Your browser is old and dusty. Try Google Chrome!

Details for sll1072

ORF sll1072
Accession NP_440628.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440557.1_1 Forward -160 -141 -1.67217 0.276
NP_440795.1_7 Forward -373 -366 11.7405 0.0778
NP_442291.1_5 Reverse -364 -380 -4.75968 0.283
NP_441453.1_4 Reverse -219 -227 6.80426 0.121
NP_441453.1_4 Forward -228 -220 6.11594 0.121
NP_441453.1_4 Reverse -365 -373 4.64098 0.257
NP_441453.1_7 Reverse -294 -301 14.1988 0.175
NP_441453.1_8 Reverse -151 -168 6.92201 0.281
NP_441453.1_10 Forward -362 -343 13.3725 0.197
NP_442151.1_6 Forward -161 -147 9.83269 0.139
NP_440226.1_1 Forward -228 -209 1.67108 0.295
NP_442655.1_1 Forward -93 -74 6.29264 0.144
NP_442173.1_1 Forward -227 -219 12.0158 0.0316
NP_442173.1_1 Reverse -220 -228 4.83764 0.241
NP_442752.1_4 Reverse -219 -226 13.8055 0.0199
NP_442752.1_4 Forward -258 -251 5.44732 0.202
NP_442752.1_4 Reverse -22 -29 5.44732 0.202
NP_442975.1_10 Reverse -284 -298 3.04726 0.263
NP_440784.1_7 Reverse -220 -227 6.23397 0.241
NP_440784.1_7 Forward -227 -220 6.13563 0.241
NP_441934.1_5 Reverse -144 -163 13.2741 0.259
NP_440061.1_9 Reverse -150 -164 7.76712 0.194
NP_440061.1_9 Reverse -190 -204 6.78381 0.232
NP_440061.1_9 Reverse -247 -261 5.99717 0.264
NP_440061.1_9 Forward -310 -296 5.80051 0.272
NP_441145.1_7 Forward -350 -331 1.47442 0.282
NP_442062.1_8 Forward -236 -226 2.83163 0.293
NP_441900.1_2 Forward -138 -120 -1.06322 0.27
NP_440304.1_4 Reverse -150 -160 6.56821 0.15
NP_439918.1_2 Forward -256 -237 2.0644 0.207
NP_439918.1_2 Forward -160 -141 -4.72043 0.283
NP_441935.1_1 Forward -170 -151 7.66927 0.24
NP_441208.1_9 Reverse -373 -387 4.62115 0.297
NP_442896.1_6 Forward -122 -103 20.8456 0.161
NP_441925.1_4 Reverse -306 -325 -6.78612 0.185
NP_440856.1_4 Forward -369 -350 -1.7705 0.203
NP_441083.1_5 Forward -228 -218 8.82982 0.03
NP_441083.1_5 Reverse -219 -229 -0.904945 0.283
NP_441434.1_7 Forward -226 -212 11.406 0.13
NP_441738.1_2 Forward -226 -219 15.28 0.0102
NP_441738.1_2 Reverse -251 -258 10.2652 0.101
NP_441738.1_2 Forward -29 -22 10.2652 0.101
NP_441738.1_2 Forward -233 -226 6.72528 0.236
NP_440209.1_1 Reverse -219 -227 8.57422 0.0425
NP_440209.1_1 Forward -228 -220 5.52596 0.0821
NP_440447.1_5 Reverse -293 -303 14.1397 0.277
NP_441792.1_5 Reverse -74 -90 8.71166 0.258
NP_442111.1_4 Forward -375 -361 4.32615 0.212
NP_440906.1_5 Reverse -366 -373 9.47889 0.116
NP_440906.1_5 Reverse -220 -227 6.23397 0.234
NP_440906.1_5 Forward -227 -220 6.13563 0.241
NP_440012.1_6 Forward -160 -141 6.39097 0.299
NP_440747.1_10 Reverse -76 -88 -11.8591 0.161
NP_440747.1_10 Forward -377 -365 -12.5474 0.297
NP_441130.1_10 Forward -141 -127 11.0127 0.107
NP_441486.1_1 Reverse -216 -230 -4.81863 0.209
NP_441486.1_1 Forward -231 -217 -5.9986 0.272
NP_442330.1_4 Reverse -125 -144 16.0196 0.233
NP_440842.1_10 Reverse -232 -246 1.76955 0.281
NP_440057.1_9 Reverse -92 -111 14.8474 0.188
NP_441014.1_10 Forward -276 -257 -0.29631 0.249
NP_441012.1_4 Reverse -148 -161 6.1158 0.286
NP_443018.1_3 Forward -227 -220 11.7405 0.0655
NP_443018.1_3 Reverse -193 -200 7.6106 0.156
NP_443018.1_3 Reverse -220 -227 5.44732 0.193
NP_441634.1_8 Reverse -68 -82 -3.63866 0.295
NP_441634.1_8 Reverse -225 -239 -4.52363 0.295
NP_440376.1_1 Reverse -219 -228 5.99792 0.111
NP_440376.1_1 Forward -88 -79 5.89959 0.116
NP_440376.1_1 Reverse -227 -236 3.93297 0.188
NP_440376.1_1 Reverse -226 -235 0.491382 0.273
NP_440376.1_1 Forward -228 -219 -0.196935 0.285
NP_441588.1_4 Forward -226 -216 14.238 0.0773
NP_442687.1_7 Reverse -364 -374 10.7964 0.0994
NP_442687.1_7 Reverse -218 -228 4.50326 0.245
NP_442583.1_1 Reverse -19 -38 10.9142 0.298
NP_442583.1_8 Reverse -354 -373 8.16093 0.266
NP_440667.1_2 Forward -262 -243 -0.885524 0.228
NP_441950.1_7 Reverse -119 -138 -9.44032 0.297
NP_442658.1_1 Reverse -234 -244 6.76441 0.214
NP_442658.1_1 Reverse -217 -227 6.17443 0.235
NP_442496.1_5 Reverse -44 -62 8.18062 0.256
NP_441414.1_9 Reverse -219 -238 4.42435 0.0543
NP_442937.1_5 Reverse -214 -233 11.0125 0.148
NP_442937.1_5 Reverse -360 -379 8.25926 0.229
NP_441958.1_5 Reverse -218 -228 0.865012 0.12
NP_441127.1_1 Reverse -233 -247 8.25939 0.3
NP_441127.1_1 Reverse -131 -145 7.86607 0.3
NP_442836.1_10 Reverse -220 -230 10.6981 0.269
NP_440203.1_5 Reverse -195 -205 9.91099 0.245
NP_442025.1_7 Forward -258 -240 14.3187 0.276
NP_440984.1_7 Forward -233 -219 6.58777 0.209
NP_439990.1_5 Forward -333 -320 8.37742 0.174
NP_440369.1_5 Forward -275 -256 8.55425 0.281
NP_442064.1_4 Forward -159 -140 6.98015 0.246
NP_443055.1_6 Forward -236 -218 11.6214 0.114
NP_443055.1_6 Reverse -219 -237 5.42659 0.179
NP_440993.1_2 Forward -367 -351 1.63183 0.279
NP_442210.1_9 Forward -165 -147 11.0322 0.23
NP_440138.1_6 Reverse -237 -256 10.9134 0.153
NP_442002.1_1 Forward -267 -249 -8.83064 0.272
NP_442002.1_9 Reverse -218 -225 10.7572 0.185
NP_442002.1_9 Reverse -332 -339 9.77388 0.258
NP_442431.1_10 Reverse -122 -140 3.26407 0.22
NP_441000.1_6 Forward -229 -215 3.8345 0.104
NP_441110.1_10 Reverse -285 -304 13.6675 0.219
NP_440147.1_4 Forward -376 -363 0.805932 0.244
NP_440147.1_4 Reverse -217 -230 0.314277 0.257
NP_440147.1_4 Forward -90 -77 -0.570702 0.291
NP_441550.1_8 Reverse -217 -227 7.0594 0.178
NP_441041.1_4 Forward -374 -355 -10.522 0.233
NP_441041.1_4 Reverse -140 -159 -10.9153 0.238
NP_441041.1_7 Reverse -216 -228 4.98816 0.282
NP_442396.1_5 Reverse -18 -31 8.57408 0.153
NP_441725.1_4 Reverse -86 -100 2.06395 0.297
NP_441725.1_4 Reverse -74 -88 1.96562 0.3
NP_439966.1_7 Forward -230 -220 9.616 0.106
NP_439966.1_9 Reverse -217 -226 0.884706 0.253
NP_440202.1_8 Reverse -153 -172 10.0008 0.297
NP_440983.1_5 Reverse -140 -159 -6.68705 0.278
NP_441554.1_4 Reverse -101 -115 15.0784 0.22
NP_440260.1_8 Forward -260 -242 -5.58572 0.275
NP_442281.1_1 Forward -233 -219 2.06395 0.278
NP_442281.1_1 Reverse -244 -258 1.96562 0.282
NP_442281.1_1 Reverse -147 -161 1.86729 0.285
NP_441334.1_7 Forward -188 -169 -11.5053 0.122
NP_440647.1_9 Reverse -217 -235 12.0155 0.147
NP_440498.1_1 Forward -237 -219 3.46073 0.149
NP_442982.1_5 Reverse -142 -161 3.6377 0.206
NP_442982.1_5 Reverse -239 -258 3.04771 0.212
NP_441644.1_6 Reverse -192 -202 9.02601 0.0872
NP_441644.1_6 Forward -228 -218 7.15773 0.133
NP_441644.1_6 Forward -161 -151 3.51951 0.277
NP_441644.1_6 Reverse -382 -392 3.12618 0.297
NP_441644.1_6 Reverse -152 -162 3.12618 0.297
NP_443049.1_6 Reverse -218 -228 11.6409 0.24
NP_442215.1_2 Forward -163 -147 5.17175 0.0796
NP_442215.1_2 Reverse -137 -153 -0.531451 0.168
NP_442215.1_2 Forward -311 -295 -7.21796 0.289
NP_442029.1_1 Forward -203 -184 -19.4701 0.29
NP_442029.1_6 Forward -212 -193 5.50599 0.25
NP_440253.1_2 Reverse -365 -383 0.21581 0.192
NP_440929.1_8 Forward -228 -219 7.07956 0.0713
NP_442933.1_10 Reverse -365 -374 4.32629 0.257
NP_442926.1_3 Reverse -193 -212 6.39097 0.208
NP_442926.1_5 Reverse -214 -233 9.78484 0.267
NP_442554.1_8 Forward -227 -217 3.42162 0.226
NP_441762.1_7 Reverse -218 -230 11.642 0.0142
NP_441762.1_7 Forward -229 -217 2.0056 0.0705
NP_441762.1_7 Forward -375 -363 -7.63084 0.296
NP_442142.1_4 Forward -128 -115 6.21356 0.17
NP_442292.1_1 Forward -227 -218 -0.196935 0.239
NP_440122.1_2 Reverse -71 -90 1.17943 0.259
NP_440895.1_10 Forward -229 -212 3.38209 0.149
NP_442381.1_8 Forward -239 -220 3.53937 0.0717
NP_442381.1_8 Reverse -216 -235 -12.6852 0.267
NP_443009.1_5 Reverse -226 -237 8.12131 0.117
NP_443009.1_5 Forward -162 -151 4.8764 0.226
NP_440015.1_9 Reverse -249 -267 -1.94747 0.298
NP_441468.1_1 Reverse -220 -227 6.13563 0.209
NP_441468.1_1 Forward -227 -220 6.0373 0.223
NP_441020.2_6 Reverse -217 -234 10.5603 0.141
NP_441673.1_1 Reverse -219 -228 1.37636 0.114
NP_441673.1_1 Forward -228 -219 1.1797 0.163
NP_441876.1_9 Forward -144 -134 11.7793 0.273
NP_441330.1_1 Forward -379 -360 3.14605 0.0672
NP_441330.1_1 Forward -233 -214 -11.8003 0.183
NP_441637.1_9 Reverse -375 -393 -3.91409 0.296
NP_442719.1_2 Forward -117 -99 -3.22649 0.2
NP_442719.1_2 Reverse -152 -170 -7.65136 0.238
NP_442719.1_2 Forward -244 -226 -11.3879 0.291
NP_440051.1_5 Reverse -367 -381 13.478 0.294
NP_443058.1_7 Reverse -191 -210 1.57275 0.299
NP_442808.1_1 Forward -229 -219 19.449 0.00201
NP_442808.1_1 Forward -237 -227 4.01116 0.212
NP_442808.1_1 Reverse -234 -244 1.74956 0.281
NP_440145.1_3 Reverse -69 -88 -0.688862 0.143
NP_441906.1_2 Forward -387 -368 0.883656 0.295
NP_442820.1_3 Forward -50 -40 13.6475 0.277
NP_442050.1_5 Reverse -247 -257 7.74772 0.243
NP_441114.1_3 Reverse -153 -162 7.66954 0.231
NP_440558.1_2 Reverse -136 -155 -0.197208 0.198
NP_440558.1_2 Forward -164 -145 -7.17871 0.289
NP_442789.1_5 Reverse -120 -139 1.67108 0.29
NP_441878.1_6 Reverse -226 -236 2.33998 0.0405
NP_441878.1_6 Forward -89 -79 -6.11649 0.191
NP_441878.1_6 Reverse -151 -161 -7.39479 0.222
NP_441036.1_8 Reverse -218 -228 6.8632 0.213
NP_441036.1_8 Forward -229 -219 6.07655 0.242
NP_441557.1_5 Reverse -219 -228 1.08137 0.0794
NP_441557.1_5 Forward -228 -219 0.589713 0.134
NP_441557.1_5 Reverse -365 -374 -0.885252 0.26
NP_441445.1_1 Reverse -210 -229 3.14605 0.218
NP_441590.1_6 Reverse -182 -201 11.405 0.297
NP_442066.2_9 Forward -240 -227 7.19745 0.243
NP_441433.1_8 Reverse -87 -106 -4.6221 0.294
NP_442419.1_2 Forward -233 -214 -2.36049 0.247
NP_442347.1_2 Forward -227 -218 8.94785 0.0718
NP_442645.1_2 Forward -382 -363 -11.8003 0.144
NP_442888.1_6 Reverse -182 -201 2.55606 0.252
NP_441633.1_3 Forward -150 -137 -2.04567 0.171
NP_441633.1_3 Forward -230 -217 -6.47056 0.253
NP_441633.1_3 Reverse -225 -238 -6.66722 0.265
NP_440136.1_2 Reverse -220 -227 6.23397 0.171
NP_440136.1_2 Forward -227 -220 6.13563 0.193
NP_442590.1_10 Forward -167 -148 4.62101 0.273
NP_442998.1_10 Forward -226 -219 15.5754 0.0102
NP_440299.1_1 Reverse -361 -374 7.98351 0.1
NP_441799.1_1 Forward -232 -218 7.86545 0.13
NP_441799.1_4 Reverse -131 -150 -5.40875 0.219
NP_440256.1_1 Forward -164 -145 3.24438 0.0553
NP_441559.1_2 Forward -102 -83 19.8623 0.109
NP_441559.1_4 Forward -151 -132 21.0423 0.00985
NP_441559.1_6 Forward -209 -190 17.7974 0.0543
NP_441559.1_7 Forward -172 -153 8.94757 0.0433
NP_441559.1_8 Forward -240 -226 -2.85201 0.195
NP_441559.1_8 Reverse -157 -171 -3.83532 0.211
NP_441296.1_2 Forward -253 -234 18.0924 0.12
NP_441296.1_8 Forward -154 -135 14.2574 0.258
NP_441866.1_4 Forward -250 -237 14.023 0.273
NP_442866.1_1 Forward -166 -147 -5.40875 0.24
NP_442866.1_6 Reverse -217 -236 6.58763 0.267
NP_440748.1_5 Reverse -82 -101 4.22769 0.201
NP_442993.1_1 Forward -201 -185 -9.97122 0.201
NP_442386.1_9 Forward -229 -220 13.8639 0.0289
NP_442386.1_9 Reverse -235 -244 7.07914 0.219
NP_442386.1_9 Reverse -218 -227 5.9975 0.23
NP_442386.1_10 Forward -314 -301 4.24752 0.265
NP_441340.1_5 Reverse -220 -227 13.5105 0.0314
NP_441340.1_5 Forward -227 -220 5.84064 0.208
NP_443028.1_4 Forward -33 -14 7.48206 0.293
NP_440168.1_4 Reverse -135 -154 -6.29373 0.26
NP_440168.1_8 Forward -368 -349 6.98095 0.187
NP_440168.1_9 Reverse -225 -244 1.0811 0.251
NP_440168.1_9 Forward -150 -131 0.687771 0.259
NP_440327.1_6 Forward -160 -141 3.14605 0.285
NP_440327.1_6 Forward -212 -193 2.65439 0.292
NP_441254.1_1 Forward -34 -21 10.8351 0.295
NP_442506.1_9 Forward -256 -237 5.50599 0.289
NP_440586.1_1 Reverse -121 -140 -4.52377 0.278
NP_440586.1_8 Forward -227 -220 9.47853 0.146
NP_440586.1_8 Reverse -220 -227 5.74197 0.283
NP_441262.1_3 Reverse -219 -226 14.7888 0.0223
NP_443051.1_1 Reverse -218 -227 7.47288 0.0571
NP_441232.1_10 Reverse -354 -373 2.0644 0.259
NP_439937.1_9 Reverse -191 -208 -1.43681 0.124
NP_440398.1_2 Reverse -116 -135 5.70265 0.231
NP_440372.1_2 Reverse -220 -227 13.8055 0.0214
NP_440372.1_2 Forward -227 -220 6.52896 0.188
NP_440171.1_3 Reverse -125 -144 6.78429 0.259
NP_440316.1_10 Reverse -218 -228 11.1898 0.214
NP_441803.1_2 Reverse -131 -150 1.37609 0.232
NP_439977.1_7 Forward -385 -366 11.6017 0.262
NP_440139.1_1 Reverse -213 -232 0.588665 0.287
NP_440267.1_2 Reverse -244 -258 6.68548 0.226
NP_442384.1_10 Reverse -152 -165 5.52582 0.127
NP_442384.1_10 Forward -374 -361 2.47756 0.224
NP_442384.1_10 Forward -31 -18 1.10092 0.268
NP_441980.1_8 Reverse -173 -192 13.6675 0.227
NP_441604.1_9 Forward -166 -147 14.6508 0.193
NP_441877.1_7 Forward -379 -360 1.47364 0.242
NP_441018.1_7 Forward -165 -146 7.37428 0.272
NP_442790.1_4 Forward -170 -151 -11.8003 0.235
NP_442790.1_4 Reverse -210 -229 -12.0953 0.241
NP_442262.1_10 Forward -227 -220 13.2155 0.0213
NP_442262.1_10 Reverse -193 -200 8.8889 0.219
NP_441689.1_5 Reverse -247 -257 12.1726 0.132
NP_442244.1_6 Forward -315 -296 0.294447 0.291
NP_440344.1_10 Reverse -212 -229 -12.3509 0.25
NP_441060.1_1 Forward -170 -151 13.2525 0.294
NP_442280.1_10 Forward -312 -294 12.4673 0.178
NP_441592.1_4 Forward -236 -217 -3.93378 0.292
NP_441896.1_3 Reverse -121 -140 0.786102 0.224
NP_440894.1_10 Reverse -274 -293 6.68596 0.213
NP_440894.1_10 Forward -240 -221 2.16274 0.294
NP_440888.1_2 Forward -161 -147 13.7653 0.0246
NP_440888.1_2 Reverse -192 -206 10.5204 0.0919
NP_442892.1_9 Forward -156 -142 16.5185 0.243
NP_440792.1_5 Reverse -220 -239 5.70265 0.246
NP_440052.1_5 Reverse -208 -227 0.196116 0.175
NP_442033.1_10 Forward -238 -219 -12.2919 0.267
NP_441759.1_6 Reverse -350 -369 10.6192 0.237
NP_441543.1_2 Forward -373 -364 13.8644 0.021
NP_441543.1_2 Forward -227 -218 8.65285 0.0968
NP_442845.1_2 Reverse -213 -227 5.30946 0.237
NP_442845.1_2 Forward -207 -193 3.63784 0.282
NP_441469.1_8 Reverse -218 -227 6.39124 0.227
NP_441469.1_8 Forward -229 -220 5.60459 0.258
NP_441469.1_8 Forward -237 -228 5.3096 0.277
NP_442578.1_7 Reverse -220 -227 6.0373 0.18
NP_441462.1_2 Reverse -219 -229 7.55152 0.0543
NP_441601.1_4 Forward -141 -122 -3.24547 0.293
NP_440516.1_8 Reverse -219 -228 18.9776 0.00442
NP_440516.1_8 Forward -228 -219 5.01461 0.118
NP_441033.1_2 Forward -238 -219 11.3075 0.0464
NP_441033.1_2 Reverse -278 -297 -5.21209 0.293
NP_442428.1_5 Reverse -220 -227 6.13563 0.209
NP_442428.1_5 Forward -227 -220 6.0373 0.212
NP_442428.1_5 Reverse -366 -373 3.77569 0.277
NP_441353.1_8 Forward -246 -227 17.5864 0.245
NP_440673.1_3 Forward -226 -219 12.4288 0.0426
NP_440673.1_3 Reverse -194 -201 8.98723 0.203
NP_440673.1_3 Forward -159 -152 6.72562 0.277
NP_441052.1_2 Reverse -152 -162 4.3066 0.161
NP_441052.1_2 Forward -228 -218 1.25834 0.249
NP_442219.1_9 Reverse -366 -375 5.50626 0.153
NP_440436.1_4 Forward -227 -218 8.55409 0.0997
NP_440436.1_4 Forward -235 -226 6.78414 0.147
NP_440041.1_6 Forward -147 -128 8.35677 0.295
NP_441719.1_4 Reverse -220 -227 6.82395 0.0855
NP_441719.1_4 Forward -227 -220 6.52896 0.188
NP_441733.1_10 Reverse -216 -229 8.08242 0.143
NP_441004.1_1 Forward -154 -135 -4.52377 0.171
NP_441004.1_1 Forward -340 -321 -13.0786 0.253
NP_441004.1_1 Reverse -221 -240 -18.1918 0.298
NP_441004.1_9 Reverse -172 -190 12.0888 0.257
NP_442366.1_5 Reverse -216 -226 13.3526 0.0775
NP_442206.1_1 Forward -236 -217 -10.1286 0.219
NP_442312.1_1 Forward -287 -268 9.53756 0.297
NP_443054.1_2 Reverse -225 -239 10.6193 0.0761
NP_443054.1_2 Forward -237 -223 8.55439 0.117
NP_443054.1_2 Reverse -77 -91 4.71948 0.24
NP_441851.1_10 Forward -259 -249 11.7798 0.0631
NP_441851.1_10 Reverse -226 -236 4.99491 0.233
NP_441851.1_10 Reverse -21 -31 4.3066 0.277
NP_441542.1_4 Forward -397 -383 3.24451 0.289
NP_442515.1_1 Reverse -151 -165 -0.787057 0.235
NP_441396.1_5 Forward -265 -256 7.37455 0.279
NP_440593.1_3 Forward -138 -119 -7.27704 0.291
NP_440593.1_3 Reverse -68 -87 -7.4737 0.295
NP_442314.1_1 Reverse -216 -234 0.707465 0.231
NP_442843.1_1 Reverse -204 -223 -9.53865 0.266
NP_440396.1_10 Reverse -153 -169 10.7759 0.219
NP_440431.1_3 Reverse -78 -97 -9.63698 0.252
NP_440943.1_5 Forward -163 -149 12.586 0.253
NP_442006.1_2 Forward -303 -286 3.18543 0.0846
NP_441570.1_1 Forward -275 -257 -12.4689 0.214
NP_441570.1_1 Forward -328 -310 -15.0255 0.227
NP_440078.1_4 Reverse -208 -227 17.699 0.133
NP_441078.1_4 Reverse -79 -88 6.09625 0.0863
NP_441078.1_4 Forward -88 -79 5.99792 0.0932
NP_441078.1_4 Reverse -219 -228 0.196389 0.205
NP_441078.1_4 Forward -228 -219 -0.000272808 0.205
NP_441078.1_4 Forward -374 -365 -1.18024 0.237
NP_441078.1_4 Reverse -152 -161 -1.37691 0.254
NP_441078.1_4 Reverse -227 -236 -1.57357 0.266
NP_441078.1_4 Forward -236 -227 -1.57357 0.266
NP_442348.1_2 Reverse -22 -31 15.7327 0.119
NP_442348.1_2 Forward -258 -249 6.98123 0.293
NP_442443.1_1 Reverse -220 -239 7.07928 0.144
NP_442443.1_4 Forward -388 -378 16.9908 0.14
NP_442443.1_4 Reverse -105 -115 15.1225 0.179
NP_442443.1_4 Reverse -239 -249 14.8275 0.202
NP_441432.1_8 Forward -202 -193 12.2911 0.0444
NP_441432.1_8 Reverse -151 -160 11.9961 0.0519
NP_441432.1_8 Reverse -218 -227 5.50626 0.151
NP_441432.1_8 Forward -375 -366 2.75299 0.287
NP_442320.1_8 Reverse -213 -227 6.98109 0.0223
NP_442344.1_7 Reverse -220 -239 2.45773 0.0638
NP_442344.1_7 Forward -373 -354 -8.26035 0.209
NP_440497.1_7 Reverse -212 -231 16.7157 0.142
NP_440760.1_1 Reverse -365 -384 -22.9117 0.274
NP_442353.1_4 Reverse -146 -165 4.12856 0.206
NP_442968.1_8 Forward -312 -293 11.7992 0.282
NP_442010.1_1 Reverse -374 -392 11.7197 0.241
NP_440713.1_4 Forward -211 -192 7.96426 0.174
NP_442489.1_7 Forward -228 -219 0.688044 0.152
NP_442489.1_7 Reverse -219 -228 0.688044 0.152
NP_442489.1_7 Reverse -227 -236 -1.57357 0.213
NP_442489.1_7 Reverse -152 -161 -1.57357 0.213
NP_442489.1_7 Forward -236 -227 -2.06522 0.288
NP_442489.1_7 Forward -161 -152 -2.06522 0.288
NP_441659.2_8 Reverse -192 -202 0.865012 0.256
NP_440426.1_7 Reverse -231 -250 -0.4922 0.297
NP_441040.1_2 Forward -156 -137 -6.29373 0.181
NP_439956.1_7 Forward -166 -147 4.42435 0.257
NP_442776.1_1 Reverse -140 -159 9.24257 0.181
NP_442346.1_5 Reverse -151 -161 9.41981 0.118
NP_442346.1_5 Forward -375 -365 7.45319 0.169
NP_442346.1_5 Reverse -226 -236 4.79825 0.272
NP_440831.1_3 Forward -237 -218 7.8433 0.24
NP_440831.1_3 Reverse -210 -229 5.02806 0.29
NP_440010.1_10 Forward -86 -67 6.68596 0.226
NP_440010.1_10 Forward -145 -126 1.86774 0.292
NP_440847.1_3 Reverse -250 -264 12.192 0.254
NP_442603.1_7 Reverse -32 -46 6.39049 0.245
NP_441050.1_5 Forward -261 -243 0.707465 0.234
NP_441833.1_4 Forward -227 -220 6.52896 0.0924
NP_441833.1_4 Reverse -220 -227 6.23397 0.163
NP_442162.1_9 Forward -227 -220 12.9205 0.0282
NP_442162.1_9 Reverse -220 -227 12.9205 0.0282
NP_442140.1_3 Forward -227 -217 14.1397 0.0501
NP_442140.1_3 Reverse -220 -230 8.73149 0.119
NP_440875.1_9 Reverse -355 -365 8.95605 0.233
NP_441813.1_5 Forward -230 -220 6.76487 0.0792
NP_441813.1_5 Reverse -217 -227 0.176696 0.215
NP_441813.1_7 Forward -134 -120 7.96378 0.298
NP_442089.1_1 Reverse -216 -235 1.47442 0.237
NP_440590.1_4 Forward -227 -214 -1.16069 0.212
NP_440590.1_4 Forward -373 -360 -1.25902 0.215
NP_440590.1_4 Reverse -220 -233 -1.65234 0.225
NP_440567.1_1 Forward -227 -213 -0.393733 0.281
NP_442497.1_10 Forward -227 -218 0.589713 0.153
NP_440821.1_2 Reverse -266 -285 16.1257 0.0896
NP_440821.1_4 Reverse -217 -227 0.471689 0.174
NP_441239.1_9 Forward -230 -218 13.3137 0.037
NP_441239.1_9 Reverse -225 -237 8.9871 0.117
NP_442193.1_1 Forward -275 -257 10.7372 0.228
NP_442629.1_3 Forward -273 -254 0.58944 0.294
NP_442216.1_4 Reverse -163 -171 8.1805 0.255
NP_440949.1_7 Reverse -228 -247 7.96345 0.298
NP_440546.1_4 Reverse -219 -229 14.0213 0.0459
NP_440546.1_4 Forward -228 -218 6.55553 0.291
NP_441656.1_3 Forward -256 -237 13.4708 0.19
NP_440462.1_6 Forward -230 -220 5.09324 0.168
NP_441184.1_9 Reverse -372 -385 17.7189 0.196
NP_442340.1_3 Forward -310 -291 -11.3086 0.299
NP_440868.1_4 Reverse -215 -227 5.84051 0.0879
NP_440868.1_4 Forward -232 -220 0.333971 0.217
NP_442499.1_3 Forward -140 -122 3.75572 0.289
NP_440374.1_1 Forward -263 -244 10.6192 0.292
NP_441474.1_1 Forward -238 -219 2.55527 0.247
NP_442402.1_10 Reverse -165 -175 11.5826 0.246
NP_441848.1_7 Reverse -244 -263 -2.75457 0.27
NP_441084.1_6 Reverse -150 -164 10.5076 0.238
NP_440653.1_10 Reverse -140 -159 8.06259 0.201
NP_442023.1_2 Reverse -144 -163 14.1591 0.143
NP_442023.1_2 Reverse -234 -253 3.93269 0.286
NP_442039.1_4 Reverse -220 -227 11.6422 0.0747
NP_441811.1_4 Reverse -126 -145 -0.0988766 0.295
NP_442837.1_3 Forward -227 -220 6.0373 0.25
NP_442837.1_3 Reverse -220 -227 6.0373 0.25
NP_442053.1_1 Forward -228 -219 14.4544 0.0114
NP_442053.1_1 Reverse -219 -228 7.86621 0.0863
NP_440505.1_3 Reverse -217 -227 5.19158 0.241
NP_440505.1_3 Forward -203 -193 4.3066 0.3
NP_441102.1_1 Forward -160 -141 14.0608 0.108
NP_441408.2_7 Reverse -137 -156 2.85105 0.199
NP_440914.1_1 Reverse -152 -162 12.6163 0.0518
NP_440914.1_1 Forward -31 -21 12.226 0.0652
NP_441011.1_8 Reverse -220 -229 11.7994 0.0629
NP_441011.1_8 Forward -227 -218 7.07956 0.179
NP_442533.1_6 Forward -236 -227 7.57121 0.0898
NP_442533.1_6 Reverse -152 -161 5.11294 0.155
NP_442533.1_6 Forward -228 -219 4.42462 0.179
NP_442541.1_10 Forward -236 -222 1.17898 0.29
NP_442269.1_10 Forward -256 -237 10.3242 0.176
NP_441028.1_6 Forward -58 -48 7.35439 0.229
NP_441028.1_6 Reverse -290 -300 6.17443 0.232
NP_440116.1_8 Reverse -220 -239 -2.16383 0.126
NP_441527.1_4 Reverse -101 -120 -8.83343 0.251
NP_440115.1_6 Forward -204 -194 7.15819 0.158
NP_439965.1_1 Reverse -210 -229 -5.50708 0.211
NP_441602.1_3 Forward -154 -135 -2.55715 0.233
NP_441170.1_4 Forward -140 -122 2.18243 0.285
NP_441106.1_1 Reverse -218 -227 8.45619 0.0548
NP_439903.1_6 Forward -164 -145 0.392004 0.264
NP_440797.1_2 Forward -396 -377 17.5372 0.11
NP_440670.1_8 Reverse -219 -228 8.75118 0.0606
NP_440670.1_8 Forward -228 -219 6.19458 0.124
NP_441930.1_2 Reverse -151 -161 11.3864 0.294
NP_440886.1_7 Forward -229 -219 16.4991 0.0104
NP_440886.1_7 Reverse -218 -228 6.86274 0.113
NP_440886.1_7 Forward -237 -227 4.99446 0.205
NP_440083.1_2 Forward -370 -351 4.32602 0.138
NP_442614.1_2 Reverse -226 -240 5.70279 0.298
NP_442382.1_9 Forward -153 -134 17.7965 0.239
NP_442401.1_4 Forward -88 -78 16.0039 0.256
NP_442213.1_5 Forward -252 -233 3.14605 0.231
NP_442022.1_4 Forward -173 -154 8.55425 0.268
NP_440907.2_8 Forward -227 -217 12.4676 0.0624
NP_442264.1_2 Forward -165 -148 8.7903 0.208
NP_442264.1_2 Forward -246 -229 5.15205 0.284
NP_440326.1_5 Forward -163 -150 19.8821 0.175
NP_441463.1_6 Reverse -247 -261 8.73514 0.25
NP_442842.1_4 Forward -257 -238 2.26107 0.265
NP_441626.1_2 Reverse -220 -227 12.2322 0.0511
NP_441626.1_2 Forward -227 -220 5.93897 0.231
NP_442794.1_1 Forward -152 -140 2.20226 0.299
NP_442615.1_1 Reverse -210 -228 4.54237 0.0452
NP_442615.1_1 Reverse -356 -374 -5.78238 0.223
NP_441962.1_4 Reverse -222 -241 -12.8819 0.265
NP_441962.1_4 Forward -367 -348 -14.2585 0.285
NP_440387.1_1 Forward -88 -72 -4.1697 0.178
NP_440387.1_1 Forward -374 -358 -5.05468 0.212
NP_442647.1_7 Forward -129 -116 5.52582 0.283
NP_441993.1_1 Forward -154 -135 5.84498 0.194
NP_440467.1_3 Reverse -193 -212 11.7445 0.265
NP_440114.1_10 Reverse -219 -233 9.14437 0.183
NP_440114.1_10 Forward -228 -214 8.94771 0.19
NP_440935.1_5 Reverse -14 -33 18.1502 0.29
NP_441510.2_7 Forward -373 -359 11.307 0.28
NP_440293.1_3 Reverse -220 -239 -5.40875 0.276
NP_440766.1_4 Reverse -126 -140 2.94952 0.163
NP_442103.1_8 Forward -81 -67 21.4357 0.12
NP_439910.1_2 Reverse -184 -201 -14.5141 0.183
NP_440457.1_1 Forward -262 -250 5.25052 0.142
NP_440457.1_1 Forward -205 -193 -0.846001 0.278
NP_440213.1_5 Forward -160 -141 14.2574 0.186
NP_440798.1_6 Reverse -220 -233 4.64084 0.144
NP_440798.1_6 Forward -227 -214 3.5592 0.15
NP_441801.1_4 Forward -306 -296 2.7333 0.262
NP_440801.1_8 Forward -229 -210 6.39097 0.166
NP_442297.1_3 Forward -234 -215 8.06178 0.289
NP_441436.1_8 Reverse -226 -245 6.78429 0.297
NP_442509.1_9 Reverse -219 -229 11.9759 0.107
NP_442509.1_9 Forward -228 -218 9.71433 0.192
NP_442514.1_5 Reverse -285 -304 -5.40949 0.259
NP_440554.1_4 Forward -227 -217 4.40493 0.19
NP_441845.1_5 Reverse -230 -249 19.3819 0.121
NP_441885.1_5 Reverse -365 -375 0.0783647 0.183
NP_441885.1_5 Reverse -219 -229 0.0783647 0.183
NP_440478.1_10 Reverse -363 -377 6.58777 0.288
NP_442341.1_7 Forward -375 -361 5.89945 0.142
NP_442341.1_7 Reverse -226 -240 2.5562 0.252
NP_440423.1_6 Reverse -211 -230 -19.4701 0.239
NP_443000.1_7 Forward -376 -366 6.56821 0.123
NP_441842.1_10 Reverse -212 -226 10.3243 0.165
NP_441842.1_10 Reverse -170 -184 8.75105 0.211
NP_440275.1_3 Reverse -217 -227 5.78156 0.131
NP_441183.1_2 Reverse -111 -121 16.8278 0.245
NP_442275.1_1 Reverse -70 -89 11.5042 0.222
NP_439962.1_4 Forward -236 -217 -4.6221 0.271
NP_440175.1_7 Forward -165 -147 15.9018 0.119
NP_442495.1_5 Reverse -54 -73 6.19431 0.291
NP_442373.1_2 Forward -197 -178 -10.6203 0.288
NP_440216.1_1 Reverse -219 -233 -4.22864 0.103
NP_440216.1_1 Forward -228 -214 -6.68692 0.145
NP_440216.1_9 Reverse -199 -208 8.35786 0.286
NP_440701.1_2 Forward -366 -347 13.5691 0.191
NP_440172.1_1 Reverse -152 -162 6.17489 0.11
NP_441226.1_7 Reverse -220 -227 12.7234 0.0312
NP_441226.1_7 Forward -227 -220 11.5435 0.0757
NP_442222.1_1 Forward -220 -203 21.2775 0.15
NP_441111.1_7 Forward -227 -219 8.86921 0.0589
NP_441766.1_2 Forward -228 -219 14.7494 0.00772
NP_440416.1_9 Forward -156 -137 -16.6185 0.218
NP_440845.1_1 Forward -259 -240 4.52268 0.152
NP_442154.1_1 Forward -82 -64 -18.9587 0.288
NP_441430.1_2 Forward -144 -125 -4.32711 0.266
NP_440896.1_8 Reverse -221 -240 12.6841 0.274
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TACATTCGAGATAATGGCGAAAATCTAGCTATCACCGAAGCGCTGGAAACAGTTAAAGGTTGTTTGCTCAAAGGTGGTTGTAATGTGGTGCCTGGACTGCCCAGGGAACAGTGGATTTTAACCTTGGTAACTTCCATTGTGGGGGGATTGATTTTTGGCTTTGCGGCCATTCCCCGATCGCCGAATCAGACCTTTGCGTGGCAATGGGTGTTGATTATGTCGCCTCTGTGGGGAATTCTGGTCATTGCCTTTGGTATTGGCCCCGTTGTCACCCGCACCAGTGATTTTTTGCCTCTGTTCCGCAATTTAATGGGCTTTAGCCTGGGTGCCCTGGTAGCGTACCTTTCTCCCATGTTTAGCCAGATCAATAACAATCCCCAAACTTAAGCATTCAACCAGG

CDS

GTGACTATGATGGAAAAAACGGAAATTATGGCGCATTCCCCCATGGTCACCACCAATTCTCCCACCCGAGTTGCCATTCTTGAAAATGGCGATCACCTCAATCGTCAAGAGTTTGAGCGAATTTATGCTGAATCTCGAATCAAAAAAGCTGAGCTAATTGAAGGAATCGTCCACGTGGCTTCTCCCCTCCGTCACACTTACCATGGTCAACCCCATAGTCAAATCATTGGTTGGCTAATAACTTACCAAGCCCAAAGAACTGGACTAGCGGTTAGTATTGAGGCCACTGTGCGGTTAGACGATGAAAACGAACTTCAACCTGATGCTATTCTTTTTCGCTTAGGGGGGAATGCCCAGATAGATGAAGATGACTACATCAGCGGTGCCCCGGAGTTAGTGGTGGAGATTGCCGCCAGCACTGCTTCCTACGACCTCCATAGCAAAAAACGAGTTTACGAAAACCATGGGGTGAAAGAGTACATTGTTTGGCGCACCATCGACCGGGAAATTGATTGGTTTGTGCTAGTGAATGGAAAATATGAACGCCTGAGTCCCGACGACAATGGATTGATGGCCAGTCAAGAATTTCCAGGCTTAGTGCTCAATACCCCTGCTATGTTGGCCAACAATATGGCCGATGTGATTACTACCCTTAACAGCTTCTCCCGTTAG

Protein

MTMMEKTEIMAHSPMVTTNSPTRVAILENGDHLNRQEFERIYAESRIKKAELIEGIVHVASPLRHTYHGQPHSQIIGWLITYQAQRTGLAVSIEATVRLDDENELQPDAILFRLGGNAQIDEDDYISGAPELVVEIAASTASYDLHSKKRVYENHGVKEYIVWRTIDREIDWFVLVNGKYERLSPDDNGLMASQEFPGLVLNTPAMLANNMADVITTLNSFSR