Your browser is old and dusty. Try Google Chrome!

Details for sll1087

ORF sll1087
Accession NP_441666.1
Symbol
Category similar to sodium/glucose cotransporter
Definition Transport and binding proteins
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -353 -339 2.85119 0.17
NP_441418.1_6 Reverse -250 -269 -29.4015 0.224
NP_442291.1_5 Forward -260 -244 -2.98973 0.232
NP_441453.1_1 Forward -266 -248 5.42659 0.246
NP_441453.1_4 Reverse -250 -258 6.80426 0.121
NP_441453.1_4 Forward -259 -251 6.11594 0.121
NP_441623.1_1 Forward -275 -257 -4.01242 0.274
NP_441818.1_1 Forward -258 -247 14.8078 0.0426
NP_441818.1_9 Forward -330 -311 -1.18052 0.198
NP_441818.1_9 Reverse -287 -306 -9.24366 0.288
NP_440226.1_1 Reverse -250 -269 8.35759 0.0885
NP_442173.1_1 Forward -258 -250 12.0158 0.0316
NP_442173.1_1 Reverse -251 -259 4.83764 0.241
NP_442752.1_4 Reverse -250 -257 13.8055 0.0199
NP_443027.1_4 Forward -82 -72 7.45319 0.24
NP_439997.1_3 Forward -263 -244 13.9625 0.161
NP_440784.1_7 Reverse -251 -258 6.23397 0.241
NP_440784.1_7 Forward -258 -251 6.13563 0.241
NP_440061.1_9 Forward -254 -240 6.78381 0.232
NP_439918.1_2 Forward -330 -311 -1.86883 0.24
NP_441935.1_1 Forward -344 -325 7.37428 0.24
NP_441935.1_1 Forward -191 -172 4.81767 0.293
NP_441208.1_9 Reverse -189 -203 14.7492 0.093
NP_442804.1_1 Forward -54 -35 20.354 0.0863
NP_441083.1_5 Forward -259 -249 17.7779 0.00336
NP_441083.1_5 Forward -201 -191 2.63497 0.193
NP_441083.1_5 Reverse -250 -260 -0.904945 0.283
NP_442827.1_8 Forward -307 -288 -2.26292 0.272
NP_441738.1_2 Forward -257 -250 15.28 0.0102
NP_441738.1_2 Forward -264 -257 6.23363 0.264
NP_441558.1_5 Forward -355 -336 7.37428 0.182
NP_440209.1_1 Reverse -250 -258 8.57422 0.0425
NP_440209.1_1 Forward -259 -251 5.52596 0.0821
NP_441770.1_4 Reverse -297 -316 -8.55534 0.245
NP_441025.1_5 Reverse -244 -258 13.7659 0.294
NP_440906.1_5 Reverse -251 -258 6.23397 0.234
NP_440906.1_5 Forward -258 -251 6.13563 0.241
NP_440747.1_10 Reverse -247 -259 -2.61596 0.0556
NP_441130.1_10 Forward -261 -247 9.04604 0.131
NP_441486.1_1 Reverse -247 -261 -3.83532 0.183
NP_442634.1_4 Forward -332 -318 -3.54032 0.161
NP_441014.1_10 Forward -96 -77 -0.689632 0.252
NP_443018.1_3 Forward -258 -251 11.7405 0.0655
NP_443018.1_3 Forward -352 -345 9.38056 0.128
NP_443018.1_3 Reverse -251 -258 5.44732 0.193
NP_441634.1_8 Reverse -248 -262 -2.95034 0.295
NP_440376.1_1 Reverse -250 -259 5.99792 0.111
NP_440376.1_1 Reverse -243 -252 0.196389 0.283
NP_440376.1_1 Forward -259 -250 -0.196935 0.285
NP_440376.1_1 Reverse -303 -312 -0.491928 0.29
NP_441588.1_4 Forward -257 -247 8.73149 0.14
NP_441846.1_10 Reverse -274 -293 -23.6 0.294
NP_441846.1_10 Reverse -271 -290 -23.7966 0.298
NP_441013.1_2 Forward -335 -317 -1.94747 0.282
NP_442544.1_2 Reverse -10 -24 -1.67204 0.287
NP_441414.1_9 Reverse -250 -269 -0.787193 0.0943
NP_440184.1_5 Reverse -240 -259 5.70265 0.241
NP_442937.1_5 Reverse -21 -40 12.5858 0.105
NP_441958.1_5 Reverse -249 -259 0.865012 0.12
NP_441127.1_1 Forward -242 -228 12.4876 0.213
NP_442836.1_5 Reverse -237 -256 8.35759 0.144
NP_442836.1_10 Reverse -44 -54 13.5497 0.22
NP_442836.1_10 Reverse -251 -261 10.6981 0.269
NP_440203.1_5 Forward -24 -14 14.2375 0.0886
NP_440984.1_7 Forward -358 -344 7.17775 0.182
NP_440153.1_5 Forward -258 -244 1.37622 0.257
NP_441294.1_7 Forward -263 -249 10.6905 0.177
NP_441646.1_7 Reverse -284 -298 16.9125 0.229
NP_442438.1_10 Reverse -51 -65 0.589577 0.221
NP_441000.1_6 Forward -260 -246 4.22782 0.0964
NP_440484.1_3 Reverse -248 -262 9.43936 0.263
NP_440147.1_4 Forward -261 -248 1.00259 0.242
NP_441550.1_8 Reverse -248 -258 13.8442 0.0207
NP_440465.1_10 Forward -299 -280 -1.27885 0.291
NP_441041.1_7 Reverse -247 -259 6.25147 0.216
NP_441725.1_4 Reverse -66 -80 4.62054 0.278
NP_439966.1_7 Forward -261 -251 9.616 0.106
NP_439966.1_7 Reverse -248 -258 5.58445 0.216
NP_442941.1_3 Forward -258 -248 9.41981 0.0319
NP_440289.1_2 Reverse -247 -260 -5.09393 0.297
NP_440260.1_7 Reverse -282 -301 -5.9004 0.279
NP_441678.1_9 Reverse -332 -351 -3.93378 0.288
NP_001035871.2_7 Reverse -323 -333 12.9597 0.237
NP_440437.1_1 Reverse -65 -84 -5.40875 0.282
NP_442500.1_8 Reverse -378 -392 10.4676 0.272
NP_442012.1_1 Forward -302 -283 4.03102 0.177
NP_441087.1_6 Forward -290 -272 -0.964891 0.264
NP_441644.1_6 Forward -259 -249 14.4342 0.0126
NP_441644.1_6 Forward -353 -343 5.87944 0.174
NP_443049.1_6 Reverse -249 -259 14.4711 0.114
NP_442215.1_2 Forward -261 -245 -1.80975 0.189
NP_442215.1_2 Forward -362 -346 -6.7263 0.278
NP_442029.1_8 Reverse -279 -298 15.1424 0.129
NP_440929.1_8 Forward -259 -250 7.07956 0.0713
NP_440469.1_8 Reverse -279 -298 9.83255 0.295
NP_441346.1_7 Forward -71 -52 19.8623 0.115
NP_441751.2_8 Forward -258 -244 -4.22864 0.166
NP_442554.1_8 Forward -258 -248 6.37155 0.12
NP_442554.1_8 Reverse -345 -355 3.91327 0.203
NP_441762.1_7 Reverse -249 -261 2.49725 0.0676
NP_442313.1_3 Forward -335 -316 13.5691 0.208
NP_442142.1_4 Forward -195 -182 5.72191 0.186
NP_442142.1_4 Reverse -341 -354 3.16532 0.265
NP_442292.1_1 Forward -258 -249 8.65285 0.0335
NP_441525.1_1 Reverse -179 -192 14.5723 0.212
NP_441715.1_4 Forward -258 -248 7.55152 0.108
NP_440881.1_4 Forward -312 -293 2.3594 0.226
NP_441468.1_1 Reverse -251 -258 6.13563 0.209
NP_441468.1_1 Forward -258 -251 6.0373 0.223
NP_441015.1_10 Reverse -339 -358 -6.68705 0.253
NP_441673.1_1 Reverse -250 -259 1.37636 0.114
NP_441673.1_1 Forward -259 -250 1.1797 0.163
NP_441731.1_3 Reverse -242 -261 -5.11376 0.284
NP_441096.1_5 Forward -289 -271 13.6864 0.297
NP_441876.1_9 Reverse -72 -82 10.1076 0.3
NP_441826.1_2 Reverse -244 -258 6.78443 0.09
NP_442868.1_6 Reverse -248 -258 9.51814 0.0447
NP_442808.1_1 Forward -260 -250 19.449 0.00201
NP_442820.1_3 Forward -189 -179 13.4509 0.277
NP_442718.1_2 Forward -242 -223 -6.29373 0.295
NP_442542.1_2 Reverse -242 -255 6.1158 0.234
NP_442542.1_9 Reverse -243 -257 9.83206 0.128
NP_442903.1_2 Reverse -146 -165 5.20389 0.196
NP_440274.1_4 Forward -195 -177 3.06741 0.192
NP_442792.1_5 Reverse -322 -339 8.10198 0.296
NP_441036.1_8 Forward -260 -250 6.07655 0.242
NP_441557.1_5 Reverse -250 -259 1.08137 0.0794
NP_441557.1_5 Forward -259 -250 0.589713 0.134
NP_442066.2_4 Forward -133 -114 -8.35868 0.294
NP_441433.1_8 Forward -131 -112 -4.32711 0.294
NP_442397.1_9 Forward -259 -240 6.39097 0.246
NP_441574.1_1 Forward -330 -311 0.491109 0.192
NP_441549.1_9 Reverse -281 -299 -4.20908 0.198
NP_441549.1_9 Reverse -50 -68 -8.43732 0.228
NP_442347.1_2 Reverse -72 -81 15.4377 0.056
NP_442347.1_2 Forward -258 -249 10.3245 0.058
NP_442347.1_2 Reverse -291 -300 6.29291 0.175
NP_442645.1_2 Reverse -242 -261 -14.3569 0.173
NP_442965.1_2 Reverse -327 -346 -4.32711 0.255
NP_440151.1_5 Forward -336 -317 6.78429 0.235
NP_440136.1_2 Reverse -251 -258 6.23397 0.171
NP_440136.1_2 Forward -258 -251 6.13563 0.193
NP_442590.1_10 Forward -259 -240 6.98095 0.236
NP_442998.1_5 Reverse -271 -281 12.0747 0.176
NP_442998.1_10 Forward -257 -250 15.5754 0.0102
NP_442998.1_10 Forward -33 -26 7.21728 0.144
NP_441799.1_1 Forward -263 -249 6.58715 0.167
NP_442334.1_2 Reverse -240 -257 -13.7275 0.297
NP_440256.1_1 Reverse -247 -266 5.01433 0.0395
NP_440256.1_1 Reverse -318 -337 -8.45701 0.261
NP_440087.1_1 Reverse -287 -306 -7.76869 0.276
NP_440915.1_6 Reverse -246 -260 9.73436 0.039
NP_440915.1_6 Reverse -283 -297 -1.8687 0.251
NP_442386.1_9 Forward -260 -251 13.8639 0.0289
NP_442386.1_9 Forward -354 -345 7.47246 0.219
NP_440570.1_5 Reverse -323 -342 4.916 0.207
NP_442054.1_3 Forward -141 -122 -3.24547 0.277
NP_441750.1_4 Reverse -332 -351 2.65439 0.251
NP_441340.1_5 Reverse -251 -258 13.5105 0.0314
NP_441340.1_5 Forward -258 -251 5.84064 0.208
NP_442791.1_5 Forward -260 -241 -1.18052 0.214
NP_442791.1_5 Forward -267 -248 -7.67036 0.279
NP_440168.1_4 Reverse -340 -359 0.786102 0.22
NP_440168.1_9 Forward -253 -234 -4.03212 0.296
NP_440161.1_3 Reverse -248 -267 7.7676 0.287
NP_440586.1_8 Forward -258 -251 9.47853 0.146
NP_440586.1_8 Reverse -251 -258 5.74197 0.283
NP_440192.1_4 Forward -347 -328 17.8384 0.146
NP_440969.1_3 Forward -258 -240 8.6715 0.278
NP_441262.1_3 Reverse -250 -257 14.7888 0.0223
NP_440027.1_3 Forward -259 -241 1.69003 0.299
NP_440027.1_3 Forward -299 -281 1.5917 0.3
NP_443051.1_1 Reverse -249 -258 7.47288 0.0571
NP_439937.1_9 Forward -346 -329 -2.32179 0.149
NP_439937.1_9 Reverse -285 -302 -8.8116 0.177
NP_440408.1_6 Reverse -239 -257 12.9988 0.287
NP_440626.1_1 Reverse -251 -270 14.7483 0.183
NP_440372.1_2 Reverse -251 -258 13.8055 0.0214
NP_440372.1_2 Forward -258 -251 6.52896 0.188
NP_440171.1_3 Reverse -269 -288 2.65439 0.285
NP_441789.1_7 Forward -306 -287 -5.31116 0.297
NP_440819.1_5 Forward -118 -110 7.68924 0.266
NP_440316.1_10 Reverse -243 -253 7.55152 0.246
NP_441572.1_7 Reverse -244 -263 -3.14714 0.207
NP_442887.1_5 Forward -349 -330 -12.4886 0.281
NP_442384.1_10 Reverse -290 -303 1.9859 0.24
NP_442384.1_10 Forward -259 -246 1.39592 0.26
NP_442790.1_4 Reverse -241 -260 -13.3736 0.26
NP_442262.1_10 Forward -258 -251 13.2155 0.0213
NP_442262.1_10 Forward -352 -345 9.47889 0.187
NP_440344.1_10 Forward -266 -249 -1.63279 0.0557
NP_440531.1_6 Reverse -235 -254 5.30933 0.115
NP_441965.1_3 Reverse -240 -259 -1.7705 0.294
NP_442187.1_3 Reverse -249 -259 15.6147 0.105
NP_442280.1_10 Reverse -322 -340 4.96742 0.291
NP_441592.1_4 Forward -259 -240 -3.63879 0.286
NP_441896.1_3 Reverse -265 -284 2.45773 0.194
NP_440888.1_2 Forward -259 -245 16.1252 0.00789
NP_440888.1_2 Reverse -290 -304 6.0955 0.249
NP_440600.1_4 Forward -267 -249 -7.749 0.294
NP_440491.1_1 Reverse -287 -306 6.42973 0.296
NP_442033.1_10 Forward -261 -242 -14.1602 0.297
NP_441123.1_4 Forward -259 -245 16.5185 0.278
NP_440575.1_8 Reverse -2 -21 17.0107 0.0705
NP_441543.1_2 Forward -258 -249 7.07956 0.131
NP_442845.1_2 Reverse -244 -258 7.37441 0.195
NP_442845.1_2 Forward -359 -345 6.88276 0.201
NP_442845.1_2 Reverse -273 -287 3.53951 0.287
NP_441319.1_5 Forward -258 -239 7.7676 0.3
NP_441319.1_8 Forward -305 -287 8.57394 0.231
NP_441469.1_8 Forward -260 -251 5.60459 0.258
NP_442578.1_7 Reverse -251 -258 6.0373 0.18
NP_441462.1_2 Reverse -250 -260 7.55152 0.0543
NP_443062.1_1 Forward -259 -241 7.96088 0.163
NP_441423.1_5 Forward -383 -370 18.9965 0.18
NP_442204.1_1 Forward -334 -323 2.81194 0.266
NP_442204.1_1 Reverse -246 -257 2.22195 0.266
NP_440454.1_6 Reverse -373 -392 19.688 0.148
NP_440516.1_8 Reverse -250 -259 18.9776 0.00442
NP_440516.1_8 Forward -259 -250 5.01461 0.118
NP_442428.1_5 Reverse -251 -258 6.13563 0.209
NP_442428.1_5 Forward -258 -251 6.0373 0.212
NP_440673.1_3 Forward -257 -250 12.4288 0.0426
NP_440673.1_7 Reverse -239 -258 9.24257 0.115
NP_441052.1_2 Forward -259 -249 10.6981 0.0285
NP_442219.1_9 Forward -258 -249 7.96454 0.0696
NP_440436.1_4 Forward -258 -249 7.57079 0.124
NP_441884.1_9 Reverse -241 -260 -12.1936 0.138
NP_441884.1_9 Reverse -287 -306 -21.4367 0.245
NP_442086.1_3 Reverse -251 -270 7.17762 0.282
NP_441321.1_5 Reverse -272 -291 2.75272 0.285
NP_441719.1_4 Reverse -251 -258 6.82395 0.0855
NP_441719.1_4 Forward -258 -251 6.52896 0.188
NP_441733.1_10 Reverse -247 -260 10.5407 0.106
NP_441733.1_10 Forward -83 -70 6.60746 0.179
NP_441004.1_1 Reverse -327 -346 -17.7001 0.294
NP_442873.1_2 Reverse -236 -255 8.84842 0.28
NP_440296.1_10 Reverse -241 -260 -14.4552 0.269
NP_442208.1_5 Forward -314 -295 -8.35868 0.275
NP_441542.1_4 Reverse -22 -36 3.14618 0.291
NP_442856.1_7 Reverse -241 -260 -4.42544 0.26
NP_440593.1_3 Forward -358 -339 -6.39206 0.273
NP_440940.1_7 Reverse -61 -79 8.57317 0.171
NP_441349.1_6 Reverse -1 -20 9.63589 0.283
NP_442843.1_1 Reverse -251 -270 -6.88371 0.245
NP_442843.1_1 Reverse -19 -38 -10.817 0.281
NP_442843.1_1 Forward -177 -158 -11.8003 0.293
NP_441524.1_6 Forward -334 -316 9.55725 0.243
NP_442450.1_5 Reverse -69 -79 4.69992 0.297
NP_440588.1_2 Reverse -241 -260 -1.67217 0.156
NP_440588.1_2 Reverse -47 -66 -6.98204 0.297
NP_440483.1_1 Reverse -274 -293 -8.45701 0.286
NP_441078.1_4 Reverse -250 -259 0.196389 0.205
NP_441078.1_4 Forward -259 -250 -0.000272808 0.205
NP_440526.1_3 Forward -258 -247 0.64819 0.273
NP_441432.1_5 Reverse -70 -84 13.8643 0.271
NP_441432.1_8 Reverse -249 -258 14.0611 0.0258
NP_441432.1_8 Reverse -17 -26 2.65466 0.292
NP_441432.1_9 Reverse -101 -114 10.6345 0.245
NP_441333.1_1 Forward -104 -94 13.4965 0.217
NP_442320.1_8 Reverse -244 -258 -5.40861 0.225
NP_441732.1_2 Forward -205 -189 -17.0511 0.231
NP_440760.1_1 Forward -259 -240 -23.305 0.293
NP_442797.1_7 Forward -260 -242 11.3272 0.167
NP_442797.1_7 Forward -306 -288 2.47742 0.239
NP_442274.1_8 Forward -260 -242 13.0925 0.297
NP_440199.1_10 Reverse -247 -257 7.25653 0.231
NP_441945.1_10 Forward -331 -312 8.16093 0.277
NP_440913.1_1 Forward -355 -337 5.91901 0.234
NP_441072.1_2 Reverse -239 -258 6.98095 0.261
NP_442489.1_7 Forward -259 -250 0.688044 0.152
NP_442489.1_7 Reverse -250 -259 0.688044 0.152
NP_440559.1_1 Forward -258 -249 7.76787 0.0918
NP_441659.2_8 Forward -259 -249 5.48657 0.106
NP_441022.1_1 Forward -51 -42 10.587 0.294
NP_442913.1_10 Reverse -294 -313 -4.81876 0.248
NP_441040.1_2 Forward -361 -342 -3.3438 0.144
NP_441040.1_2 Forward -261 -242 -11.6036 0.255
NP_440831.1_3 Reverse -241 -260 7.64914 0.247
NP_441786.1_3 Forward -214 -195 7.27595 0.287
NP_440459.1_2 Forward -261 -244 14.1985 0.119
NP_441943.1_8 Forward -307 -288 -5.31042 0.258
NP_442603.1_7 Forward -259 -245 7.86545 0.193
NP_441585.1_5 Forward -143 -124 -0.39464 0.291
NP_441833.1_4 Forward -258 -251 6.52896 0.0924
NP_441833.1_4 Reverse -251 -258 6.23397 0.163
NP_442162.1_9 Forward -258 -251 12.9205 0.0282
NP_442162.1_9 Reverse -251 -258 12.9205 0.0282
NP_440788.1_8 Reverse -365 -384 7.47261 0.286
NP_440671.1_2 Forward -256 -242 14.0609 0.28
NP_440671.1_4 Reverse -244 -258 8.35772 0.201
NP_440671.1_4 Reverse -358 -372 4.91614 0.3
NP_442045.1_5 Reverse -241 -260 -2.0655 0.292
NP_442546.1_4 Reverse -252 -270 11.1305 0.227
NP_442140.1_3 Forward -352 -342 9.7148 0.103
NP_442140.1_3 Reverse -251 -261 8.73149 0.119
NP_442140.1_3 Forward -258 -248 8.23984 0.122
NP_440875.1_9 Forward -257 -247 7.69067 0.255
NP_441813.1_5 Reverse -248 -258 8.4365 0.0432
NP_441813.1_5 Forward -261 -251 6.76487 0.0792
NP_440590.1_4 Forward -258 -245 11.4257 0.0202
NP_440567.1_1 Reverse -251 -265 7.57108 0.0689
NP_442497.1_10 Forward -258 -249 0.589713 0.153
NP_440821.1_4 Reverse -248 -258 -0.314959 0.251
NP_441239.1_9 Forward -261 -249 10.7571 0.0723
NP_441239.1_9 Forward -254 -242 3.2839 0.289
NP_441239.1_9 Forward -185 -173 3.2839 0.289
NP_442643.1_3 Reverse -316 -335 -4.03212 0.261
NP_442216.1_4 Forward -265 -257 8.1805 0.255
NP_440354.1_7 Reverse -244 -262 7.19731 0.274
NP_440546.1_4 Reverse -250 -260 14.0213 0.0459
NP_440546.1_4 Forward -353 -343 9.94905 0.112
NP_440546.1_4 Reverse -344 -354 7.71902 0.224
NP_440675.1_8 Forward -253 -234 21.4779 0.117
NP_440462.1_6 Forward -261 -251 5.09324 0.168
NP_442340.1_3 Forward -190 -171 -6.88371 0.227
NP_440868.1_4 Forward -263 -251 0.628964 0.206
NP_442479.1_8 Forward -191 -172 3.04771 0.259
NP_441848.1_5 Forward -395 -376 12.7089 0.269
NP_442039.1_4 Reverse -251 -258 11.6422 0.0747
NP_441811.1_4 Reverse -248 -267 1.67108 0.29
NP_442829.1_2 Reverse -149 -165 9.10743 0.287
NP_442837.1_3 Reverse -72 -79 6.52896 0.2
NP_442837.1_3 Forward -258 -251 6.0373 0.25
NP_442837.1_3 Reverse -251 -258 6.0373 0.25
NP_440160.1_2 Reverse -332 -351 -8.26035 0.286
NP_440160.1_3 Reverse -270 -289 8.16011 0.284
NP_442053.1_1 Forward -259 -250 14.4544 0.0114
NP_442053.1_1 Reverse -250 -259 7.86621 0.0863
NP_440505.1_3 Reverse -248 -258 16.7946 0.00614
NP_440520.1_1 Reverse -271 -290 -5.40875 0.292
NP_440914.1_1 Forward -259 -249 13.1043 0.0386
NP_441011.1_8 Reverse -251 -260 11.7994 0.0629
NP_442533.1_1 Forward -83 -64 -13.3736 0.237
NP_442533.1_6 Forward -259 -250 4.42462 0.179
NP_442533.1_6 Forward -68 -59 3.04799 0.228
NP_442533.1_6 Forward -252 -243 2.06468 0.275
NP_442232.1_9 Forward -182 -163 12.4867 0.252
NP_442597.1_5 Forward -152 -133 17.0449 0.241
NP_440816.1_2 Reverse -16 -35 7.98396 0.259
NP_441028.1_6 Reverse -291 -301 10.9926 0.193
NP_441028.1_6 Forward -129 -119 10.1076 0.21
NP_440116.1_8 Forward -258 -239 1.37609 0.0926
NP_440115.1_6 Reverse -247 -257 6.8632 0.167
NP_440007.1_9 Reverse -246 -260 5.80112 0.245
NP_440007.1_9 Reverse -67 -81 1.76955 0.285
NP_439965.1_1 Reverse -47 -66 -6.09707 0.211
NP_441286.1_1 Reverse -249 -261 -4.38592 0.156
NP_440670.1_8 Reverse -250 -259 8.75118 0.0606
NP_440670.1_8 Forward -259 -250 6.19458 0.124
NP_440886.1_7 Forward -260 -250 16.4991 0.0104
NP_442401.1_2 Forward -300 -281 10.4217 0.178
NP_442401.1_2 Reverse -25 -44 10.4217 0.178
NP_441069.1_1 Forward -38 -21 16.1651 0.176
NP_442022.1_4 Forward -327 -308 5.99764 0.273
NP_441626.1_2 Reverse -251 -258 12.2322 0.0511
NP_441626.1_2 Forward -258 -251 5.93897 0.231
NP_442365.1_7 Reverse -292 -311 -0.000545616 0.177
NP_441962.1_4 Reverse -339 -358 -14.6519 0.291
NP_440387.1_1 Forward -68 -52 -4.46469 0.187
NP_440855.1_9 Forward -75 -56 16.3215 0.283
NP_441431.1_2 Reverse -240 -254 11.012 0.149
NP_441431.1_2 Reverse -341 -355 8.3571 0.218
NP_441488.1_8 Reverse -245 -259 17.2068 0.103
NP_440634.1_4 Reverse -242 -261 13.8641 0.257
NP_441993.1_1 Forward -252 -233 0.874656 0.29
NP_442084.1_5 Forward -351 -332 13.2741 0.101
NP_440114.1_10 Reverse -250 -264 7.57108 0.231
NP_442684.1_6 Reverse -350 -369 19.7631 0.225
NP_442323.1_7 Forward -288 -269 7.86512 0.17
NP_440287.1_6 Forward -170 -151 0.884433 0.286
NP_440293.1_3 Reverse -279 -298 -2.95047 0.241
NP_440293.1_3 Reverse -166 -185 -3.54046 0.247
NP_440766.1_4 Reverse -246 -260 13.1759 0.0414
NP_440457.1_1 Reverse -246 -258 8.59377 0.101
NP_442680.1_5 Reverse -85 -104 2.80756 0.237
NP_440473.1_9 Forward -316 -297 -10.1286 0.27
NP_442509.1_9 Reverse -250 -260 11.9759 0.107
NP_440554.1_4 Forward -258 -248 5.97822 0.128
NP_441845.1_6 Reverse -238 -256 2.18243 0.262
NP_441885.1_5 Forward -259 -249 1.25834 0.11
NP_441885.1_5 Reverse -250 -260 0.0783647 0.183
NP_442341.1_3 Reverse -322 -341 3.14605 0.236
NP_442341.1_7 Forward -260 -246 1.37622 0.292
NP_441756.1_5 Forward -263 -244 -4.32711 0.294
NP_442395.2_4 Forward -260 -241 1.08032 0.254
NP_442534.1_8 Reverse -278 -297 16.6174 0.142
NP_440423.1_6 Reverse -242 -261 -11.0136 0.164
NP_443000.1_7 Reverse -248 -258 10.2065 0.0355
NP_440275.1_3 Reverse -248 -258 12.5664 0.0316
NP_441902.1_3 Reverse -330 -340 11.9127 0.283
NP_440679.1_10 Reverse -329 -348 -19.9617 0.283
NP_442495.1_5 Reverse -333 -352 5.70265 0.291
NP_441105.1_3 Forward -26 -7 -6.98204 0.243
NP_441105.1_3 Reverse -163 -182 -9.73531 0.295
NP_440216.1_1 Forward -259 -245 -2.16369 0.0482
NP_440172.1_1 Forward -259 -249 2.24165 0.279
NP_441226.1_7 Reverse -251 -258 12.7234 0.0312
NP_441226.1_7 Forward -258 -251 11.5435 0.0757
NP_441111.1_7 Forward -258 -250 8.86921 0.0589
NP_440244.1_1 Forward -217 -198 -1.86883 0.205
NP_441766.1_2 Forward -259 -250 14.7494 0.00772
NP_441766.1_2 Forward -345 -336 1.76968 0.276
NP_442154.1_1 Forward -329 -311 -15.9105 0.228
NP_442226.1_3 Reverse -158 -177 22.953 0.0227
NP_440261.1_5 Forward -251 -238 -6.17557 0.196
NP_440261.1_5 Forward -258 -245 -12.4687 0.297
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ATCAACTGATAGGAGCTTTTTTTGCTTACCAGTCTGAGTTTGCTTGTACCCATGGCGCCGTCTCTGCCCAAGCGTTGGATTTGGTAGTGGAAGACCCCTATGGGGAGCAGCCCCCCAGCCGTTTTGCCCTGAACCTAGTTCCCCGATCGCCAGTGGCCCGCAGTGGTAACAATATTGACTTAACGTTGCAGGGCTTAAAGGAAATCAGCACCATTGGTGCCCTGGAACAGGACATTTTGGCTGCTTGTTTATAGTTAAAACCAATCAAGCTCTTTCCTCTGTCGGAAAAAACAGACTTTTTCACTTTCATTCCCTGTAGTTGGGATCAATCTGGCGGTGCTCTACGTCCCAAAACCTGTAGGGTGGAATATTGCCACATTGCCAAGGAGTTTGATTTTTC

CDS

ATGGGCATGATTGACTGGGCCATTGTGCTGGTCTATTCGGCGATTGTCATTGCCATTGGGGCGATCGCCAGTCGCAAACAAGATAATACCGATGAATATTTCCGGGGTGCAAAGCAAATTCCCTGGTGGGCCCTAGGTTTTTCCATCATTGCCACCTCTTTTTCCGCCGCTTCTTTGCTGGGGGGCCCGGGGGAGGGTTACGGCCACGGCTTTTTATATTTGCAACTGCAATTGGGAGACTTAATCGGCTATGGCTTAGTCATTGCTGTCTTTTTGCCATTTTTTGTCCGGCTCAATCTCACCACTGCCTACGAATATTTGGAAAGGCGCTTCGATGCCAAAACCCGTTCCCTCGGTTCCCTTTGTTTTCTGCTGTTTGTCATTGCCCGCCTAGGGGGACTTTTATACGCCGCCGCCCTGGTGTTATCGGTGCTAACTGGCATTAGTACGAATACTGCCATTTTGATGGTGGGGGTGGTTTCGATTATTTACACCGTTGCCGGGGGAATCACCGCCGTAGTTTGGACGGACGTGTTGCAATTTGGCATGATTTTCGTCGGTTTGGGGGCGGGCATTTGGGCCGCAGTTACCGCTGTGCCAGGGGGTTTTGGGGAACTGTGGCGCATTGCTGGGGAAAACGGCAAGTTGGTGGTATTTAATTTTGATTGGGATCCCGCTTCCATTCGTTCTCTACCCACAGCGTTGATCGCCTACGGCATTTTAGCTTTTGCGGTGGCGGGGACTAATCAACAGTCAGTCCAGCGTTATGTTTCCTGTGCCGATGAGCAATCAGCCCGCAAAGCCATCTTTCTCGGTTGGTTTTCCGGCGTTTTAGGAGTAGGGGCCACCCTGTTACTAGGGGTTTTGCTATTCAGCTTTTACCAACTCCAGGGAGGGTTACCAGGAAATATCAAACCCGATGAAATCCTTTCCTATTTTATTGTCAACCAAGTCCCCCCTGGGGCATCGGGATTCCTCGTGGCGGCGATTTTTGCGGCGGCCATGTCTTCCATCGATTCTGCTTTGCATTCTTTGGCCACTTGCATGACGGTGGACTTTTACGACCGTTACATAAATATTCAAGCCAGCGAAATGCGCTCAGTCCGGGTGGCCCAGGGGTTAATTATTGTCTGGGGCGTAGTGGCAATTTTTTCCGCTATTTATGCCGCTTCCACCGGGCAGGATCTACTAGAATTCTTGGTGTCCTATACCACCATGTTTTTGGGACCGCTGTTGGGGATTTTTCTGATGGGGGTCTTGTTTCCCCGCATTAATGCTCTGGGTGCTTTTTACGGCACCGTGGCGGCAGTTTTACTGGTAATTATTGCTTCCAATGCCGGTTGGCTTACTTTCCCTGGCATTTGGCGCTCGGCGGTCACTGCTCCCCTGGCTGTTCTGCTAGCTTTAGGGATTTCCCTCTTTGCCAGCGCCCCCACTCCTAAGCATTTACTCGGTTTGACCATTTGGCATCCGGTCACAGATGCTCCGGGCACCAATGTTGTGGCCAGGCCGGGAGCCGATGACCAAGATTTGGGCTAG

Protein

MGMIDWAIVLVYSAIVIAIGAIASRKQDNTDEYFRGAKQIPWWALGFSIIATSFSAASLLGGPGEGYGHGFLYLQLQLGDLIGYGLVIAVFLPFFVRLNLTTAYEYLERRFDAKTRSLGSLCFLLFVIARLGGLLYAAALVLSVLTGISTNTAILMVGVVSIIYTVAGGITAVVWTDVLQFGMIFVGLGAGIWAAVTAVPGGFGELWRIAGENGKLVVFNFDWDPASIRSLPTALIAYGILAFAVAGTNQQSVQRYVSCADEQSARKAIFLGWFSGVLGVGATLLLGVLLFSFYQLQGGLPGNIKPDEILSYFIVNQVPPGASGFLVAAIFAAAMSSIDSALHSLATCMTVDFYDRYINIQASEMRSVRVAQGLIIVWGVVAIFSAIYAASTGQDLLEFLVSYTTMFLGPLLGIFLMGVLFPRINALGAFYGTVAAVLLVIIASNAGWLTFPGIWRSAVTAPLAVLLALGISLFASAPTPKHLLGLTIWHPVTDAPGTNVVARPGADDQDLG