Your browser is old and dusty. Try Google Chrome!

Details for sll1068

ORF sll1068
Accession NP_440633.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -180 -166 8.16106 0.0927
NP_440795.1_7 Forward -180 -173 14.6904 0.0123
NP_440795.1_7 Reverse -173 -180 14.6904 0.0123
NP_441418.1_3 Reverse -346 -365 14.8486 0.156
NP_441418.1_6 Forward -181 -162 -0.983855 0.0113
NP_440897.1_6 Forward -181 -162 -0.00131823 0.182
NP_441453.1_1 Reverse -165 -183 22.8311 0.0155
NP_441453.1_4 Reverse -172 -180 16.539 0.00633
NP_441453.1_4 Forward -181 -173 16.539 0.00633
NP_441453.1_7 Forward -345 -338 12.9205 0.23
NP_442151.1_6 Reverse -172 -186 16.3225 0.0158
NP_442151.1_6 Forward -181 -167 10.816 0.114
NP_441818.1_1 Reverse -173 -184 10.1862 0.232
NP_441818.1_9 Forward -282 -263 -6.88371 0.266
NP_440226.1_1 Reverse -172 -191 13.4708 0.0356
NP_440226.1_1 Forward -219 -200 4.03102 0.206
NP_442169.1_1 Forward -178 -159 -3.54046 0.295
NP_440996.1_3 Reverse -17 -35 15.0638 0.166
NP_442744.1_9 Reverse -323 -337 16.0349 0.266
NP_442655.1_10 Forward -169 -150 -13.3736 0.266
NP_442173.1_1 Forward -180 -172 15.4574 0.00633
NP_442173.1_1 Reverse -173 -181 15.4574 0.00633
NP_442752.1_4 Forward -181 -174 13.8055 0.0199
NP_442752.1_4 Reverse -172 -179 13.8055 0.0199
NP_443027.1_4 Reverse -170 -180 13.943 0.0452
NP_442975.1_10 Reverse -168 -182 13.077 0.0459
NP_440784.1_7 Forward -180 -173 15.9687 0.0123
NP_440784.1_7 Reverse -173 -180 15.9687 0.0123
NP_440061.1_9 Forward -183 -169 11.4053 0.111
NP_440110.1_8 Forward -183 -164 10.2259 0.0878
NP_441054.1_4 Forward -191 -173 0.609134 0.174
NP_442062.1_8 Forward -181 -171 19.4496 0.000558
NP_442062.1_8 Reverse -172 -182 17.3846 0.00193
NP_440761.1_4 Forward -186 -167 -13.9635 0.257
NP_441859.1_2 Reverse -155 -174 11.5033 0.215
NP_441859.1_3 Reverse -178 -197 7.27514 0.162
NP_440304.1_4 Reverse -170 -180 9.91146 0.051
NP_440304.1_4 Reverse -327 -337 3.71661 0.293
NP_440304.1_4 Forward -183 -173 1.84832 0.299
NP_442242.1_4 Forward -180 -173 14.3954 0.0124
NP_442242.1_4 Reverse -173 -180 14.3954 0.0124
NP_440044.1_8 Reverse -173 -192 -1.37718 0.244
NP_441208.1_9 Forward -184 -170 13.5693 0.103
NP_441594.1_6 Reverse -163 -182 10.9142 0.122
NP_441365.1_5 Forward -27 -8 2.75272 0.0343
NP_442110.1_7 Forward -181 -167 2.06454 0.222
NP_441925.1_4 Reverse -141 -160 -16.9142 0.287
NP_440273.1_1 Reverse -357 -376 16.5674 0.236
NP_441083.1_5 Reverse -172 -182 20.3345 0.00053
NP_441083.1_5 Forward -181 -171 11.3864 0.0159
NP_442827.1_8 Reverse -164 -183 -0.00131823 0.217
NP_441434.1_6 Reverse -327 -337 16.303 0.243
NP_441738.1_2 Forward -179 -172 15.28 0.0102
NP_441738.1_2 Reverse -174 -181 15.28 0.0102
NP_440209.1_1 Reverse -172 -180 18.1123 0.00295
NP_440209.1_1 Forward -181 -173 18.1123 0.00295
NP_442889.1_8 Reverse -169 -183 13.2736 0.0588
NP_440447.1_6 Reverse -164 -182 0.21581 0.293
NP_441713.1_1 Reverse -166 -185 -6.29373 0.118
NP_440178.1_7 Reverse -171 -190 -22.5183 0.267
NP_442445.1_2 Reverse -267 -286 7.96426 0.288
NP_441716.1_1 Forward -181 -167 10.7177 0.0936
NP_442111.1_4 Forward -182 -168 21.5341 0.00165
NP_440343.1_9 Forward -176 -157 10.8159 0.237
NP_440906.1_5 Forward -180 -173 15.8704 0.0124
NP_440906.1_5 Reverse -173 -180 15.8704 0.0124
NP_440747.1_10 Forward -184 -172 14.9853 0.00221
NP_440747.1_10 Reverse -169 -181 7.70879 0.00236
NP_440747.1_10 Reverse -137 -149 -11.8591 0.161
NP_441130.1_10 Reverse -170 -184 10.4227 0.113
NP_442973.1_5 Reverse -93 -112 11.0125 0.258
NP_441486.1_1 Forward -184 -170 13.2743 0.00871
NP_441486.1_1 Reverse -169 -183 5.50613 0.0365
NP_442634.1_4 Forward -183 -169 -2.95034 0.157
NP_441265.1_3 Reverse -166 -180 14.1593 0.059
NP_440403.1_4 Reverse -225 -244 -1.67217 0.174
NP_440403.1_4 Reverse -163 -182 -7.17871 0.237
NP_440403.1_10 Forward -181 -162 2.65439 0.279
NP_441014.1_8 Forward -222 -203 -7.27704 0.276
NP_441014.1_8 Reverse -137 -156 -8.85033 0.288
NP_441014.1_10 Forward -182 -163 2.16195 0.216
NP_443018.1_3 Forward -180 -173 14.8871 0.0123
NP_443018.1_3 Reverse -173 -180 14.8871 0.0123
NP_441316.1_7 Reverse -170 -185 1.06154 0.177
NP_441634.1_8 Forward -183 -169 6.6861 0.114
NP_440376.1_1 Forward -181 -172 19.4693 0.000692
NP_440376.1_1 Reverse -172 -181 19.4693 0.000692
NP_440376.1_1 Reverse -234 -243 7.66954 0.0706
NP_440376.1_1 Forward -149 -140 3.63797 0.2
NP_441588.1_4 Reverse -174 -184 18.1713 0.0143
NP_442687.1_7 Reverse -171 -181 15.8113 0.0125
NP_442687.1_7 Forward -182 -172 8.92815 0.0994
NP_442191.1_4 Forward -180 -166 19.3314 0.00462
NP_441077.1_6 Forward -61 -45 4.53719 0.255
NP_442485.1_3 Forward -183 -164 -3.3438 0.273
NP_441846.1_1 Reverse -368 -387 5.50599 0.28
NP_441950.1_7 Forward -279 -260 -7.17871 0.278
NP_442658.1_1 Reverse -170 -180 18.7607 0.00222
NP_442658.1_1 Forward -183 -173 6.76441 0.214
NP_442198.1_3 Forward -190 -171 17.109 0.0723
NP_441855.2_4 Reverse -164 -183 8.94462 0.296
NP_440662.1_3 Forward -235 -216 11.4058 0.226
NP_441414.1_9 Reverse -172 -191 -1.47551 0.101
NP_441487.1_9 Reverse -171 -190 9.0459 0.0988
NP_442937.1_5 Reverse -167 -186 5.99764 0.293
NP_441958.1_5 Forward -182 -172 12.2714 0.00183
NP_441958.1_5 Reverse -171 -181 12.2714 0.00183
NP_441127.1_1 Forward -175 -161 8.94771 0.284
NP_440373.1_3 Forward -224 -206 22.0444 0.0562
NP_440203.1_5 Reverse -160 -170 9.71433 0.245
NP_440984.1_7 Forward -186 -172 8.65272 0.139
NP_439990.1_5 Forward -186 -173 16.1456 0.0407
NP_439990.1_5 Reverse -167 -180 13.0973 0.103
NP_442911.1_2 Reverse -162 -181 -6.88371 0.195
NP_443055.1_6 Forward -222 -204 -1.75153 0.284
NP_440993.1_4 Forward -214 -197 1.90713 0.3
NP_441913.1_1 Forward -344 -328 16.5306 0.246
NP_441099.1_5 Reverse -162 -181 4.62101 0.0483
NP_441099.1_5 Forward -191 -172 -1.08219 0.102
NP_441099.1_5 Reverse -130 -149 -9.83364 0.234
NP_442002.1_9 Reverse -240 -247 11.3472 0.185
NP_442002.1_9 Reverse -171 -178 10.7572 0.185
NP_440475.1_1 Forward -190 -171 10.1954 0.289
NP_441938.1_1 Forward -183 -164 1.57275 0.272
NP_441294.1_7 Reverse -168 -182 8.48272 0.298
NP_442438.1_10 Reverse -167 -181 12.0943 0.0412
NP_442438.1_10 Forward -44 -30 -0.393733 0.259
NP_441000.1_6 Reverse -171 -185 -4.81863 0.252
NP_442771.1_1 Forward -183 -165 -6.66736 0.168
NP_440147.1_4 Forward -183 -170 19.4888 0.00276
NP_440147.1_4 Reverse -170 -183 3.46087 0.187
NP_441550.1_8 Forward -183 -173 14.6309 0.0132
NP_441550.1_8 Reverse -170 -180 10.501 0.066
NP_441916.1_7 Forward -181 -171 18.4663 0.00144
NP_441916.1_7 Reverse -172 -182 10.3048 0.0261
NP_441916.1_7 Forward -149 -139 4.50326 0.174
NP_441916.1_7 Reverse -144 -154 1.65166 0.278
NP_441916.1_10 Forward -35 -16 4.916 0.22
NP_440206.1_4 Forward -224 -205 -2.45958 0.298
NP_441041.1_4 Reverse -172 -191 7.17762 0.0403
NP_441041.1_4 Forward -181 -162 -0.295539 0.0941
NP_441041.1_7 Reverse -169 -181 16.2608 0.0165
NP_441041.1_7 Forward -184 -172 11.8878 0.0689
NP_442396.1_5 Forward -185 -172 11.7207 0.0913
NP_442996.1_7 Reverse -353 -372 14.8254 0.216
NP_441725.1_5 Forward -180 -170 9.02648 0.0553
NP_441725.1_5 Reverse -173 -183 2.04498 0.115
NP_439966.1_7 Reverse -170 -180 17.4824 0.00636
NP_439966.1_7 Forward -183 -173 7.25606 0.15
NP_439966.1_7 Forward -221 -211 4.60114 0.265
NP_439966.1_9 Reverse -170 -179 10.7178 0.0863
NP_442941.1_3 Reverse -173 -183 11.0914 0.0116
NP_442941.1_3 Forward -180 -170 2.53664 0.14
NP_440289.1_2 Reverse -169 -182 10.1474 0.0278
NP_440289.1_2 Forward -184 -171 -2.144 0.251
NP_441076.1_6 Forward -229 -219 17.1874 0.238
NP_440260.1_8 Reverse -163 -181 -7.25734 0.295
NP_441514.1_4 Reverse -345 -364 11.9205 0.297
NP_440802.1_4 Forward -87 -68 18.3873 0.13
NP_441678.1_9 Reverse -194 -213 4.22769 0.204
NP_442281.1_1 Reverse -167 -181 9.73373 0.0675
NP_442281.1_1 Forward -186 -172 8.84875 0.075
NP_442281.1_1 Forward -224 -210 3.53891 0.228
NP_441334.1_7 Forward -183 -164 -9.53865 0.12
NP_441079.1_7 Forward -376 -357 -5.70449 0.267
NP_440437.1_1 Reverse -166 -185 5.11266 0.0903
NP_442012.1_1 Forward -187 -168 3.04771 0.188
NP_441087.1_6 Forward -209 -191 0.903388 0.258
NP_441556.1_4 Reverse -160 -179 10.0051 0.286
NP_441556.1_7 Reverse -161 -180 3.63691 0.264
NP_441556.1_10 Reverse -167 -181 10.5138 0.267
NP_440375.1_8 Reverse -130 -149 5.99764 0.168
NP_441644.1_6 Reverse -172 -182 17.3841 0.00127
NP_441644.1_6 Forward -181 -171 10.1076 0.0628
NP_442215.1_2 Reverse -170 -186 10.8749 0.0448
NP_442215.1_2 Forward -183 -167 -0.629782 0.17
NP_442215.1_2 Reverse -196 -212 -7.61128 0.3
NP_442029.1_1 Forward -168 -149 -11.8986 0.233
NP_440253.1_2 Forward -181 -163 6.60732 0.0778
NP_440253.1_2 Reverse -140 -158 3.3624 0.118
NP_440929.1_8 Forward -181 -172 19.2726 0.000701
NP_440929.1_8 Reverse -172 -181 19.2726 0.000701
NP_440469.1_8 Forward -174 -155 7.57094 0.295
NP_442933.1_10 Forward -181 -172 17.601 0.00325
NP_442933.1_10 Reverse -172 -181 17.601 0.00325
NP_441751.2_8 Reverse -173 -187 2.5562 0.0804
NP_441751.2_8 Forward -180 -166 -3.147 0.134
NP_441751.2_8 Forward -148 -134 -5.50694 0.214
NP_442554.1_8 Forward -180 -170 16.008 0.0065
NP_442554.1_8 Reverse -173 -183 15.3197 0.00882
NP_442554.1_8 Reverse -206 -216 1.84832 0.292
NP_442863.1_5 Forward -177 -158 16.8141 0.169
NP_442970.1_3 Forward -366 -348 14.6545 0.168
NP_441762.1_7 Forward -182 -170 12.4287 0.0142
NP_441762.1_7 Reverse -171 -183 9.57708 0.0142
NP_442142.1_4 Reverse -169 -182 15.1616 0.0289
NP_442142.1_4 Forward -184 -171 13.49 0.0348
NP_442292.1_1 Reverse -173 -182 18.486 0.00229
NP_442292.1_1 Forward -180 -171 9.63616 0.0183
NP_440895.1_6 Forward -187 -174 11.819 0.202
NP_443009.1_5 Forward -182 -171 18.3477 0.00265
NP_442301.1_2 Forward -224 -205 5.80018 0.263
NP_441715.1_4 Forward -180 -170 9.32148 0.097
NP_441715.1_4 Reverse -173 -183 7.94484 0.107
NP_440730.1_4 Reverse -329 -348 2.45773 0.237
NP_440970.1_5 Reverse -195 -214 17.3057 0.16
NP_440379.1_5 Reverse -163 -182 -4.72043 0.215
NP_440379.1_5 Forward -175 -156 -8.35868 0.252
NP_440464.1_10 Reverse -173 -183 13.0082 0.169
NP_441468.1_1 Forward -180 -173 15.8704 0.0124
NP_441468.1_1 Reverse -173 -180 15.8704 0.0124
NP_441020.2_6 Forward -183 -166 9.77361 0.162
NP_441015.1_10 Forward -171 -152 -7.96535 0.272
NP_441015.1_10 Forward -183 -164 -10.817 0.288
NP_441673.1_1 Forward -181 -172 20.8459 0.000698
NP_441673.1_1 Reverse -172 -181 20.8459 0.000698
NP_441826.1_2 Reverse -166 -180 4.22782 0.104
NP_441637.1_9 Forward -362 -344 -3.91409 0.296
NP_441764.1_8 Reverse -99 -109 13.1291 0.284
NP_442868.1_6 Forward -183 -173 9.81313 0.038
NP_442868.1_6 Reverse -170 -180 8.53483 0.0555
NP_442719.1_2 Reverse -148 -166 -1.55487 0.175
NP_441612.1_2 Reverse -342 -352 8.83972 0.21
NP_441612.1_2 Reverse -172 -182 8.54929 0.21
NP_442559.1_3 Forward -349 -330 11.2092 0.214
NP_442227.1_2 Reverse -156 -175 3.04771 0.219
NP_442227.1_2 Forward -212 -193 0.196116 0.252
NP_441911.1_10 Forward -64 -45 12.8973 0.21
NP_442808.1_1 Reverse -171 -181 18.4657 0.00201
NP_442808.1_1 Forward -182 -172 8.63269 0.0481
NP_442808.1_1 Reverse -128 -138 8.3377 0.0525
NP_442808.1_1 Reverse -156 -166 3.12618 0.248
NP_442630.1_5 Forward -376 -357 14.6508 0.263
NP_441849.1_3 Forward -223 -204 16.4199 0.177
NP_440145.1_3 Forward -191 -172 7.47261 0.0466
NP_440145.1_3 Reverse -162 -181 -1.86883 0.156
NP_442542.1_2 Reverse -170 -183 11.9173 0.114
NP_442113.1_5 Reverse -155 -174 7.27514 0.294
NP_442050.1_1 Forward -179 -160 7.57094 0.265
NP_442050.1_5 Reverse -170 -180 8.23937 0.234
NP_442050.1_5 Forward -183 -173 7.64939 0.243
NP_442342.1_9 Reverse -170 -186 2.12349 0.29
NP_441114.1_3 Forward -213 -204 7.86621 0.231
NP_442789.1_4 Reverse -218 -237 4.22769 0.156
NP_442789.1_4 Forward -183 -164 -2.16383 0.233
NP_441518.1_3 Reverse -162 -181 -14.5535 0.278
NP_441878.1_6 Forward -182 -172 10.4031 0.0176
NP_441878.1_6 Reverse -171 -181 10.4031 0.0176
NP_441878.1_6 Reverse -233 -243 -7.78811 0.266
NP_441878.1_6 Reverse -143 -153 -7.98478 0.285
NP_441036.1_8 Reverse -171 -181 17.7779 0.000554
NP_441036.1_8 Forward -182 -172 8.33817 0.174
NP_441557.1_5 Forward -181 -172 19.9609 0.000699
NP_441557.1_5 Reverse -172 -181 19.9609 0.000699
NP_441445.1_1 Forward -190 -171 15.3391 0.0451
NP_441445.1_1 Reverse -163 -182 6.19431 0.153
NP_442066.2_4 Forward -181 -162 10.1275 0.069
NP_442066.2_9 Forward -185 -172 8.9674 0.183
NP_441308.1_8 Reverse -170 -180 9.22315 0.226
NP_441458.1_10 Reverse -163 -182 5.80098 0.212
NP_442183.1_1 Forward -181 -167 9.34103 0.0986
NP_442166.1_7 Forward -180 -166 9.73436 0.19
NP_442347.1_2 Reverse -173 -182 12.4878 0.056
NP_442347.1_2 Forward -180 -171 11.1111 0.056
NP_442347.1_2 Forward -218 -209 4.32629 0.284
NP_442645.1_2 Forward -189 -170 -2.85214 0.0487
NP_442645.1_2 Forward -146 -127 -14.0619 0.17
NP_442645.1_2 Forward -164 -145 -22.2233 0.29
NP_440547.1_1 Reverse -152 -171 8.65176 0.256
NP_441037.1_4 Reverse -170 -180 16.2838 0.0168
NP_441037.1_4 Forward -183 -173 7.9999 0.237
NP_442594.1_8 Forward -168 -149 6.58763 0.226
NP_441633.1_3 Forward -183 -170 18.3088 0.00715
NP_441633.1_3 Reverse -170 -183 -3.71729 0.177
NP_440136.1_2 Forward -180 -173 15.9687 0.0123
NP_440136.1_2 Reverse -173 -180 15.9687 0.0123
NP_441728.2_4 Reverse -348 -367 11.5064 0.293
NP_442998.1_5 Forward -341 -331 13.7464 0.157
NP_442998.1_10 Forward -179 -172 15.5754 0.0102
NP_442998.1_10 Reverse -174 -181 15.5754 0.0102
NP_440899.1_1 Reverse -194 -213 24.2173 0.00683
NP_440899.1_8 Reverse -46 -65 -10.522 0.28
NP_440299.1_1 Reverse -168 -181 19.6848 0.00185
NP_440299.1_1 Forward -185 -172 4.34528 0.209
NP_441799.1_1 Forward -185 -171 18.3868 0.0085
NP_441799.1_1 Reverse -168 -182 4.32555 0.255
NP_441007.1_10 Forward -186 -173 2.87088 0.183
NP_440256.1_1 Forward -184 -165 0.196116 0.0858
NP_440256.1_1 Reverse -367 -386 -9.14533 0.275
NP_440087.1_1 Forward -190 -171 -9.44032 0.297
NP_441559.1_8 Reverse -167 -181 11.996 0.0574
NP_440915.1_6 Reverse -168 -182 15.2409 0.0183
NP_440915.1_6 Forward -153 -139 0.0979218 0.176
NP_442158.1_4 Forward -106 -96 13.7464 0.212
NP_441179.1_9 Reverse -155 -165 9.12434 0.284
NP_441704.1_8 Reverse -161 -180 11.11 0.142
NP_441464.1_8 Forward -243 -229 7.47274 0.206
NP_441464.1_8 Reverse -172 -186 4.62115 0.269
NP_441939.1_3 Forward -180 -161 5.40766 0.276
NP_442993.1_1 Reverse -172 -188 -9.5779 0.188
NP_440677.1_1 Reverse -163 -182 15.1424 0.103
NP_442386.1_9 Reverse -171 -180 15.7322 0.0144
NP_442386.1_9 Forward -182 -173 13.8639 0.0289
NP_442386.1_10 Forward -138 -125 3.26421 0.285
NP_441340.1_5 Forward -180 -173 15.6737 0.0124
NP_441340.1_5 Reverse -173 -180 15.6737 0.0124
NP_442484.1_2 Forward -192 -173 5.11266 0.174
NP_442240.1_2 Forward -180 -161 -13.6686 0.171
NP_440586.1_8 Forward -180 -173 13.2151 0.026
NP_440586.1_8 Reverse -173 -180 13.2151 0.026
NP_442251.1_6 Forward -180 -173 15.2804 0.0124
NP_442251.1_6 Reverse -173 -180 15.2804 0.0124
NP_441262.1_3 Reverse -172 -179 14.7888 0.0223
NP_441262.1_3 Forward -181 -174 14.7888 0.0223
NP_440027.1_4 Forward -379 -360 0.750038 0.297
NP_443051.1_1 Reverse -171 -180 10.4228 0.00754
NP_443051.1_1 Forward -182 -173 10.4228 0.00754
NP_439937.1_9 Forward -182 -165 -8.22161 0.176
NP_439937.1_9 Reverse -171 -188 -16.383 0.287
NP_440439.1_1 Reverse -169 -182 9.65572 0.0447
NP_440439.1_1 Reverse -207 -220 -0.472371 0.221
NP_439943.1_7 Forward -197 -178 2.3594 0.294
NP_440372.1_2 Forward -180 -173 16.3621 0.0124
NP_440372.1_2 Reverse -173 -180 16.3621 0.0124
NP_440171.1_3 Forward -170 -151 2.55606 0.285
NP_440770.1_3 Forward -397 -383 15.2409 0.245
NP_440378.1_6 Forward -196 -177 15.1424 0.233
NP_441803.1_2 Reverse -167 -186 4.52268 0.177
NP_439977.1_5 Reverse -166 -185 3.24438 0.16
NP_439977.1_5 Forward -187 -168 1.76941 0.188
NP_442384.1_10 Forward -181 -168 9.65572 0.0508
NP_442384.1_10 Reverse -172 -185 8.18076 0.0685
NP_442384.1_10 Forward -219 -206 3.5592 0.186
NP_442035.1_8 Reverse -169 -183 12.6843 0.243
NP_442114.1_4 Forward -181 -170 12.1534 0.107
NP_442262.1_10 Forward -180 -173 14.1988 0.0123
NP_442262.1_10 Reverse -173 -180 14.1988 0.0123
NP_441689.1_5 Forward -183 -173 5.78111 0.197
NP_440163.1_10 Reverse -202 -212 11.0914 0.174
NP_440344.1_10 Reverse -165 -182 16.7551 0.00345
NP_440344.1_10 Forward -188 -171 -0.649475 0.0444
NP_440531.1_6 Reverse -164 -183 10.1275 0.0688
NP_440531.1_6 Forward -189 -170 -4.03212 0.273
NP_441965.1_7 Forward -234 -215 11.2084 0.293
NP_441965.1_10 Reverse -169 -185 7.2367 0.151
NP_440297.1_9 Reverse -173 -183 -0.118297 0.282
NP_440297.1_9 Forward -180 -170 -0.216628 0.282
NP_441896.1_3 Reverse -163 -182 3.14605 0.179
NP_440894.1_10 Reverse -167 -186 2.26107 0.292
NP_441894.1_1 Forward -176 -157 -5.31042 0.258
NP_442067.1_4 Reverse -161 -180 7.86593 0.194
NP_440999.1_9 Reverse -168 -182 22.714 0.0083
NP_440888.1_2 Forward -181 -167 17.0102 0.00497
NP_440888.1_2 Reverse -172 -186 7.66879 0.186
NP_442147.1_6 Forward -151 -137 19.6651 0.182
NP_442033.1_10 Reverse -170 -189 -8.16202 0.191
NP_442033.1_10 Forward -183 -164 -14.1602 0.297
NP_441543.1_2 Forward -180 -171 18.486 0.00236
NP_441543.1_2 Reverse -173 -182 16.9127 0.00359
NP_442845.1_2 Reverse -199 -213 14.4542 0.0801
NP_442845.1_2 Forward -187 -173 11.996 0.119
NP_442845.1_2 Forward -352 -338 3.24451 0.298
NP_440771.1_2 Reverse -172 -191 9.73422 0.293
NP_442710.1_7 Reverse -355 -374 -7.60718 0.296
NP_441469.1_8 Reverse -171 -180 16.126 0.00797
NP_441469.1_8 Forward -182 -173 6.48957 0.227
NP_443064.1_6 Reverse -172 -182 12.5669 0.0796
NP_442578.1_7 Forward -180 -173 14.5921 0.026
NP_442578.1_7 Reverse -173 -180 14.5921 0.026
NP_441462.1_2 Forward -181 -171 11.5831 0.00406
NP_441462.1_2 Reverse -172 -182 11.5831 0.00406
NP_441462.1_2 Forward -149 -139 7.15819 0.0583
NP_441621.1_7 Forward -183 -169 6.3911 0.068
NP_441621.1_7 Reverse -170 -184 -3.24533 0.188
NP_443062.1_1 Reverse -172 -190 14.4939 0.0465
NP_443062.1_1 Forward -149 -131 3.37804 0.3
NP_443062.1_6 Forward -189 -170 10.0292 0.119
NP_442204.1_1 Reverse -168 -179 2.41861 0.266
NP_441560.1_8 Reverse -167 -186 12.2918 0.255
NP_440544.1_5 Reverse -56 -63 13.8024 0.28
NP_442872.1_1 Reverse -152 -171 -12.0953 0.252
NP_440516.1_8 Forward -181 -172 16.9127 0.00442
NP_440516.1_8 Reverse -172 -181 16.9127 0.00442
NP_440516.1_8 Forward -138 -129 -0.68859 0.297
NP_442428.1_5 Forward -180 -173 15.8704 0.0124
NP_442428.1_5 Reverse -173 -180 15.8704 0.0124
NP_441443.1_1 Reverse -232 -251 -4.6221 0.297
NP_442859.1_2 Forward -218 -199 4.22769 0.219
NP_442120.1_10 Reverse -323 -342 -15.1435 0.289
NP_442120.1_10 Reverse -302 -321 -15.7335 0.294
NP_440673.1_2 Forward -191 -172 9.99938 0.226
NP_440673.1_2 Reverse -162 -181 9.70673 0.238
NP_440673.1_3 Forward -179 -172 12.4288 0.0426
NP_440673.1_3 Reverse -174 -181 12.4288 0.0426
NP_441714.1_3 Reverse -165 -183 17.2262 0.105
NP_440865.1_9 Forward -187 -168 -9.63698 0.294
NP_441052.1_2 Reverse -172 -182 19.9412 0.00106
NP_441052.1_2 Forward -181 -171 10.5014 0.0285
NP_442219.1_9 Reverse -173 -182 17.7976 0.00718
NP_442219.1_9 Forward -180 -171 8.35786 0.0681
NP_440436.1_4 Forward -180 -171 18.1905 0.00233
NP_440436.1_4 Reverse -173 -182 17.2072 0.00233
NP_441884.1_9 Forward -184 -165 -12.1936 0.138
NP_441884.1_9 Reverse -169 -188 -23.895 0.284
NP_440314.1_9 Reverse -173 -192 16.7157 0.0121
NP_441719.1_4 Forward -180 -173 16.3621 0.0124
NP_441719.1_4 Reverse -173 -180 16.3621 0.0124
NP_441733.1_10 Forward -184 -171 9.85238 0.106
NP_441733.1_10 Reverse -169 -182 8.18076 0.14
NP_441004.1_1 Forward -172 -153 -9.34199 0.206
NP_441004.1_1 Forward -187 -168 -15.8318 0.279
NP_441004.1_2 Forward -177 -158 -2.45882 0.264
NP_442366.1_3 Reverse -171 -189 -3.71743 0.255
NP_442366.1_5 Forward -184 -174 14.8275 0.0375
NP_442873.1_3 Reverse -162 -181 5.11187 0.262
NP_440296.1_6 Forward -373 -355 10.6016 0.295
NP_442694.1_9 Forward -348 -329 11.7992 0.207
NP_442206.1_10 Forward -181 -166 2.73316 0.198
NP_443054.1_2 Forward -183 -169 3.04785 0.24
NP_443054.1_2 Reverse -170 -184 2.16287 0.245
NP_442430.1_10 Reverse -162 -181 9.93006 0.277
NP_442586.1_5 Forward -141 -122 22.7139 0.0324
NP_441851.1_10 Reverse -171 -181 16.008 0.00552
NP_441851.1_10 Forward -182 -172 15.8113 0.00552
NP_441501.1_6 Reverse -204 -223 12.2908 0.299
NP_442856.1_5 Reverse -123 -142 19.7774 0.171
NP_442515.1_1 Reverse -240 -254 -0.787057 0.235
NP_442515.1_1 Forward -182 -168 -2.26202 0.271
NP_442515.1_1 Reverse -171 -185 -4.7203 0.298
NP_440593.1_3 Forward -186 -167 -4.72043 0.251
NP_440463.1_8 Reverse -156 -175 11.1788 0.203
NP_441046.1_2 Forward -192 -173 6.39097 0.221
NP_440338.1_4 Reverse -348 -367 7.4718 0.28
NP_440940.1_7 Reverse -162 -180 10.0481 0.15
NP_441349.1_10 Forward -191 -172 -9.44032 0.292
NP_441409.1_6 Forward -187 -168 -7.27704 0.146
NP_442843.1_1 Reverse -242 -261 -10.3253 0.277
NP_439960.1_10 Reverse -156 -174 -4.50408 0.293
NP_441477.1_10 Forward -215 -197 2.87075 0.23
NP_440431.1_4 Forward -66 -47 -8.35597 0.275
NP_442450.1_3 Reverse -347 -365 7.58986 0.211
NP_442450.1_5 Forward -183 -173 7.55152 0.13
NP_441031.1_6 Reverse -159 -178 9.53756 0.126
NP_440023.1_5 Reverse -359 -378 8.84924 0.195
NP_442006.1_2 Forward -175 -158 -15.8908 0.23
NP_443047.1_7 Forward -317 -298 6.4893 0.228
NP_441570.1_1 Forward -181 -163 -7.15901 0.0859
NP_441078.1_4 Forward -181 -172 19.6659 0.0007
NP_441078.1_4 Reverse -172 -181 19.6659 0.0007
NP_442729.1_8 Reverse -168 -181 8.37742 0.125
NP_442388.1_3 Reverse -193 -212 8.75091 0.228
NP_440793.1_1 Forward -335 -321 8.55376 0.295
NP_440526.1_3 Reverse -173 -184 10.2846 0.0646
NP_440526.1_3 Forward -180 -169 9.49793 0.0826
NP_440526.1_3 Forward -242 -231 1.23817 0.267
NP_441432.1_8 Forward -182 -173 16.8143 0.00595
NP_441432.1_8 Reverse -171 -180 8.25953 0.0755
NP_441432.1_8 Forward -139 -130 3.14632 0.259
NP_442320.1_8 Reverse -166 -180 -1.08205 0.0817
NP_442320.1_8 Forward -187 -173 -2.36035 0.0871
NP_441732.1_2 Reverse -168 -184 -6.52964 0.0495
NP_441732.1_2 Forward -185 -169 -16.2644 0.165
NP_441030.1_6 Reverse -127 -146 11.0224 0.297
NP_440313.1_5 Forward -346 -328 11.9164 0.252
NP_442003.1_4 Reverse -173 -192 12.1925 0.272
NP_442003.1_9 Reverse -330 -349 4.12936 0.263
NP_440760.1_1 Reverse -172 -191 -12.8819 0.0954
NP_440199.1_10 Forward -184 -174 7.25653 0.231
NP_441057.1_4 Forward -182 -164 11.4255 0.14
NP_442353.1_4 Reverse -166 -185 -0.197979 0.287
NP_440713.1_4 Reverse -200 -219 5.60432 0.205
NP_440713.1_4 Reverse -162 -181 4.916 0.219
NP_442489.1_7 Forward -181 -172 20.1576 0.000695
NP_442489.1_7 Reverse -172 -181 20.1576 0.000695
NP_442489.1_7 Forward -149 -140 -1.96689 0.28
NP_442079.1_7 Forward -180 -161 11.5042 0.0971
NP_440559.1_1 Reverse -173 -182 17.4043 0.00658
NP_440559.1_1 Forward -180 -171 8.75118 0.0586
NP_441659.2_8 Reverse -172 -182 18.1713 0.00133
NP_441659.2_8 Forward -181 -171 11.9764 0.0147
NP_442913.1_10 Forward -190 -171 -3.14714 0.201
NP_442346.1_5 Forward -182 -172 16.6963 0.00248
NP_442346.1_5 Reverse -171 -181 9.02648 0.118
NP_440545.1_3 Forward -185 -168 5.25038 0.0631
NP_440545.1_5 Forward -185 -168 9.97027 0.21
NP_440545.1_5 Reverse -201 -218 6.03703 0.226
NP_441856.1_3 Forward -152 -133 -2.26216 0.258
NP_440459.1_2 Reverse -197 -214 9.57695 0.224
NP_440847.1_3 Reverse -159 -173 16.9119 0.115
NP_442603.1_7 Forward -181 -167 10.1271 0.133
NP_442603.1_9 Forward -34 -16 -0.472507 0.3
NP_440034.1_4 Reverse -355 -367 17.9689 0.223
NP_442828.1_5 Reverse -360 -379 10.52 0.289
NP_441888.1_7 Reverse -167 -181 3.8345 0.225
NP_441833.1_4 Forward -180 -173 15.9687 0.0124
NP_441833.1_4 Reverse -173 -180 15.9687 0.0124
NP_441329.1_3 Reverse -318 -328 14.5211 0.253
NP_442162.1_9 Forward -180 -173 16.2637 0.0124
NP_442162.1_9 Reverse -173 -180 16.2637 0.0124
NP_442943.1_1 Forward -373 -358 13.1545 0.117
NP_442140.1_3 Forward -180 -170 17.4829 0.0159
NP_442140.1_3 Reverse -173 -183 12.2714 0.0632
NP_440875.1_9 Forward -179 -169 18.3004 0.0104
NP_441813.1_5 Reverse -170 -180 10.0098 0.0208
NP_441813.1_5 Forward -183 -173 8.63316 0.0367
NP_442089.1_1 Forward -184 -165 -1.27885 0.267
NP_440590.1_4 Forward -180 -167 15.4572 0.0106
NP_440590.1_4 Reverse -173 -186 11.4257 0.0202
NP_440567.1_1 Forward -180 -166 9.5377 0.0434
NP_440567.1_1 Reverse -173 -187 6.19444 0.0871
NP_442497.1_10 Forward -180 -171 10.4228 0.0087
NP_442497.1_10 Reverse -173 -182 10.4228 0.0087
NP_440821.1_4 Reverse -170 -180 18.7612 0.00422
NP_440821.1_4 Forward -183 -173 9.41981 0.0286
NP_441239.1_9 Reverse -170 -182 16.0669 0.0175
NP_441239.1_9 Forward -183 -171 5.93884 0.202
NP_441239.1_9 Forward -216 -204 3.87389 0.272
NP_441239.1_9 Forward -146 -134 3.87389 0.272
NP_441727.1_3 Forward -221 -202 2.55606 0.299
NP_441892.1_1 Reverse -163 -180 4.85706 0.105
NP_440604.1_6 Forward -181 -162 -6.09707 0.289
NP_442044.1_1 Reverse -167 -186 -12.2919 0.271
NP_441541.1_7 Reverse -340 -358 12.0022 0.225
NP_440833.1_6 Forward -340 -326 11.4053 0.222
NP_440876.1_5 Forward -241 -222 5.40766 0.283
NP_441526.1_6 Forward -174 -155 2.94938 0.271
NP_441617.1_5 Forward -302 -283 19.0748 0.0725
NP_440546.1_4 Forward -181 -171 11.8882 0.0679
NP_440546.1_4 Reverse -172 -182 10.046 0.109
NP_440462.1_4 Reverse -198 -212 7.76774 0.273
NP_440462.1_6 Reverse -170 -180 17.9746 0.00578
NP_440462.1_6 Reverse -138 -148 3.12662 0.26
NP_440462.1_6 Forward -183 -173 1.35667 0.294
NP_442340.1_3 Reverse -159 -178 -5.70374 0.223
NP_440868.1_4 Reverse -168 -180 9.97041 0.0405
NP_440868.1_4 Forward -185 -173 8.20045 0.0602
NP_442479.1_5 Reverse -359 -378 11.2293 0.222
NP_442402.1_10 Reverse -332 -342 10.501 0.288
NP_442039.1_4 Forward -180 -173 15.1821 0.0124
NP_442039.1_4 Reverse -173 -180 15.1821 0.0124
NP_442039.1_7 Forward -344 -334 11.2881 0.257
NP_442679.1_1 Forward -65 -46 2.3594 0.167
NP_441926.1_3 Forward -338 -322 5.6634 0.17
NP_440825.1_7 Reverse -173 -183 12.9096 0.152
NP_442837.1_3 Forward -180 -173 15.7721 0.0124
NP_442837.1_3 Reverse -173 -180 15.7721 0.0124
NP_442053.1_1 Forward -181 -172 18.3876 0.0007
NP_442053.1_1 Reverse -172 -181 18.3876 0.0007
NP_440505.1_3 Reverse -170 -180 14.1397 0.0235
NP_440505.1_3 Forward -183 -173 9.22315 0.122
NP_440505.1_3 Forward -140 -130 4.40493 0.292
NP_440914.1_1 Reverse -172 -182 17.5935 0.000537
NP_440914.1_1 Forward -181 -171 8.6151 0.186
NP_440914.1_4 Reverse -155 -171 19.3307 0.11
NP_441011.1_8 Forward -180 -171 16.9127 0.00602
NP_441011.1_8 Reverse -173 -182 8.25953 0.144
NP_442533.1_6 Forward -181 -172 17.2076 0.00137
NP_442533.1_6 Reverse -172 -181 17.2076 0.00137
NP_442533.1_6 Forward -243 -234 11.2095 0.046
NP_442533.1_6 Forward -267 -258 3.24465 0.219
NP_442533.1_6 Forward -214 -205 3.04799 0.228
NP_442533.1_6 Forward -208 -199 3.04799 0.228
NP_442533.1_6 Reverse -140 -149 1.86802 0.284
NP_442541.1_4 Reverse -59 -77 13.1947 0.217
NP_442541.1_10 Forward -244 -230 0.687325 0.3
NP_442322.1_4 Forward -222 -205 -7.23831 0.279
NP_442322.1_4 Reverse -154 -171 -10.0899 0.298
NP_440854.1_1 Reverse -348 -367 8.83258 0.152
NP_442229.1_1 Reverse -170 -184 11.7987 0.18
NP_442229.1_1 Forward -183 -169 7.27547 0.196
NP_442229.1_1 Forward -228 -214 5.1122 0.288
NP_441482.1_7 Reverse -166 -180 -8.45687 0.193
NP_439944.1_9 Reverse -173 -183 10.5014 0.0887
NP_439944.1_9 Forward -180 -170 10.4031 0.0887
NP_439944.1_9 Reverse -31 -41 8.53483 0.107
NP_441697.1_5 Forward -374 -355 -9.40638 0.268
NP_441697.1_5 Reverse -357 -376 -9.50187 0.268
NP_441697.1_5 Reverse -356 -375 -11.3162 0.295
NP_441028.1_6 Forward -349 -339 10.6976 0.197
NP_442202.1_6 Reverse -172 -191 -0.197208 0.265
NP_440116.1_8 Reverse -173 -192 8.65258 0.0371
NP_440115.1_6 Reverse -169 -179 10.5998 0.115
NP_440007.1_9 Forward -223 -209 0.392915 0.298
NP_441106.1_1 Reverse -171 -180 18.191 0.0028
NP_441106.1_1 Forward -182 -173 9.63616 0.0311
NP_441106.1_3 Forward -372 -353 10.7175 0.245
NP_441420.1_1 Forward -161 -142 -3.83545 0.292
NP_442588.1_6 Forward -174 -155 -0.000545616 0.255
NP_442306.1_10 Forward -186 -167 -19.8634 0.201
NP_441286.1_1 Forward -182 -170 14.7886 0.00418
NP_441286.1_1 Reverse -171 -183 3.38223 0.0467
NP_442674.1_2 Reverse -6 -25 8.25926 0.261
NP_442674.1_3 Reverse -164 -183 4.62021 0.288
NP_440670.1_8 Forward -181 -172 18.3876 0.000699
NP_440670.1_8 Reverse -172 -181 18.3876 0.000699
NP_440886.1_7 Reverse -171 -181 17.7774 0.0011
NP_440886.1_7 Forward -182 -172 7.94438 0.0805
NP_440886.1_7 Reverse -128 -138 4.20782 0.249
NP_442614.1_2 Reverse -172 -186 14.1593 0.104
NP_442382.1_9 Forward -31 -12 8.55343 0.281
NP_442072.1_9 Forward -182 -164 -22.6953 0.253
NP_440907.2_8 Forward -180 -170 17.4824 0.00685
NP_440907.2_8 Reverse -173 -183 7.64939 0.117
NP_441463.1_6 Forward -183 -169 8.83177 0.25
NP_441463.1_6 Reverse -327 -341 5.44959 0.287
NP_441626.1_2 Forward -180 -173 15.7721 0.0124
NP_441626.1_2 Reverse -173 -180 15.7721 0.0124
NP_442794.1_1 Reverse -168 -180 3.48056 0.286
NP_442794.1_1 Forward -185 -173 2.59558 0.287
NP_442615.1_1 Forward -190 -172 4.34571 0.0472
NP_442615.1_1 Reverse -163 -181 -3.32411 0.159
NP_441962.1_4 Forward -186 -167 -10.522 0.229
NP_441962.1_4 Reverse -167 -186 -10.7186 0.232
NP_440387.1_1 Forward -181 -165 6.54838 0.0282
NP_440387.1_1 Reverse -172 -188 -4.26803 0.181
NP_441431.1_2 Reverse -169 -183 20.4518 0.00685
NP_441836.1_2 Forward -187 -168 -3.14714 0.234
NP_440634.1_9 Forward -375 -357 18.2409 0.208
NP_440814.1_4 Forward -190 -171 -12.7836 0.244
NP_440114.1_10 Reverse -172 -186 7.37441 0.236
NP_440287.1_6 Forward -190 -171 4.03102 0.207
NP_442833.1_1 Forward -336 -322 20.1604 0.0451
NP_440293.1_3 Reverse -198 -217 -2.95047 0.241
NP_440766.1_4 Reverse -168 -182 8.16106 0.0871
NP_440766.1_5 Forward -385 -373 7.36932 0.29
NP_441237.1_9 Reverse -173 -183 14.828 0.0242
NP_439910.1_2 Forward -189 -172 -12.7442 0.0944
NP_440457.1_1 Reverse -168 -180 6.62715 0.116
NP_440798.1_6 Forward -180 -167 1.39592 0.217
NP_440801.1_8 Reverse -261 -280 -1.7705 0.283
NP_441332.1_3 Forward -339 -320 10.2259 0.173
NP_441436.1_6 Forward -181 -162 6.19431 0.29
NP_441436.1_8 Forward -182 -163 8.16093 0.283
NP_442509.1_9 Forward -181 -171 16.2041 0.00739
NP_442509.1_9 Forward -39 -29 8.82935 0.192
NP_442509.1_9 Reverse -172 -182 8.14104 0.192
NP_440554.1_4 Forward -180 -170 13.943 0.0218
NP_441885.1_5 Reverse -172 -182 20.9245 0.000538
NP_441885.1_5 Forward -181 -171 11.4848 0.00668
NP_442341.1_7 Forward -182 -168 20.0591 0.00702
NP_442341.1_7 Reverse -171 -185 14.3559 0.0299
NP_442341.1_9 Reverse -170 -184 8.65209 0.166
NP_441756.1_5 Reverse -168 -187 1.0811 0.219
NP_441173.1_9 Reverse -334 -342 10.9338 0.242
NP_443000.1_7 Forward -183 -173 10.3048 0.0345
NP_443000.1_7 Reverse -170 -180 2.04498 0.226
NP_440507.2_3 Reverse -163 -182 8.25844 0.257
NP_440275.1_3 Reverse -170 -180 17.9746 0.0082
NP_440275.1_3 Forward -183 -173 8.04317 0.0602
NP_440275.1_3 Forward -151 -141 2.24165 0.269
NP_440091.1_1 Reverse -168 -180 3.2839 0.163
NP_440091.1_1 Forward -185 -173 1.31728 0.198
NP_441902.1_3 Forward -133 -123 15.897 0.17
NP_443010.1_10 Forward -82 -65 10.2116 0.125
NP_443010.1_10 Reverse -169 -186 7.11931 0.179
NP_442451.1_2 Reverse -150 -169 -11.4069 0.294
NP_441635.1_5 Forward -26 -12 18.6621 0.192
NP_441122.1_1 Forward -142 -127 3.91314 0.28
NP_441389.1_1 Reverse -161 -180 20.059 0.15
NP_440149.1_8 Forward -181 -162 -6.29373 0.246
NP_441105.1_3 Reverse -161 -180 -9.93197 0.298
NP_442373.1_2 Forward -184 -165 -10.522 0.284
NP_440216.1_1 Forward -181 -167 -2.16369 0.0482
NP_440216.1_1 Reverse -140 -154 -4.03198 0.096
NP_440216.1_1 Reverse -172 -186 -9.53851 0.145
NP_440216.1_1 Forward -160 -146 -11.5051 0.192
NP_440216.1_1 Reverse -129 -143 -12.1934 0.247
NP_440216.1_1 Forward -149 -135 -12.3901 0.264
NP_440216.1_9 Forward -344 -335 11.9961 0.252
NP_440172.1_1 Reverse -172 -182 15.0247 0.00945
NP_440172.1_1 Forward -181 -171 8.73149 0.0586
NP_442371.1_1 Forward -342 -332 14.0409 0.191
NP_442015.1_10 Reverse -168 -181 12.5073 0.0368
NP_442015.1_10 Forward -185 -172 1.49425 0.204
NP_441226.1_7 Forward -180 -173 14.4934 0.0123
NP_441226.1_7 Reverse -173 -180 14.4934 0.0123
NP_441226.1_7 Forward -242 -235 5.64364 0.286
NP_441111.1_7 Forward -180 -172 18.7023 0.00294
NP_441111.1_7 Reverse -173 -181 18.7023 0.00294
NP_441766.1_2 Forward -181 -172 17.5026 0.00297
NP_441766.1_2 Reverse -172 -181 17.5026 0.00297
NP_440416.1_9 Reverse -155 -174 -19.5684 0.276
NP_440416.1_9 Reverse -165 -184 -20.7484 0.288
NP_443052.1_9 Reverse -51 -70 -5.11376 0.265
NP_442116.1_6 Forward -373 -356 5.68616 0.291
NP_440591.1_9 Forward -182 -164 6.60732 0.215
NP_442154.1_1 Forward -174 -156 -6.37237 0.137
NP_440261.1_5 Forward -180 -167 6.50913 0.0332
NP_440261.1_5 Reverse -173 -186 -2.83231 0.0932
NP_440988.1_7 Reverse -187 -206 -1.7705 0.281
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GACGGAGTTATTTACTGGGACAGCAATAAATTGTTTAAATTGTTTTAATGTTTTACCCCTGGGAAAATTGCCTTTTTCTCAAAGGAAGTGTCCCTCTCTGACCTTAAACTGAACCAATATGGCTGATTTGTTTGTCGGTGCCCCAGTTCGTTTAATTGCCCGTCCCCCCTATTTGAAAACCGCTGATCCCATGCCCATGCTCCGTCCTCCGGATTTATTGGCGATCGCCGCGGAGGGAATGGTGGTAGACCGTCGACCGGCTGGCTATTGGGGAGTAAAGTTTGACCGAGGCACTTTTCTGTTGGAAAGCCAGTATTTGGAAGTGATTCGGCCTCAGGAAGAAAAAACGGAAGTCTCGGATTAAGAACGCCGAGTAAATGACCAAGTTTAATCTAAAAAT

CDS

ATGGCATCAACTGTAAATCGCCTTTTTTTAGCAATTTTGACCATAGCCAGCTTCAGCCTTAGTGGAGGTTATGGATATGTTCCCGTTCCCATGGCGATCGCCGCTGACGTCCCAGAACTGACAGCAAAGGTGCCCAATTATTTGGATAAAATCCAATTTCCTCTAGGGGTTATCGATGTCTATGGATTGATGGGCCCAGAGGATGGTAAACGTTCCCAAGGCTATGAATTTTGTGTTGTGCCCGAGAAAAAAAGTGAAGTTTTGGCCATCGATCCCTCACTCACATTTTCGTCTAGCCCTGGTCGCATCGGTTGCCCCCAGGAACAATTACTGTGCCTAGGAGATACCCAGCAACCAAATTGGCAGGCCATTCTCTTTGCCCTGGCCCGGTTGAGTTACATAGAAAAAATCTTGCCCCACTGGGGAGAATAG

Protein

MASTVNRLFLAILTIASFSLSGGYGYVPVPMAIAADVPELTAKVPNYLDKIQFPLGVIDVYGLMGPEDGKRSQGYEFCVVPEKKSEVLAIDPSLTFSSSPGRIGCPQEQLLCLGDTQQPNWQAILFALARLSYIEKILPHWGE