3.3438 0.133
NP_441099.1_5 Forward -334 -315 -8.94866 0.209
NP_442002.1_9 Forward -336 -329 11.3472 0.185
NP_442002.1_9 Forward -259 -252 10.7572 0.185
NP_442002.1_9 Forward -180 -173 10.7572 0.185
NP_441294.1_7 Forward -358 -344 12.6102 0.0916
NP_441646.1_1 Reverse -320 -339 0.196116 0.254
NP_441646.1_1 Forward -265 -246 -1.96717 0.298
NP_442438.1_10 Forward -263 -249 10.816 0.0484
NP_441000.1_6 Reverse -169 -183 -2.06536 0.216
NP_441000.1_6 Forward -259 -245 -5.31028 0.273
NP_442771.1_1 Reverse -247 -265 2.77242 0.0672
NP_440484.1_3 Forward -204 -190 11.2093 0.242
NP_440484.1_3 Reverse -247 -261 9.63603 0.258
NP_440147.1_4 Forward -260 -247 12.8023 0.0326
NP_440147.1_4 Reverse -247 -260 0.805932 0.244
NP_441550.1_8 Reverse -247 -257 16.7941 0.00906
NP_441550.1_8 Forward -260 -250 6.0761 0.214
NP_441916.1_7 Reverse -249 -259 18.4663 0.00144
NP_441916.1_7 Forward -258 -248 10.3048 0.0261
NP_441916.1_7 Reverse -170 -180 6.96153 0.0784
NP_441916.1_7 Forward -196 -186 3.02829 0.232
NP_441041.1_4 Reverse -249 -268 -9.44032 0.216
NP_441041.1_7 Forward -338 -326 13.9285 0.0432
NP_441041.1_7 Forward -261 -249 7.61196 0.162
NP_441725.1_4 Forward -273 -259 7.3738 0.235
NP_441725.1_5 Reverse -250 -260 11.2881 0.0247
NP_441725.1_5 Forward -178 -168 10.0098 0.0381
NP_441725.1_5 Forward -257 -247 9.02648 0.0553
NP_439966.1_7 Forward -260 -250 18.4657 0.00473
NP_439966.1_7 Reverse -247 -257 14.8275 0.0177
NP_439966.1_7 Forward -181 -171 8.23937 0.14
NP_439966.1_7 Reverse -168 -178 4.30615 0.279
NP_439966.1_9 Reverse -324 -333 4.52295 0.253
NP_439966.1_9 Forward -260 -251 0.983037 0.253
NP_439966.1_9 Forward -181 -172 0.884706 0.253
NP_439966.1_9 Reverse -247 -256 0.884706 0.253
NP_442941.1_3 Reverse -250 -260 11.4848 0.0116
NP_442941.1_3 Forward -257 -247 10.9931 0.0116
NP_442941.1_3 Reverse -171 -181 0.963343 0.16
NP_440289.1_2 Forward -261 -248 11.819 0.0171
NP_440289.1_2 Reverse -246 -259 -4.60227 0.29
NP_440289.1_2 Forward -182 -169 -4.9956 0.294
NP_440260.1_8 Reverse -324 -342 -5.88071 0.279
NP_442281.1_1 Forward -263 -249 11.7003 0.0438
NP_442281.1_1 Reverse -244 -258 7.27547 0.104
NP_442281.1_1 Forward -201 -187 6.48882 0.124
NP_442281.1_1 Forward -184 -170 4.52221 0.192
NP_440177.1_9 Reverse -241 -260 16.9124 0.165
NP_440437.1_1 Forward -264 -245 16.1257 0.0204
NP_440437.1_1 Forward -229 -210 -0.0988766 0.174
NP_439983.1_1 Forward -19 -1 9.94979 0.289
NP_441457.1_7 Forward -337 -318 3.6377 0.234
NP_442982.1_5 Forward -268 -249 -0.885524 0.262
NP_443030.1_4 Forward -265 -246 -6.88371 0.291
NP_441196.1_4 Reverse -200 -219 13.8641 0.112
NP_441644.1_6 Forward -258 -248 17.3841 0.00127
NP_441644.1_6 Reverse -249 -259 10.1076 0.0628
NP_441644.1_6 Forward -179 -169 3.61784 0.272
NP_443049.1_6 Forward -180 -170 11.0554 0.282
NP_441071.1_2 Reverse -75 -94 12.5568 0.291
NP_442215.1_2 Reverse -331 -347 8.12167 0.0666
NP_442215.1_2 Reverse -247 -263 3.69678 0.093
NP_442215.1_2 Forward -356 -340 -5.64466 0.254
NP_442029.1_6 Reverse -244 -263 14.4541 0.115
NP_440253.1_2 Forward -258 -240 21.062 0.00457
NP_440253.1_2 Reverse -249 -267 2.47742 0.137
NP_440929.1_8 Forward -258 -249 19.2726 0.000701
NP_440929.1_8 Reverse -249 -258 19.2726 0.000701
NP_440929.1_8 Reverse -170 -179 7.76787 0.0533
NP_440929.1_8 Forward -179 -170 7.66954 0.0624
NP_442933.1_10 Forward -258 -249 17.601 0.00325
NP_442933.1_10 Reverse -249 -258 17.601 0.00325
NP_442933.1_10 Reverse -170 -179 6.48957 0.119
NP_442933.1_10 Forward -196 -187 4.52295 0.24
NP_440382.1_2 Forward -315 -296 1.76863 0.284
NP_441751.2_8 Reverse -250 -264 -1.8687 0.132
NP_441751.2_8 Forward -257 -243 -3.04867 0.134
NP_442554.1_8 Forward -257 -247 18.0729 0.00543
NP_442554.1_8 Reverse -250 -260 13.8447 0.0145
NP_442554.1_8 Reverse -171 -181 4.3066 0.189
NP_442554.1_8 Forward -178 -168 2.04498 0.285
NP_442554.1_8 Reverse -60 -70 1.94665 0.288
NP_442863.1_3 Reverse -119 -137 14.6705 0.172
NP_441762.1_7 Forward -259 -247 11.8387 0.0142
NP_441762.1_7 Reverse -248 -260 2.89058 0.0676
NP_441762.1_7 Reverse -169 -181 -5.76255 0.238
NP_441762.1_7 Forward -336 -324 -6.35254 0.284
NP_442313.1_8 Reverse -40 -59 8.16093 0.292
NP_442142.1_4 Forward -261 -248 17.1282 0.0264
NP_442142.1_4 Reverse -246 -259 6.80355 0.154
NP_442292.1_1 Forward -257 -248 18.486 0.00229
NP_442292.1_1 Reverse -250 -259 9.63616 0.0183
NP_442292.1_1 Reverse -171 -180 -0.196935 0.239
NP_442292.1_1 Forward -178 -169 -0.786921 0.287
NP_440919.1_1 Reverse -268 -287 -5.01543 0.244
NP_440919.1_1 Reverse -343 -362 -7.4737 0.278
NP_442476.1_3 Reverse -327 -346 9.0459 0.277
NP_442476.1_6 Forward -257 -243 8.16106 0.105
NP_442476.1_6 Reverse -171 -185 0.982901 0.233
NP_441711.1_4 Reverse -240 -259 4.12936 0.222
NP_441523.1_6 Forward -272 -253 9.93088 0.169
NP_443009.1_2 Forward -140 -121 0.196116 0.216
NP_443009.1_5 Reverse -248 -259 18.3477 0.00265
NP_443009.1_5 Forward -336 -325 5.56471 0.197
NP_441715.1_4 Reverse -250 -260 16.303 0.0117
NP_441715.1_4 Reverse -171 -181 9.02648 0.105
NP_441715.1_4 Forward -257 -247 7.84651 0.107
NP_440730.1_4 Forward -217 -198 1.0811 0.242
NP_441198.1_5 Forward -256 -243 16.2433 0.206
NP_441198.1_8 Forward -337 -327 12.2947 0.144
NP_441468.1_1 Forward -257 -250 15.8704 0.0124
NP_441468.1_1 Reverse -250 -257 15.8704 0.0124
NP_441468.1_1 Forward -178 -171 6.13563 0.209
NP_441468.1_1 Reverse -171 -178 6.0373 0.223
NP_441468.1_1 Forward -195 -188 4.07068 0.263
NP_441020.2_6 Reverse -247 -264 10.9536 0.131
NP_441020.2_6 Forward -181 -164 10.3636 0.146
NP_441020.2_6 Forward -260 -243 8.00365 0.212
NP_441015.1_10 Reverse -244 -263 -4.03212 0.197
NP_441015.1_10 Reverse -134 -153 -6.88371 0.258
NP_441673.1_1 Forward -258 -249 20.8459 0.000698
NP_441673.1_1 Reverse -249 -258 20.8459 0.000698
NP_441673.1_1 Forward -179 -170 1.37636 0.114
NP_441673.1_1 Reverse -170 -179 1.1797 0.163
NP_441826.1_2 Forward -264 -250 11.5043 0.0358
NP_441826.1_2 Reverse -243 -257 2.5562 0.125
NP_441826.1_2 Reverse -181 -195 -3.147 0.283
NP_441330.1_1 Reverse -244 -263 -13.2752 0.183
NP_441637.1_9 Reverse -70 -88 2.28076 0.279
NP_441764.1_8 Reverse -295 -305 11.0236 0.287
NP_442868.1_6 Reverse -247 -257 17.4829 0.012
NP_442868.1_6 Forward -355 -345 3.12662 0.202
NP_442868.1_6 Forward -260 -250 0.963343 0.205
NP_442868.1_6 Forward -337 -327 0.766681 0.209
NP_442868.1_6 Forward -181 -171 0.57002 0.217
NP_442719.1_2 Forward -298 -280 -5.09477 0.218
NP_442719.1_2 Forward -289 -271 -9.12632 0.259
NP_442719.1_2 Forward -299 -281 -11.7812 0.296
NP_441056.1_1 Forward -258 -239 -6.88371 0.271
NP_441612.1_2 Reverse -16 -26 14.3581 0.21
NP_441612.1_2 Forward -258 -248 8.54929 0.21
NP_442427.1_8 Reverse -240 -259 7.86593 0.203
NP_442808.1_1 Forward -259 -249 18.4657 0.00201
NP_442808.1_1 Reverse -248 -258 8.63269 0.0481
NP_442808.1_1 Forward -355 -345 2.43787 0.266
NP_440145.1_3 Reverse -239 -258 2.16274 0.12
NP_442718.1_2 Reverse -208 -227 -7.27704 0.3
NP_442542.1_2 Reverse -247 -260 4.54251 0.3
NP_442542.1_9 Forward -186 -172 6.0955 0.252
NP_442050.1_5 Reverse -247 -257 15.6142 0.01
NP_442050.1_5 Reverse -168 -178 11.1893 0.105
NP_442050.1_5 Forward -260 -250 9.12434 0.193
NP_442342.1_9 Reverse -247 -263 4.28677 0.25
NP_440558.1_2 Reverse -184 -203 -5.11376 0.253
NP_440558.1_2 Reverse -323 -342 -6.88371 0.283
NP_441878.1_6 Forward -259 -249 10.4031 0.0176
NP_441878.1_6 Reverse -248 -258 10.4031 0.0176
NP_441878.1_6 Reverse -169 -179 0.57002 0.14
NP_441878.1_6 Reverse -207 -217 -7.39479 0.222
NP_441036.1_8 Forward -259 -249 17.7779 0.000554
NP_441036.1_8 Reverse -248 -258 8.33817 0.174
NP_441036.1_8 Forward -180 -170 7.05986 0.21
NP_441557.1_5 Forward -258 -249 19.9609 0.000699
NP_441557.1_5 Reverse -249 -258 19.9609 0.000699
NP_441557.1_5 Reverse -170 -179 7.57121 0.049
NP_441557.1_5 Forward -179 -170 1.08137 0.0794
NP_442066.2_9 Reverse -245 -258 10.344 0.154
NP_441433.1_8 Reverse -194 -213 -4.42544 0.294
NP_442419.1_2 Reverse -244 -263 -2.85214 0.247
NP_441739.1_2 Forward -282 -266 3.89277 0.248
NP_441308.1_8 Forward -260 -250 10.1081 0.22
NP_440101.1_5 Forward -265 -246 8.84924 0.183
NP_441458.1_10 Forward -267 -248 8.45592 0.186
NP_442830.1_5 Forward -218 -204 7.76712 0.215
NP_442183.1_1 Forward -258 -244 16.5192 0.0143
NP_442183.1_1 Forward -179 -165 16.5192 0.0143
NP_442183.1_1 Reverse -249 -263 9.93102 0.0903
NP_442347.1_2 Forward -257 -248 12.4878 0.056
NP_442347.1_2 Reverse -250 -259 11.1111 0.056
NP_442347.1_2 Reverse -171 -180 10.9145 0.0571
NP_442347.1_2 Forward -267 -258 6.68623 0.156
NP_442347.1_2 Forward -353 -344 3.93297 0.284
NP_442645.1_2 Reverse -241 -260 -1.57384 0.0487
NP_441037.1_4 Reverse -247 -257 9.55921 0.21
NP_441037.1_4 Forward -260 -250 7.02532 0.237
NP_441633.1_3 Forward -260 -247 6.01747 0.0481
NP_441633.1_3 Reverse -247 -260 1.29759 0.109
NP_441633.1_3 Forward -181 -168 -4.40561 0.195
NP_440136.1_2 Forward -257 -250 15.9687 0.0123
NP_440136.1_2 Reverse -250 -257 15.9687 0.0123
NP_440136.1_2 Forward -178 -171 6.23397 0.171
NP_440136.1_2 Reverse -171 -178 6.13563 0.193
NP_442998.1_5 Forward -293 -283 10.6981 0.206
NP_442998.1_5 Forward -337 -327 7.94484 0.278
NP_442998.1_5 Reverse -270 -280 7.05986 0.3
NP_442998.1_10 Forward -256 -249 15.5754 0.0102
NP_442998.1_10 Reverse -251 -258 15.5754 0.0102
NP_442998.1_10 Reverse -172 -179 15.5754 0.0102
NP_440899.1_8 Forward -246 -227 -9.63698 0.267
NP_440299.1_1 Forward -262 -249 20.1765 0.00128
NP_440299.1_1 Reverse -245 -258 12.605 0.0362
NP_440299.1_1 Forward -183 -170 6.11523 0.152
NP_441799.1_1 Reverse -245 -259 12.8803 0.0385
NP_441799.1_1 Reverse -183 -197 8.25877 0.12
NP_441799.1_1 Forward -262 -248 4.03056 0.269
NP_441799.1_1 Forward -206 -192 3.53891 0.295
NP_441007.1_10 Reverse -244 -257 8.67241 0.112
NP_441007.1_10 Reverse -165 -178 0.215946 0.241
NP_442201.1_10 Forward -190 -171 -13.0786 0.27
NP_442333.2_1 Forward -219 -200 -0.787193 0.113
NP_440256.1_1 Reverse -190 -209 2.85105 0.0589
NP_440256.1_1 Reverse -167 -186 -7.4737 0.238
NP_441957.1_1 Forward -343 -324 6.58763 0.239
NP_442007.1_8 Forward -334 -316 9.6548 0.269
NP_441559.1_8 Forward -263 -249 11.996 0.0574
NP_441559.1_8 Reverse -322 -336 3.63784 0.143
NP_441559.1_8 Reverse -340 -354 -5.31028 0.259
NP_441559.1_8 Reverse -254 -268 -5.60527 0.267
NP_441559.1_8 Forward -46 -32 -6.88358 0.281
NP_441559.1_8 Reverse -202 -216 -7.76856 0.299
NP_441270.1_5 Reverse -123 -142 10.8472 0.296
NP_440915.1_6 Forward -262 -248 5.70279 0.0879
NP_440915.1_6 Reverse -245 -259 3.53951 0.101
NP_440915.1_6 Forward -183 -169 1.86788 0.131
NP_441179.1_1 Forward -261 -242 4.32602 0.247
NP_442069.1_7 Forward -275 -256 12.6833 0.201
NP_441464.1_1 Forward -272 -253 7.96426 0.261
NP_441464.1_8 Forward -258 -244 6.98109 0.222
NP_441113.1_3 Forward -344 -330 17.9935 0.178
NP_440306.1_8 Reverse -72 -91 -2.45958 0.259
NP_440695.1_5 Forward -179 -160 19.469 0.0404
NP_441199.1_6 Forward -262 -243 5.211 0.154
NP_442993.1_1 Reverse -249 -265 2.02515 0.0502
NP_440677.1_6 Forward -267 -248 8.94757 0.27
NP_442386.1_9 Forward -259 -250 15.7322 0.0144
NP_442386.1_9 Reverse -248 -257 13.8639 0.0289
NP_442386.1_9 Forward -197 -188 9.04574 0.175
NP_442386.1_9 Forward -180 -171 5.9975 0.23
NP_440570.1_5 Reverse -239 -258 -3.04881 0.286
NP_441340.1_5 Forward -257 -250 15.6737 0.0124
NP_441340.1_5 Reverse -250 -257 15.6737 0.0124
NP_441340.1_5 Forward -178 -171 6.23397 0.132
NP_441340.1_5 Reverse -171 -178 5.84064 0.208
NP_441340.1_5 Reverse -188 -195 3.97235 0.274
NP_439976.1_4 Reverse -29 -48 6.39016 0.278
NP_442240.1_2 Reverse -171 -190 -14.0619 0.174
NP_442240.1_2 Reverse -250 -269 -14.4552 0.18
NP_442240.1_2 Reverse -335 -354 -20.65 0.295
NP_440586.1_8 Forward -178 -171 14.69 0.026
NP_440586.1_8 Forward -257 -250 13.2151 0.026
NP_440586.1_8 Reverse -250 -257 13.2151 0.026
NP_440586.1_8 Reverse -353 -360 8.88855 0.205
NP_442251.1_6 Forward -257 -250 15.2804 0.0124
NP_442251.1_6 Reverse -250 -257 15.2804 0.0124
NP_442251.1_6 Reverse -171 -178 12.0355 0.0627
NP_441262.1_3 Reverse -249 -256 14.7888 0.0223
NP_441262.1_3 Forward -258 -251 14.7888 0.0223
NP_441262.1_3 Forward -179 -172 14.7888 0.0223
NP_440027.1_3 Forward -268 -250 3.16499 0.278
NP_443051.1_1 Reverse -248 -257 10.4228 0.00754
NP_443051.1_1 Forward -259 -250 10.4228 0.00754
NP_443051.1_1 Reverse -169 -178 6.19458 0.0849
NP_443051.1_1 Forward -180 -171 0.884706 0.125
NP_439984.1_3 Reverse -242 -256 12.782 0.255
NP_439937.1_9 Forward -218 -201 -4.38673 0.157
NP_439937.1_9 Forward -337 -320 -13.7281 0.287
NP_440439.1_1 Forward -261 -248 8.37742 0.0537
NP_440439.1_1 Reverse -246 -259 1.29759 0.157
NP_439943.1_7 Reverse -188 -207 6.4893 0.221
NP_440372.1_2 Forward -257 -250 16.3621 0.0124
NP_440372.1_2 Reverse -250 -257 16.3621 0.0124
NP_440372.1_2 Forward -178 -171 6.82395 0.0854
NP_440372.1_2 Reverse -171 -178 6.52896 0.188
NP_441789.1_7 Forward -137 -118 2.9486 0.214
NP_440819.1_5 Forward -90 -82 7.98423 0.228
NP_440316.1_10 Reverse -207 -217 6.96153 0.251
NP_439977.1_5 Forward -264 -245 2.85105 0.166
NP_440139.1_1 Reverse -181 -200 5.89851 0.151
NP_440267.1_2 Forward -273 -259 4.52221 0.3
NP_442384.1_10 Reverse -249 -262 15.7522 0.00946
NP_442384.1_10 Forward -354 -341 4.64084 0.151
NP_442384.1_10 Forward -258 -245 2.67422 0.216
NP_442384.1_10 Reverse -170 -183 1.00259 0.271
NP_442790.1_4 Reverse -33 -52 -13.2752 0.26
NP_442262.1_10 Forward -257 -250 14.1988 0.0123
NP_442262.1_10 Reverse -250 -257 14.1988 0.0123
NP_442262.1_10 Forward -178 -171 12.9205 0.0422
NP_442262.1_10 Reverse -188 -195 9.87221 0.164
NP_441689.1_5 Forward -260 -250 8.53436 0.132
NP_441689.1_5 Reverse -247 -257 5.87944 0.197
NP_441689.1_5 Forward -198 -188 4.99446 0.285
NP_440163.1_10 Forward -261 -251 16.303 0.0762
NP_440344.1_10 Forward -265 -248 3.38209 0.0271
NP_440344.1_10 Reverse -163 -180 -11.8592 0.231
NP_440075.1_2 Reverse -204 -223 6.68596 0.249
NP_440531.1_6 Reverse -189 -208 -0.787193 0.221
NP_440531.1_6 Forward -102 -83 -4.81876 0.287
NP_440189.1_10 Forward -275 -256 13.1758 0.132
NP_440487.1_1 Reverse -246 -265 -2.36049 0.214
NP_441335.1_8 Reverse -279 -298 6.29264 0.287
NP_441965.1_10 Reverse -246 -262 10.5799 0.107
NP_441965.1_10 Reverse -130 -146 3.99177 0.252
NP_440297.1_9 Forward -178 -168 9.61647 0.0917
NP_440297.1_9 Reverse -250 -260 9.32148 0.0917
NP_440297.1_9 Forward -257 -247 -0.216628 0.282
NP_441896.1_5 Reverse -155 -162 12.2322 0.273
NP_440999.1_9 Forward -262 -248 13.1759 0.0329
NP_440999.1_9 Forward -133 -119 -1.37704 0.236
NP_440888.1_2 Forward -258 -244 16.9119 0.00511
NP_440888.1_2 Reverse -249 -263 15.9285 0.00837
NP_440888.1_2 Reverse -187 -201 9.93039 0.11
NP_440888.1_2 Forward -189 -175 6.68548 0.223
NP_440052.1_5 Forward -190 -171 -3.3438 0.234
NP_442948.1_2 Reverse -248 -267 3.44104 0.283
NP_442033.1_10 Reverse -247 -266 -4.32711 0.179
NP_442033.1_10 Forward -219 -200 -12.7836 0.277
NP_441543.1_2 Reverse -250 -259 18.486 0.00236
NP_441543.1_2 Forward -257 -248 16.9127 0.00359
NP_441543.1_2 Reverse -171 -180 8.65285 0.0968
NP_442845.1_2 Reverse -243 -257 3.44117 0.29
NP_441304.1_10 Forward -338 -329 16.6177 0.164
NP_441918.1_7 Forward -259 -240 -2.55715 0.297
NP_441469.1_8 Forward -259 -250 16.126 0.00797
NP_441469.1_8 Reverse -207 -216 7.76787 0.227
NP_441469.1_8 Reverse -248 -257 6.48957 0.227
NP_441469.1_8 Forward -180 -171 6.39124 0.227
NP_443064.1_6 Forward -258 -248 12.5669 0.0796
NP_443064.1_6 Forward -192 -182 9.46426 0.219
NP_442337.1_8 Reverse -149 -168 -0.885524 0.278
NP_442578.1_7 Forward -178 -171 14.6904 0.026
NP_442578.1_7 Forward -257 -250 14.5921 0.026
NP_442578.1_7 Reverse -250 -257 14.5921 0.026
NP_441462.1_2 Forward -258 -248 11.5831 0.00406
NP_441462.1_2 Reverse -249 -259 11.5831 0.00406
NP_441462.1_2 Forward -179 -169 1.94665 0.0807
NP_441621.1_7 Reverse -247 -261 6.3911 0.068
NP_441621.1_7 Forward -260 -246 -3.147 0.188
NP_443062.1_1 Reverse -170 -188 3.76806 0.285
NP_443062.1_1 Forward -258 -240 3.37804 0.3
NP_443062.1_6 Forward -266 -247 0.687771 0.291
NP_440911.1_1 Forward -84 -65 14.8466 0.212
NP_442204.1_1 Forward -262 -251 9.69511 0.0736
NP_442204.1_1 Forward -272 -261 7.33516 0.135
NP_442204.1_1 Forward -183 -172 2.12362 0.266
NP_442204.1_5 Forward -268 -249 8.75091 0.111
NP_442204.1_6 Reverse -124 -143 7.96426 0.23
NP_441560.1_10 Forward -266 -247 6.88262 0.287
NP_440516.1_8 Forward -258 -249 16.9127 0.00442
NP_440516.1_8 Reverse -249 -258 16.9127 0.00442
NP_440516.1_8 Forward -179 -170 1.08137 0.129
NP_442428.1_5 Forward -257 -250 15.8704 0.0124
NP_442428.1_5 Reverse -250 -257 15.8704 0.0124
NP_442428.1_5 Forward -178 -171 6.13563 0.209
NP_442428.1_5 Reverse -171 -178 6.0373 0.212
NP_442428.1_5 Forward -195 -188 4.46401 0.267
NP_441353.1_7 Forward -339 -321 17.9146 0.18
NP_442859.1_2 Reverse -188 -207 5.30933 0.21
NP_440673.1_3 Forward -256 -249 12.4288 0.0426
NP_440673.1_3 Reverse -251 -258 12.4288 0.0426
NP_440673.1_3 Reverse -172 -179 12.4288 0.0426
NP_440673.1_3 Reverse -189 -196 10.5605 0.123
NP_441052.1_2 Forward -258 -248 19.9412 0.00106
NP_441052.1_2 Reverse -249 -259 10.5014 0.0285
NP_441052.1_2 Forward -354 -344 3.32329 0.181
NP_442219.1_9 Forward -257 -248 17.7976 0.00718
NP_442219.1_9 Reverse -250 -259 8.35786 0.0681
NP_440436.1_4 Reverse -250 -259 18.1905 0.00233
NP_440436.1_4 Forward -257 -248 17.2072 0.00233
NP_440436.1_4 Reverse -188 -197 9.73406 0.0871
NP_440436.1_4 Reverse -171 -180 8.55409 0.0997
NP_441884.1_9 Forward -261 -242 -23.9933 0.284
NP_440121.1_5 Forward -293 -280 19.5581 0.292
NP_440314.1_9 Forward -257 -238 0.392778 0.0952
NP_441086.1_3 Reverse -365 -384 9.11592 0.22
NP_441719.1_4 Forward -257 -250 16.3621 0.0124
NP_441719.1_4 Reverse -250 -257 16.3621 0.0124
NP_441719.1_4 Forward -178 -171 13.5105 0.026
NP_441719.1_4 Reverse -171 -178 6.52896 0.188
NP_441733.1_10 Reverse -246 -259 16.9322 0.0382
NP_441004.1_1 Reverse -243 -262 -10.6203 0.224
NP_441004.1_1 Reverse -124 -143 -13.8652 0.262
NP_442366.1_3 Reverse -248 -266 6.70565 0.0773
NP_442366.1_3 Reverse -186 -204 -4.99573 0.28
NP_439949.1_7 Reverse -64 -78 13.4709 0.254
NP_439949.1_7 Reverse -278 -292 12.8809 0.258
NP_442873.1_9 Reverse -239 -258 5.99684 0.259
NP_442206.1_10 Reverse -249 -264 2.14318 0.205
NP_440328.1_4 Reverse -253 -272 2.16274 0.209
NP_443054.1_2 Forward -260 -246 3.14618 0.24
NP_440864.1_9 Reverse -189 -208 -0.885524 0.156
NP_441851.1_10 Forward -259 -249 16.008 0.00552
NP_441851.1_10 Reverse -248 -258 15.8113 0.00552
NP_441851.1_10 Forward -180 -170 11.8781 0.0602
NP_441851.1_10 Reverse -169 -179 6.07655 0.187
NP_441851.1_10 Reverse -192 -202 3.91327 0.296
NP_442011.1_1 Forward -197 -178 -0.590531 0.268
NP_441668.1_4 Reverse -239 -258 0.982764 0.227
NP_441668.1_5 Forward -293 -274 10.1275 0.225
NP_442515.1_1 Forward -259 -245 12.586 0.0337
NP_442515.1_1 Forward -180 -166 2.85119 0.129
NP_442515.1_1 Reverse -248 -262 -4.81863 0.298
NP_441396.1_5 Forward -398 -389 8.25953 0.224
NP_441683.1_7 Reverse -1 -20 -2.45882 0.241
NP_441982.1_6 Forward -92 -83 11.6259 0.288
NP_440940.1_7 Forward -268 -250 13.1947 0.0831
NP_441349.1_10 Forward -268 -249 5.89931 0.0399
NP_442024.1_4 Reverse -318 -337 9.83255 0.254
NP_441409.1_6 Forward -264 -245 1.76941 0.0586
NP_440389.1_5 Forward -265 -246 13.4757 0.261
NP_440432.1_9 Forward -257 -242 15.6145 0.0125
NP_440432.1_9 Reverse -171 -186 -5.03498 0.233
NP_442843.1_1 Forward -257 -238 -11.5053 0.291
NP_440396.1_10 Forward -257 -241 15.1024 0.151
NP_441124.1_5 Reverse -278 -288 11.0983 0.267
NP_442450.1_5 Forward -260 -250 9.32148 0.115
NP_442450.1_5 Reverse -168 -178 8.4365 0.13
NP_440588.1_2 Forward -267 -248 7.37428 0.0502
NP_441003.1_7 Reverse -30 -49 14.0608 0.254
NP_440483.1_1 Forward -349 -330 -1.86883 0.208
NP_440483.1_1 Forward -348 -329 -2.26216 0.208
NP_442243.1_1 Forward -349 -331 -2.53818 0.293
NP_441570.1_1 Reverse -249 -267 -15.9105 0.236
NP_441570.1_1 Forward -258 -240 -16.7954 0.254
NP_440078.1_10 Reverse -249 -268 2.85105 0.269
NP_441078.1_4 Forward -258 -249 19.6659 0.0007
NP_441078.1_4 Reverse -249 -258 19.6659 0.0007
NP_441078.1_4 Forward -179 -170 0.196389 0.205
NP_441078.1_4 Reverse -170 -179 -0.000272808 0.205
NP_442729.1_8 Reverse -245 -258 10.4424 0.125
NP_442729.1_8 Forward -262 -249 8.08242 0.125
NP_442729.1_8 Reverse -166 -179 6.80412 0.178
NP_440707.1_9 Reverse -256 -275 2.45773 0.272
NP_442443.1_1 Reverse -319 -338 7.7676 0.131
NP_440526.1_3 Forward -257 -246 10.7762 0.0646
NP_441432.1_8 Reverse -248 -257 16.8143 0.00595
NP_441432.1_8 Forward -259 -250 8.25953 0.0755
NP_441432.1_8 Forward -197 -188 5.3096 0.17
NP_441432.1_9 Reverse -73 -86 11.9919 0.221
NP_442320.1_8 Reverse -243 -257 12.9793 0.0155
NP_442320.1_8 Forward -264 -250 -2.26202 0.0871
NP_442320.1_8 Forward -185 -171 -4.13031 0.148
NP_442320.1_8 Forward -202 -188 -5.50694 0.228
NP_442344.1_7 Forward -178 -159 1.17943 0.0838
NP_441732.1_2 Forward -262 -246 11.7599 0.00594
NP_440629.1_4 Forward -228 -209 10.7175 0.238
NP_440760.1_1 Forward -258 -239 -4.32711 0.0417
NP_440760.1_1 Reverse -170 -189 -8.16202 0.0754
NP_440760.1_7 Reverse -273 -292 2.85027 0.281
NP_442797.1_1 Forward -227 -208 -3.04881 0.266
NP_440131.1_10 Forward -206 -187 21.2389 0.0258
NP_440713.1_4 Reverse -335 -354 4.71934 0.223
NP_442489.1_7 Forward -258 -249 20.1576 0.000695
NP_442489.1_7 Reverse -249 -258 20.1576 0.000695
NP_442489.1_7 Reverse -170 -179 7.47288 0.0613
NP_442489.1_7 Forward -179 -170 0.688044 0.152
NP_441830.1_2 Reverse -199 -218 -4.42544 0.275
NP_440559.1_1 Forward -257 -248 17.4043 0.00658
NP_440559.1_1 Forward -178 -169 13.3727 0.0401
NP_440559.1_1 Reverse -250 -259 8.75118 0.0586
NP_440559.1_1 Forward -195 -186 4.42462 0.277
NP_441659.2_8 Forward -258 -248 18.1713 0.00133
NP_441659.2_8 Reverse -249 -259 11.9764 0.0147
NP_441659.2_8 Forward -179 -169 6.46988 0.0744
NP_441022.1_1 Forward -388 -379 14.7117 0.183
NP_441022.1_1 Forward -387 -378 12.4095 0.232
NP_441040.1_2 Reverse -247 -266 -15.5368 0.286
NP_439956.1_7 Reverse -127 -146 9.14423 0.257
NP_442008.1_2 Forward -351 -332 2.94938 0.27
NP_440708.1_6 Reverse -336 -355 -10.1286 0.277
NP_440708.1_6 Reverse -335 -354 -10.6203 0.282
NP_442346.1_5 Reverse -248 -258 16.6963 0.00248
NP_442346.1_5 Forward -197 -187 10.5014 0.0934
NP_442346.1_5 Forward -259 -249 9.02648 0.118
NP_442346.1_5 Reverse -186 -196 4.99491 0.267
NP_440545.1_3 Reverse -245 -262 12.2319 0.0214
NP_440459.1_2 Forward -188 -171 7.61033 0.285
NP_440010.1_4 Reverse -245 -264 -0.197979 0.25
NP_440010.1_10 Reverse -336 -355 10.8159 0.209
NP_442137.1_7 Reverse -43 -62 11.7992 0.298
NP_442603.1_7 Reverse -249 -263 10.6187 0.125
NP_442603.1_7 Forward -258 -244 8.3571 0.176
NP_441233.1_9 Forward -262 -243 15.0441 0.217
NP_441585.1_5 Reverse -26 -45 2.9486 0.256
NP_441888.1_7 Forward -263 -249 3.8345 0.225
NP_441888.1_7 Reverse -37 -51 1.67122 0.241
NP_441888.1_7 Reverse -27 -41 0.589577 0.292
NP_440946.1_1 Reverse -259 -278 12.3892 0.237
NP_441948.1_4 Forward -265 -247 -1.45582 0.146
NP_441948.1_4 Reverse -163 -181 -3.71743 0.203
NP_441047.1_1 Forward -140 -121 1.86774 0.229
NP_441833.1_4 Forward -257 -250 15.9687 0.0124
NP_441833.1_4 Reverse -250 -257 15.9687 0.0124
NP_441833.1_4 Reverse -171 -178 6.52896 0.0924
NP_441833.1_4 Forward -178 -171 6.23397 0.163
NP_441895.1_2 Reverse -255 -274 -26.8449 0.256
NP_441895.1_10 Reverse -267 -286 -18.5851 0.282
NP_442162.1_9 Forward -257 -250 16.2637 0.0124
NP_442162.1_9 Reverse -250 -257 16.2637 0.0124
NP_442162.1_9 Forward -178 -171 6.62729 0.142
NP_442162.1_9 Reverse -171 -178 6.52896 0.178
NP_440671.1_4 Forward -264 -250 19.4691 0.00937
NP_440671.1_4 Reverse -187 -201 8.55439 0.195
NP_440671.1_4 Forward -202 -188 5.30946 0.286
NP_442140.1_3 Forward -257 -247 13.5497 0.0542
NP_442140.1_3 Reverse -250 -260 8.33817 0.119
NP_442140.1_3 Reverse -171 -181 4.69992 0.238
NP_440875.1_9 Reverse -251 -261 9.05339 0.233
NP_440875.1_9 Reverse -172 -182 8.46937 0.233
NP_441813.1_5 Forward -260 -250 17.188 0.00979
NP_441813.1_5 Forward -181 -171 9.7148 0.0241
NP_441813.1_5 Reverse -247 -257 8.73149 0.0367
NP_441813.1_5 Reverse -168 -178 5.68323 0.113
NP_440590.1_4 Reverse -171 -184 10.5407 0.0262
NP_440590.1_4 Reverse -250 -263 6.80412 0.0565
NP_440590.1_4 Forward -257 -244 2.57589 0.0845
NP_440567.1_1 Forward -257 -243 -0.688726 0.298
NP_442497.1_10 Forward -257 -248 10.4228 0.0087
NP_442497.1_10 Reverse -250 -259 10.4228 0.0087
NP_442497.1_10 Forward -178 -169 8.25953 0.047
NP_442497.1_10 Reverse -171 -180 0.589713 0.153
NP_440821.1_4 Forward -260 -250 19.0562 0.00399
NP_440821.1_4 Reverse -247 -257 17.9746 0.00497
NP_440821.1_4 Reverse -168 -178 9.41981 0.0286
NP_440821.1_4 Forward -181 -171 0.471689 0.174
NP_441239.1_9 Forward -260 -248 13.3137 0.037
NP_441239.1_9 Reverse -247 -259 9.67541 0.0987
NP_441239.1_9 Reverse -168 -180 4.95553 0.234
NP_441239.1_9 Reverse -324 -336 4.5622 0.251
NP_441239.1_9 Forward -181 -169 3.87389 0.272
NP_441892.1_1 Reverse -178 -195 -5.95935 0.294
NP_440796.1_3 Forward -265 -247 11.8181 0.204
NP_441017.1_6 Forward -200 -186 16.6169 0.0651
NP_441017.1_6 Forward -183 -169 13.4703 0.192
NP_442629.1_3 Reverse -119 -138 2.94938 0.275
NP_440354.1_7 Reverse -164 -182 14.5721 0.167
NP_442052.1_8 Reverse -185 -195 14.1397 0.253
NP_442052.1_8 Forward -266 -256 13.0581 0.253
NP_440546.1_2 Reverse -328 -347 20.1573 0.219
NP_440546.1_4 Reverse -249 -259 11.8882 0.0679
NP_440546.1_4 Forward -258 -248 10.046 0.109
NP_441230.1_5 Reverse -244 -263 -0.590531 0.29
NP_440675.1_1 Reverse -246 -265 2.94938 0.261
NP_440462.1_6 Forward -260 -250 15.418 0.0142
NP_440462.1_6 Forward -181 -171 14.0414 0.0235
NP_440462.1_6 Reverse -247 -257 10.3048 0.0396
NP_440868.1_4 Forward -262 -250 8.6921 0.0582
NP_440868.1_4 Reverse -245 -257 7.11881 0.0756
NP_442499.1_1 Forward -178 -159 8.35759 0.203
NP_442479.1_9 Forward -86 -67 -6.68705 0.266
NP_441582.1_5 Forward -285 -266 2.6536 0.289
NP_441672.1_10 Reverse -172 -191 12.7825 0.278
NP_442402.1_4 Forward -276 -257 4.42355 0.145
NP_442402.1_10 Forward -278 -268 13.5492 0.2
NP_442402.1_10 Forward -279 -269 12.3692 0.212
NP_441848.1_7 Forward -157 -138 0.785326 0.228
NP_441084.1_6 Reverse -364 -378 10.2167 0.25
NP_440696.1_3 Reverse -183 -201 9.0656 0.149
NP_442023.1_2 Reverse -289 -308 7.7676 0.255
NP_442039.1_4 Forward -257 -250 15.1821 0.0124
NP_442039.1_4 Reverse -250 -257 15.1821 0.0124
NP_442039.1_7 Reverse -266 -276 7.45319 0.276
NP_441811.1_8 Reverse -164 -178 9.73436 0.225
NP_440825.1_6 Reverse -272 -291 8.25926 0.285
NP_442837.1_3 Forward -257 -250 15.7721 0.0124
NP_442837.1_3 Reverse -250 -257 15.7721 0.0124
NP_442837.1_3 Reverse -171 -178 12.1338 0.0702
NP_442837.1_3 Forward -178 -171 6.0373 0.25
NP_442053.1_1 Forward -258 -249 18.3876 0.0007
NP_442053.1_1 Reverse -249 -258 18.3876 0.0007
NP_442053.1_1 Reverse -170 -179 6.78456 0.115
NP_440505.1_3 Reverse -247 -257 16.598 0.00683
NP_440505.1_3 Forward -260 -250 13.8447 0.0247
NP_440505.1_3 Reverse -212 -222 7.15819 0.163
NP_440505.1_3 Forward -181 -171 7.05986 0.165
NP_440505.1_3 Forward -204 -194 4.3066 0.3
NP_440505.1_7 Reverse -341 -360 -1.7705 0.283
NP_440505.1_7 Reverse -176 -195 -2.55715 0.289
NP_441959.1_8 Forward -83 -70 10.2518 0.286
NP_441959.1_8 Reverse -70 -83 9.38413 0.286
NP_441203.1_1 Reverse -250 -269 -0.787193 0.0636
NP_441203.1_1 Reverse -171 -190 -4.91709 0.0854
NP_442532.1_1 Forward -84 -70 12.0572 0.215
NP_442532.1_7 Forward -258 -244 4.12949 0.178
NP_441408.2_7 Forward -204 -185 8.75091 0.115
NP_440914.1_1 Forward -258 -248 17.5935 0.000537
NP_440914.1_1 Reverse -249 -259 8.6151 0.186
NP_441011.1_8 Reverse -250 -259 16.9127 0.00602
NP_441011.1_8 Forward -257 -248 8.25953 0.144
NP_441011.1_8 Reverse -171 -180 7.07956 0.179
NP_441011.1_8 Reverse -194 -203 5.40793 0.263
NP_442533.1_1 Reverse -2 -21 -15.6352 0.257
NP_442533.1_6 Forward -258 -249 17.2076 0.00137
NP_442533.1_6 Reverse -249 -258 17.2076 0.00137
NP_442541.1_10 Forward -336 -322 2.94893 0.254
NP_442232.1_9 Reverse -367 -386 12.4867 0.252
NP_442322.1_4 Forward -18 -1 -9.99156 0.297
NP_440854.1_7 Reverse -72 -86 15.1934 0.246
NP_442229.1_1 Reverse -247 -261 7.96378 0.189
NP_442535.1_9 Forward -267 -249 5.32902 0.159
NP_441482.1_7 Forward -264 -250 10.1277 0.0135
NP_441482.1_7 Forward -185 -171 -2.75368 0.0997
NP_441482.1_7 Reverse -243 -257 -2.95034 0.103
NP_441482.1_7 Reverse -187 -201 -9.93184 0.209
NP_441482.1_7 Reverse -164 -178 -11.5051 0.268
NP_439944.1_9 Forward -257 -247 19.1546 0.00329
NP_439944.1_9 Reverse -250 -260 10.3048 0.0887
NP_439944.1_9 Forward -178 -168 5.78156 0.221
NP_440816.1_2 Forward -90 -71 5.85408 0.293
NP_441028.1_6 Forward -278 -268 8.04271 0.217
NP_441028.1_6 Forward -277 -267 6.0761 0.232
NP_442202.1_4 Reverse -247 -261 14.9684 0.197
NP_440115.1_6 Reverse -246 -256 9.7148 0.115
NP_440007.1_9 Forward -262 -248 3.73617 0.267
NP_441680.1_4 Forward -103 -84 -1.27885 0.262
NP_441972.1_5 Reverse -171 -190 2.45773 0.121
NP_441106.1_1 Forward -259 -250 18.191 0.0028
NP_441106.1_1 Reverse -248 -257 9.63616 0.0311
NP_441106.1_1 Forward -180 -171 8.45619 0.0548
NP_442588.1_8 Reverse -334 -353 5.40766 0.282
NP_442306.1_10 Forward -263 -244 -19.1751 0.197
NP_441286.1_1 Reverse -248 -260 14.4936 0.00418
NP_441286.1_1 Forward -259 -247 12.1337 0.0104
NP_441286.1_1 Forward -180 -168 -4.18925 0.152
NP_442674.1_2 Forward -294 -275 8.45592 0.254
NP_440670.1_8 Forward -258 -249 18.3876 0.000699
NP_440670.1_8 Reverse -249 -258 18.3876 0.000699
NP_440670.1_8 Forward -179 -170 7.47288 0.0773
NP_440670.1_8 Reverse -170 -179 5.89959 0.131
NP_441930.1_2 Reverse -207 -217 12.8614 0.248
NP_441930.1_2 Reverse -326 -336 12.0747 0.266
NP_440886.1_7 Forward -259 -249 17.7774 0.0011
NP_440886.1_7 Reverse -248 -258 7.94438 0.0805
NP_440886.1_7 Forward -218 -208 5.78111 0.163
NP_440083.1_3 Reverse -51 -70 13.0775 0.16
NP_442072.1_9 Forward -259 -241 -22.007 0.216
NP_440907.2_8 Forward -257 -247 10.8943 0.0969
NP_440907.2_8 Reverse -250 -260 7.84605 0.117
NP_440907.2_8 Forward -178 -168 4.69947 0.25
NP_442264.1_2 Reverse -245 -262 10.1669 0.188
NP_442264.1_2 Reverse -160 -177 6.43035 0.259
NP_441021.1_1 Forward -257 -238 -10.3253 0.234
NP_441463.1_3 Forward -227 -208 4.916 0.081
NP_441463.1_3 Reverse -160 -179 -7.08038 0.254
NP_441463.1_3 Reverse -239 -258 -8.55534 0.271
NP_441463.1_6 Forward -260 -246 8.63851 0.25
NP_441463.1_6 Reverse -247 -261 5.64286 0.287
NP_442056.1_1 Forward -43 -25 14.9655 0.264
NP_441626.1_2 Forward -257 -250 15.7721 0.0124
NP_441626.1_2 Reverse -250 -257 15.7721 0.0124
NP_441626.1_2 Forward -178 -171 6.13563 0.177
NP_441626.1_2 Reverse -171 -178 5.93897 0.231
NP_442365.1_5 Forward -195 -176 20.354 0.0389
NP_442365.1_7 Forward -262 -243 4.32602 0.146
NP_442794.1_1 Forward -262 -250 10.1671 0.0721
NP_442794.1_1 Reverse -189 -201 6.23383 0.186
NP_442794.1_1 Reverse -110 -122 2.59558 0.287
NP_442615.1_1 Forward -267 -249 3.46073 0.0542
NP_441962.1_4 Forward -263 -244 -9.34199 0.215
NP_441962.1_4 Reverse -244 -263 -11.3086 0.239
NP_440387.1_1 Forward -258 -242 14.2182 0.00668
NP_440387.1_1 Reverse -249 -265 13.3332 0.00865
NP_440387.1_1 Forward -179 -163 -5.93965 0.258
NP_441431.1_2 Forward -261 -247 7.96378 0.23
NP_442020.1_1 Forward -289 -270 1.37531 0.255
NP_441836.1_2 Reverse -127 -146 -4.42544 0.255
NP_440634.1_1 Reverse -247 -266 13.2741 0.26
NP_440082.1_7 Forward -97 -78 16.4504 0.283
NP_440114.1_10 Forward -196 -182 8.16106 0.213
NP_440114.1_10 Reverse -326 -340 7.17775 0.243
NP_440114.1_10 Forward -258 -244 5.70279 0.296
NP_440754.1_3 Reverse -316 -334 16.8337 0.0704
NP_440766.1_4 Forward -262 -248 8.25939 0.0871
NP_441237.1_9 Forward -257 -247 14.9263 0.0242
NP_442743.1_4 Reverse -171 -190 12.7825 0.0547
NP_442743.1_4 Reverse -250 -269 -8.65367 0.298
NP_440643.1_6 Forward -170 -151 4.42435 0.22
NP_441531.1_7 Reverse -121 -140 14.1591 0.272
NP_442930.1_1 Forward -282 -272 10.3043 0.276
NP_439910.1_2 Forward -266 -249 -13.4325 0.162
NP_440457.1_1 Forward -262 -250 8.29878 0.101
NP_440457.1_1 Forward -183 -171 6.03717 0.132
NP_440457.1_1 Reverse -316 -328 2.79224 0.205
NP_440457.1_1 Reverse -6 -18 0.530633 0.25
NP_441801.1_2 Forward -178 -159 -8.06369 0.17
NP_441332.1_6 Reverse -333 -343 11.4531 0.26
NP_440473.1_9 Reverse -176 -195 -3.44213 0.165
NP_442509.1_9 Reverse -249 -259 16.2041 0.00739
NP_442509.1_9 Forward -258 -248 8.14104 0.192
NP_442582.1_3 Forward -60 -46 15.6723 0.169
NP_440554.1_4 Reverse -250 -260 14.6313 0.02
NP_440554.1_4 Reverse -171 -181 6.8632 0.111
NP_440554.1_4 Forward -257 -247 6.37155 0.123
NP_441885.1_5 Forward -258 -248 20.9245 0.000538
NP_441885.1_5 Reverse -249 -259 11.4848 0.00668
NP_442703.1_8 Forward -245 -227 12.2114 0.265
NP_442341.1_7 Reverse -248 -262 17.7975 0.0111
NP_442341.1_7 Forward -259 -245 9.93102 0.0692
NP_442341.1_7 Reverse -169 -183 1.76955 0.281
NP_441756.1_7 Forward -263 -244 16.7157 0.133
NP_441173.1_9 Reverse -286 -294 13.2937 0.17
NP_441173.1_9 Forward -277 -269 11.3271 0.226
NP_442395.2_4 Forward -355 -336 -0.492971 0.295
NP_443000.1_7 Reverse -247 -257 10.4031 0.0345
NP_443000.1_7 Forward -260 -250 8.73149 0.0437
NP_443000.1_7 Forward -181 -171 1.84832 0.228
NP_440507.2_3 Forward -267 -248 12.7816 0.145
NP_440507.2_3 Reverse -240 -259 7.37347 0.281
NP_440552.1_8 Forward -295 -278 14.0895 0.175
NP_440275.1_3 Reverse -247 -257 17.6796 0.0102
NP_440275.1_3 Forward -260 -250 8.4365 0.0602
NP_440275.1_3 Forward -181 -171 5.87989 0.13
NP_440091.1_1 Reverse -245 -257 8.9871 0.0567
NP_440091.1_1 Forward -262 -250 1.41561 0.197
NP_442354.1_7 Forward -261 -242 8.65258 0.216
NP_441397.1_5 Reverse -275 -291 15.272 0.284
NP_443010.1_10 Reverse -323 -340 2.28762 0.277
NP_442451.1_2 Forward -187 -168 -7.86702 0.24
NP_442451.1_2 Forward -266 -247 -9.73531 0.259
NP_441207.1_7 Forward -87 -73 8.09365 0.293
NP_440149.1_8 Reverse -249 -268 4.916 0.0794
NP_440149.1_8 Forward -258 -239 -2.75381 0.175
NP_440149.1_8 Reverse -170 -189 -3.63879 0.193
NP_441105.1_3 Forward -207 -188 -7.08038 0.245
NP_441105.1_3 Reverse -176 -195 -7.86702 0.261
NP_440216.1_1 Reverse -249 -263 -2.16369 0.0482
NP_440216.1_1 Reverse -170 -184 -2.26202 0.0484
NP_440216.1_1 Forward -258 -244 -2.85201 0.0608
NP_440216.1_1 Reverse -193 -207 -12.0951 0.24
NP_440216.1_9 Forward -162 -153 6.68623 0.289
NP_440172.1_1 Forward -258 -248 15.0247 0.00945
NP_440172.1_1 Reverse -249 -259 8.73149 0.0586
NP_440172.1_1 Forward -196 -186 2.83163 0.264
NP_442371.1_1 Forward -90 -80 15.7125 0.142
NP_442371.1_1 Reverse -268 -278 14.8275 0.183
NP_442015.1_10 Forward -262 -249 19.1938 0.00444
NP_442015.1_10 Reverse -341 -354 3.95252 0.178
NP_441226.1_7 Forward -257 -250 14.4934 0.0123
NP_441226.1_7 Reverse -250 -257 14.4934 0.0123
NP_441111.1_7 Forward -257 -249 18.7023 0.00294
NP_441111.1_7 Reverse -250 -258 18.7023 0.00294
NP_441111.1_7 Reverse -171 -179 8.86921 0.0589
NP_441766.1_2 Forward -258 -249 17.5026 0.00297
NP_441766.1_2 Reverse -249 -258 17.5026 0.00297
NP_441766.1_2 Reverse -170 -179 6.48957 0.096
NP_442969.1_4 Forward -91 -72 4.12936 0.295
NP_442417.1_5 Reverse -249 -263 12.1926 0.0981
NP_440416.1_9 Forward -275 -256 -8.55534 0.117
NP_440416.1_9 Reverse -163 -182 -12.8819 0.16
NP_440416.1_9 Reverse -186 -205 -15.1435 0.186
NP_440416.1_9 Forward -265 -246 -21.9284 0.298
NP_443052.1_8 Reverse -160 -179 -8.85033 0.179
NP_443052.1_9 Forward -143 -124 -2.65548 0.241
NP_443052.1_9 Forward -328 -309 -5.60541 0.271
NP_440072.1_5 Reverse -309 -327 -3.02911 0.273
NP_441135.1_4 Forward -265 -246 2.85105 0.284
NP_442154.1_1 Reverse -256 -274 -15.0255 0.218
NP_440261.1_5 Reverse -250 -263 -2.93064 0.0983
NP_440261.1_5 Reverse -134 -147 -6.37223 0.201
NP_440261.1_5 Forward -257 -244 -10.5021 0.201
NP_440261.1_5 Reverse -171 -184 -12.3704 0.284
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CTTTGGTGGGGCCAAAAACTTTTATACCCAGTGCTTGTAATTGATCGGTCAACCCCAGGGTAAGGGGCAATTCCGGCCCCACCACTACTAAATTAATCTTTTCCGTTTGGCAAAATTCACAAATTTCCCCCAGTTGATCCACGGCGATCGCCACATTTTCTGTTTTCGGTAACCCAGCAGTACCGCCATTTCCCGGCAAGCAATAGCAATGGCTCACCTCCGGCGATCGAACTAACGACCAAGCCAAAGTATGTTCCCGTCCACCGCTACCAATAACTGCCACTTTCATGGACTGTAACCTCTACAACTGCTGGAAAAATTATGATAAATTAGCCGTTCTCAAGATTAACAGAATGGCCGGAGTTGACTGGAGTTATTTATCTCCGCCCCCCCACTTTCC

CDS

ATGGCTGAACAGCATTTAATTATTTTCACCCGTTGGCCAGAACCCGGAAAAACCAAAACTCGCCTGATCCCTGCCCTTGGCTCTAGGGGAGCGGCCAAGCTACAGCAACAACTGACGGAACATACCGTTCAAACCGCCCATAATTTTCGCTGCCAAACCGATGCCCCTTGTCAAATAACTGTTTTTTACACTGGCGGAACTAGACAGCAGATGGAACAGTGGCTAGGAACTAATTTTTGTTATCAACCCCAAGGAACTGGAGATTTAGGCGATCGCCTGCAACAGTCTTGCCAGTGGGCCTTTGGGCAGGGAGGCAACAAAGTTGTGATTATCGGCATTGATTGCCCTGGTATTACTCAAGAACTACTCCAAACCGCCTTCACTGCCTTGGATAATTACCCGGTAGTGCTGGGGCCGGCCCTGGATGGCGGTTATTATCTAATGGGCTTGACCAACTTCAACCCAGCCTATTTCGAGCAAATTGACTGGGGCACTGGAGTCGTTTACCAACAGACCTTGGCAAAAATTGTCCAAAATGGCGATCGCCCTTACGACTTACCAACCCTACCGGACATAGACCATCCCACGGACTTGCAATACCTACCCGTCACCTTCATCGCAGCAGATAAAACTTAG

Protein

MAEQHLIIFTRWPEPGKTKTRLIPALGSRGAAKLQQQLTEHTVQTAHNFRCQTDAPCQITVFYTGGTRQQMEQWLGTNFCYQPQGTGDLGDRLQQSCQWAFGQGGNKVVIIGIDCPGITQELLQTAFTALDNYPVVLGPALDGGYYLMGLTNFNPAYFEQIDWGTGVVYQQTLAKIVQNGDRPYDLPTLPDIDHPTDLQYLPVTFIAADKT