Your browser is old and dusty. Try Google Chrome!

Details for sll1082

ORF sll1082
Accession NP_440613.1
Symbol
Category ABC transport system ATP-binding protein
Definition Transport and binding proteins
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442657.1_1 Forward -146 -129 11.2247 0.245
NP_440295.1_9 Reverse -288 -307 -1.96717 0.194
NP_441453.1_7 Reverse -370 -377 12.9205 0.23
NP_442151.1_6 Reverse -306 -320 9.14437 0.157
NP_442151.1_6 Forward -315 -301 9.04604 0.159
NP_441818.1_9 Forward -237 -218 -0.688862 0.196
NP_442655.1_10 Forward -246 -227 -4.42544 0.22
NP_442655.1_10 Forward -234 -215 -13.5702 0.266
NP_440613.1_1 Forward -236 -217 31.7604 0.0000069
NP_440613.1_2 Forward -380 -361 29.1054 0.000286
NP_440613.1_3 Forward -266 -247 33.0387 0.0000158
NP_440613.1_4 Forward -169 -150 28.2234 0.000729
NP_440613.1_5 Forward -400 -381 33.727 0.000028
NP_440613.1_6 Forward -143 -124 23.7955 0.0312
NP_440613.1_7 Forward -203 -184 24.0905 0.0226
NP_440613.1_8 Forward -287 -268 28.3188 0.00153
NP_440613.1_9 Forward -89 -70 24.8772 0.00843
NP_440613.1_10 Forward -329 -310 20.4523 0.102
NP_441812.1_3 Forward -121 -107 12.3893 0.21
NP_441675.1_1 Forward -234 -215 -7.37537 0.251
NP_440784.1_7 Forward -314 -307 5.84064 0.248
NP_441250.1_3 Reverse -123 -142 1.0811 0.298
NP_439979.1_9 Forward -236 -218 7.00065 0.288
NP_440878.1_4 Forward -183 -165 13.4905 0.266
NP_440878.1_9 Reverse -224 -243 -3.54046 0.299
NP_441802.1_1 Reverse -372 -391 10.5209 0.197
NP_439918.1_2 Forward -255 -236 -3.04881 0.251
NP_439918.1_2 Forward -249 -230 -3.63879 0.258
NP_439918.1_2 Forward -237 -218 -4.13045 0.268
NP_441352.1_2 Forward -235 -216 2.55606 0.222
NP_441208.1_1 Forward -227 -208 1.76941 0.244
NP_441208.1_9 Reverse -303 -317 7.66941 0.22
NP_440132.1_1 Forward -239 -221 11.4255 0.207
NP_441925.1_4 Reverse -224 -243 -6.78612 0.185
NP_441645.1_7 Reverse -230 -244 16.916 0.286
NP_442889.1_8 Reverse -178 -192 4.32555 0.27
NP_442570.1_8 Forward -134 -116 11.5239 0.235
NP_441716.1_1 Forward -315 -301 10.9143 0.0936
NP_441327.1_1 Reverse -7 -26 7.5772 0.232
NP_441327.1_5 Reverse -149 -158 14.651 0.192
NP_441624.1_7 Reverse -201 -215 8.75105 0.235
NP_440343.1_3 Reverse -224 -242 13.1947 0.115
NP_442973.1_5 Forward -224 -205 9.93088 0.287
NP_441486.1_10 Reverse -142 -159 19.0167 0.159
NP_442634.1_4 Reverse -304 -318 0.982901 0.149
NP_442634.1_4 Forward -217 -203 -3.04867 0.16
NP_440470.1_5 Reverse -354 -373 6.2543 0.28
NP_442730.1_8 Reverse -198 -217 4.71854 0.273
NP_442687.1_1 Reverse -45 -58 19.8815 0.178
NP_441846.1_10 Forward -243 -224 -13.4719 0.206
NP_440642.1_10 Forward -156 -142 5.30886 0.241
NP_440667.1_2 Forward -237 -218 -4.32711 0.247
NP_440667.1_2 Forward -261 -242 -5.40875 0.26
NP_440667.1_2 Forward -240 -221 -7.67036 0.283
NP_441950.1_7 Forward -240 -221 -8.06369 0.283
NP_441763.1_5 Reverse -221 -240 -6.29373 0.274
NP_442658.1_1 Forward -217 -207 8.43603 0.194
NP_440141.1_8 Reverse -276 -295 6.29264 0.265
NP_440141.1_8 Forward -240 -221 4.916 0.278
NP_442205.1_9 Reverse -300 -316 -1.71142 0.264
NP_441256.1_1 Reverse -231 -250 -9.34199 0.282
NP_442937.1_5 Forward -248 -229 7.7676 0.241
NP_439905.1_1 Reverse -207 -220 7.88576 0.241
NP_440153.1_8 Reverse -252 -265 -2.53732 0.244
NP_441099.1_5 Forward -283 -264 -10.9153 0.266
NP_442431.1_10 Forward -243 -225 2.18243 0.243
NP_442870.1_4 Forward -144 -130 15.3392 0.289
NP_441916.1_7 Forward -261 -251 3.22496 0.223
NP_440345.1_5 Reverse -9 -23 15.0979 0.272
NP_441041.1_1 Forward -237 -218 9.43923 0.221
NP_441041.1_4 Forward -273 -254 -12.3902 0.265
NP_441041.1_4 Forward -243 -224 -12.6852 0.272
NP_443063.1_2 Reverse -106 -125 4.62101 0.289
NP_441725.1_4 Reverse -122 -136 6.39049 0.277
NP_441076.1_6 Forward -174 -164 17.1874 0.238
NP_441079.1_7 Reverse -17 -36 -5.50783 0.266
NP_442068.1_4 Reverse -207 -226 8.06178 0.23
NP_441644.1_6 Reverse -206 -216 6.66608 0.152
NP_441644.1_6 Reverse -306 -316 4.30615 0.242
NP_443049.1_6 Forward -344 -334 11.9337 0.24
NP_442215.1_2 Forward -224 -208 -7.31629 0.291
NP_442029.1_6 Forward -237 -218 5.60432 0.25
NP_442933.1_6 Forward -42 -23 12.5568 0.287
NP_442926.1_3 Forward -239 -220 2.0644 0.296
NP_440421.1_1 Forward -144 -130 13.4709 0.297
NP_442301.1_2 Reverse -218 -237 11.6017 0.159
NP_441015.1_10 Forward -233 -214 -2.65548 0.18
NP_441015.1_10 Forward -245 -226 -11.0136 0.29
NP_441764.1_1 Reverse -374 -393 7.96426 0.28
NP_442719.1_2 Reverse -164 -182 -10.7979 0.283
NP_441251.1_7 Forward -139 -126 14.3756 0.266
NP_441056.1_1 Forward -273 -254 -7.67036 0.275
NP_440806.1_1 Reverse -152 -170 7.59063 0.273
NP_442227.1_4 Reverse -63 -82 11.0117 0.285
NP_441911.1_7 Forward -55 -36 -10.031 0.201
NP_442718.1_2 Forward -243 -224 -7.27704 0.3
NP_442542.1_9 Forward -222 -208 6.29216 0.243
NP_440558.1_2 Reverse -219 -238 -4.32711 0.244
NP_442789.1_4 Forward -239 -220 0.58944 0.192
NP_440923.1_1 Reverse -9 -27 13.588 0.208
NP_441878.1_6 Reverse -305 -315 1.65166 0.0795
NP_442650.1_2 Reverse -264 -278 4.71948 0.163
NP_441445.1_1 Forward -249 -230 2.3594 0.235
NP_441445.1_1 Forward -270 -251 -0.688862 0.3
NP_442419.1_2 Reverse -217 -236 -2.95047 0.247
NP_440101.1_10 Reverse -213 -232 6.29264 0.197
NP_441458.1_8 Reverse -6 -25 9.78869 0.229
NP_440356.1_1 Reverse -217 -236 16.8132 0.166
NP_441574.1_1 Forward -237 -218 3.73603 0.142
NP_441574.1_1 Forward -261 -242 -7.57203 0.292
NP_442347.1_2 Reverse -265 -274 5.70292 0.226
NP_442347.1_2 Reverse -128 -137 5.70292 0.226
NP_442594.1_8 Forward -252 -233 3.6377 0.279
NP_442594.1_10 Reverse -325 -344 8.94676 0.28
NP_441405.1_1 Forward -315 -305 15.9097 0.284
NP_442998.1_5 Reverse -42 -52 10.2065 0.222
NP_441799.1_4 Reverse -223 -242 -5.50708 0.223
NP_441007.1_10 Forward -398 -385 -0.37404 0.277
NP_440256.1_1 Reverse -203 -222 -6.98204 0.225
NP_442860.1_7 Reverse -34 -52 10.0595 0.283
NP_440997.1_6 Reverse -118 -137 12.6841 0.228
NP_440717.1_3 Forward -312 -298 7.86545 0.279
NP_441464.1_8 Forward -315 -301 10.4227 0.178
NP_442993.1_1 Forward -261 -245 -12.8228 0.281
NP_442993.1_1 Reverse -306 -322 -13.4128 0.291
NP_441750.1_1 Forward -249 -230 3.34271 0.128
NP_441750.1_1 Forward -237 -218 -11.8003 0.3
NP_440327.1_6 Forward -255 -236 2.3594 0.298
NP_440586.1_1 Forward -238 -219 0.982764 0.236
NP_440586.1_1 Forward -241 -222 -3.24547 0.265
NP_440027.1_3 Reverse -206 -224 5.91824 0.232
NP_439937.1_9 Forward -316 -299 -15.6947 0.287
NP_439937.1_9 Reverse -221 -238 -16.1864 0.287
NP_440408.1_10 Forward -234 -215 13.1758 0.167
NP_440271.1_2 Forward -252 -233 1.96607 0.284
NP_441789.1_7 Reverse -218 -237 -2.65624 0.258
NP_442493.1_6 Forward -145 -127 19.9803 0.0685
NP_442384.1_10 Reverse -306 -319 8.77074 0.0608
NP_440699.1_1 Forward -42 -23 2.62561 0.288
NP_440163.1_10 Forward -264 -254 13.648 0.118
NP_442454.1_2 Forward -40 -21 6.63627 0.291
NP_440491.1_1 Reverse -261 -280 9.06107 0.219
NP_440491.1_1 Forward -225 -206 8.67125 0.232
NP_441123.1_8 Forward -136 -117 10.5209 0.251
NP_442807.1_10 Forward -236 -222 17.9942 0.185
NP_442845.1_2 Forward -210 -196 4.42448 0.259
NP_442710.1_6 Forward -25 -6 14.1591 0.204
NP_442315.1_1 Reverse -295 -313 5.82068 0.256
NP_442637.1_3 Forward -211 -192 3.53937 0.202
NP_442578.1_7 Forward -392 -385 9.97054 0.112
NP_440519.1_8 Forward -237 -221 8.71166 0.199
NP_442780.1_3 Forward -27 -8 12.6523 0.185
NP_442780.1_3 Reverse -23 -42 6.54077 0.269
NP_442872.1_1 Reverse -214 -233 -11.0136 0.241
NP_441443.1_10 Forward -355 -337 1.49337 0.276
NP_441664.1_9 Reverse -220 -239 10.4225 0.274
NP_442120.1_10 Forward -261 -242 -6.39206 0.21
NP_440673.1_6 Reverse -262 -281 10.4225 0.289
NP_441052.1_2 Forward -315 -305 2.04498 0.22
NP_441052.1_2 Reverse -306 -316 1.94665 0.221
NP_441004.1_1 Forward -237 -218 -0.688862 0.124
NP_441004.1_1 Forward -255 -236 -12.1936 0.245
NP_441004.1_1 Forward -249 -230 -12.7836 0.251
NP_441004.1_1 Forward -243 -224 -13.8652 0.262
NP_441004.1_2 Forward -242 -223 -1.57384 0.261
NP_439949.1_7 Forward -346 -332 9.93102 0.296
NP_441115.1_4 Reverse -205 -223 9.75313 0.202
NP_440864.1_3 Reverse -231 -250 9.73422 0.297
NP_441396.1_5 Forward -227 -218 8.25953 0.224
NP_441046.1_2 Forward -233 -214 4.32602 0.228
NP_440874.1_2 Reverse -15 -34 14.6893 0.107
NP_440389.1_3 Reverse -204 -223 12.2908 0.268
NP_442843.1_1 Forward -239 -220 -7.67036 0.25
NP_440396.1_8 Reverse -225 -244 17.9932 0.226
NP_441124.1_5 Reverse -168 -178 12.8172 0.215
NP_440431.1_3 Reverse -69 -88 -10.1286 0.271
NP_440588.1_2 Forward -324 -305 7.7676 0.048
NP_440078.1_2 Forward -237 -218 14.7491 0.249
NP_441078.1_4 Reverse -306 -315 -1.96689 0.282
NP_442348.1_2 Forward -232 -223 10.3245 0.27
NP_440707.1_9 Forward -239 -220 5.70265 0.235
NP_442443.1_1 Forward -239 -220 12.7825 0.0832
NP_442443.1_1 Forward -236 -217 7.47261 0.14
NP_441432.1_8 Forward -216 -207 5.3096 0.17
NP_441732.1_2 Reverse -343 -359 -17.1494 0.24
NP_440131.1_2 Forward -268 -249 6.19431 0.279
NP_441945.1_10 Forward -238 -219 15.2408 0.168
NP_442353.1_4 Reverse -207 -226 3.73524 0.21
NP_441072.1_2 Forward -226 -207 5.80098 0.296
NP_442400.1_10 Reverse -381 -394 8.27408 0.279
NP_442489.1_7 Reverse -306 -315 -1.6719 0.235
NP_441659.2_8 Reverse -206 -216 3.42162 0.161
NP_441659.2_8 Reverse -252 -262 1.455 0.24
NP_441800.1_7 Reverse -226 -244 9.85225 0.113
NP_442346.1_5 Reverse -305 -315 9.41981 0.118
NP_442346.1_5 Forward -316 -306 7.35486 0.172
NP_441629.1_3 Reverse -245 -264 -2.65624 0.272
NP_442311.1_5 Forward -246 -227 -0.000545616 0.283
NP_442603.1_7 Reverse -231 -245 6.39049 0.245
NP_442828.1_2 Forward -26 -7 14.7531 0.242
NP_442828.1_7 Forward -235 -216 -4.13045 0.276
NP_441502.1_3 Forward -217 -198 18.6823 0.112
NP_441329.1_4 Forward -26 -8 11.5565 0.251
NP_441895.1_10 Reverse -287 -306 -18.1918 0.282
NP_441112.1_8 Forward -179 -160 4.916 0.232
NP_440788.1_1 Forward -234 -215 -7.86702 0.287
NP_440671.1_1 Reverse -22 -41 6.70529 0.229
NP_442404.1_9 Forward -312 -298 8.16044 0.296
NP_441973.1_6 Reverse -165 -183 15.3744 0.27
NP_442199.1_7 Reverse -130 -149 0.981987 0.28
NP_441813.1_7 Reverse -231 -245 11.602 0.215
NP_440156.1_4 Forward -108 -98 9.12434 0.221
NP_442216.1_4 Reverse -336 -344 8.08217 0.255
NP_441474.1_1 Reverse -217 -236 1.76863 0.247
NP_441848.1_4 Reverse -36 -52 9.26952 0.287
NP_441848.1_7 Reverse -171 -190 -1.08295 0.245
NP_441848.1_7 Reverse -320 -339 -1.77127 0.257
NP_442358.1_9 Forward -222 -203 19.9606 0.115
NP_442039.1_4 Reverse -182 -189 6.13563 0.297
NP_441811.1_4 Reverse -221 -240 -0.0988766 0.295
NP_442829.1_2 Reverse -126 -142 7.85119 0.295
NP_440160.1_2 Reverse -246 -265 -7.76869 0.286
NP_441959.1_8 Reverse -7 -20 8.32366 0.296
NP_442533.1_1 Forward -249 -230 -13.0786 0.236
NP_442533.1_6 Forward -315 -306 5.11294 0.155
NP_442533.1_6 Reverse -306 -315 3.83464 0.202
NP_442533.1_6 Forward -261 -252 2.16301 0.27
NP_442232.1_9 Reverse -370 -389 11.5033 0.3
NP_441697.1_5 Reverse -17 -36 -8.16498 0.256
NP_441697.1_5 Forward -36 -17 -10.0748 0.278
NP_442202.1_4 Reverse -220 -234 13.0292 0.266
NP_440007.1_9 Reverse -260 -274 6.88276 0.216
NP_440007.1_9 Reverse -249 -263 3.44117 0.269
NP_441106.1_1 Forward -216 -207 2.26134 0.293
NP_441479.1_1 Forward -236 -217 6.4893 0.295
NP_440886.1_7 Reverse -230 -240 6.56775 0.118
NP_440083.1_4 Forward -170 -151 9.42666 0.28
NP_442072.1_9 Forward -223 -205 -22.7936 0.259
NP_440028.1_6 Forward -242 -224 10.8356 0.277
NP_441808.1_8 Forward -234 -215 15.9291 0.152
NP_442022.1_4 Forward -234 -215 9.53756 0.245
NP_441463.1_3 Reverse -221 -240 -10.1286 0.289
NP_442805.1_5 Reverse -224 -243 -2.8529 0.262
NP_440467.1_3 Forward -214 -195 10.7679 0.296
NP_442090.1_2 Forward -49 -30 6.73176 0.281
NP_442930.1_1 Forward -301 -291 10.6976 0.276
NP_442341.1_9 Forward -264 -250 12.2903 0.108
NP_440191.1_5 Forward -78 -59 15.7324 0.27
NP_440191.1_6 Reverse -9 -23 13.285 0.294
NP_440423.1_3 Forward -146 -127 11.1109 0.27
NP_443000.1_7 Forward -317 -307 1.94665 0.226
NP_440679.1_10 Forward -238 -219 -11.0136 0.182
NP_442638.1_3 Forward -186 -167 15.708 0.244
NP_441635.1_1 Forward -65 -46 7.78217 0.236
NP_442373.1_2 Forward -240 -221 2.55606 0.162
NP_442373.1_2 Forward -252 -233 -4.22878 0.205
NP_440216.1_1 Reverse -206 -220 -11.9968 0.236
NP_440216.1_9 Reverse -113 -122 13.9627 0.184
NP_440172.1_1 Forward -215 -205 4.3066 0.194
NP_440172.1_1 Reverse -306 -316 2.14332 0.283
NP_440249.1_2 Forward -184 -174 14.3359 0.284
NP_442015.1_10 Forward -277 -264 4.93583 0.156
NP_443052.1_9 Reverse -218 -237 5.01433 0.149
NP_443052.1_9 Reverse -221 -240 1.0811 0.186
NP_443052.1_9 Reverse -224 -243 -2.45882 0.238
NP_442116.1_6 Forward -33 -16 7.596 0.254
NP_442116.1_6 Reverse -368 -385 6.35461 0.28
NP_442154.1_1 Forward -239 -221 -12.6655 0.217
NP_442154.1_1 Forward -248 -230 -13.1572 0.217
NP_442154.1_1 Forward -242 -224 -13.9439 0.217
NP_442154.1_1 Forward -233 -215 -14.0422 0.217
NP_442154.1_1 Forward -251 -233 -19.3521 0.298
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTATGGATGCGGTCAAATTTATTCCCAAGGAATTAATTGAAGTTACCTATACCCTAGGGGGATTAAGGAAACAGATTTTGTTTAAGGTCATCACCCCCTACATTATTCCCAATATTCTTGACGCCTTTCGGATCAACATGGCGGCGGCTTGGAACTTGGTAGTGGTGGCGGAATTGGTGGCGGCAGACAATGGCTTAGGGAAGCGTATTTTGCTAGCTCAGAAATTTTTGAAAACCGATGAGATTTTTGCTTGCTTAATTGTTTTGGGATTAATTGGCTTTGCGTTGGATTTATCATTTCGCCTCATCCTCAGATTCACTTGTAAATGGTCTTTGGAACAATAAGTCAGATTTTTTCCATCATTACAAAACTATTAAATTAATTGTAAATAATAAAAACC

CDS

ATGCATCTAGAAATAACTGATTTAAATCGGGTGTTTGTCGGCAAACGGGGGTCAGTGGTAGCTCTAAAAAACATCAATATGCACATTGAAACCGGGGAATTTGTGTGTGCAGTGGGGGCTTCTGGTTCCGGAAAATCGACCCTTTTGAGGTTAATTGCTGGTTTGGATACTCCGACTTCCGGCACCATTAATGTGGATGGACAAAGGGTGACGGGACCAGGGGCTGACCGGGGTATGGTTTTCCAACATTACAGTCTTTTTCCCTGGATGACTGTGCGGCAAAATGTAGAATTTGGTCTCAAACTCCAAGGTTGCTCCCAAAAGGAACGCTTTGACACCGCTAGTTATTATCTGGACGTGGTGGGGCTAATTAATTTTTCTGAAGCTTATCCCAGGGAATTGTCCGGTGGCATGAAACAACGGGTGGCGATCGCCAGGTCTTTGGCTTGCCATCCAAAAGTCTTATTAATGGATGAACCCTTTGGCGCTTTAGATATTCAAACCAAGGAAAGGATGCATGAATATCTGATTGATATTTGGCAAAGACTGCAATGTAGCATTTTGATGATTACCCATGACGTGGAGGAAGCCGTATTTCTGGCCCAACGGGTTTATGTGTTGAGTTCCCGTCCCGGCACTATTCAGCGGGAATTAACCATTAATCTGCCGGGGGATGAAGAAACTCCGAAAAATCGGACCTATAAAATTAAGCGGGAACCAGAGTTTTTTAAATATAGCGATGAAATTTCTAGCCTATTGAGGGGTAGGGAAACGGAAGAAACGGAGGCGATCGCTAGCTAA

Protein

MHLEITDLNRVFVGKRGSVVALKNINMHIETGEFVCAVGASGSGKSTLLRLIAGLDTPTSGTINVDGQRVTGPGADRGMVFQHYSLFPWMTVRQNVEFGLKLQGCSQKERFDTASYYLDVVGLINFSEAYPRELSGGMKQRVAIARSLACHPKVLLMDEPFGALDIQTKERMHEYLIDIWQRLQCSILMITHDVEEAVFLAQRVYVLSSRPGTIQRELTINLPGDEETPKNRTYKIKREPEFFKYSDEISSLLRGRETEETEAIAS