Your browser is old and dusty. Try Google Chrome!

Details for sll1058

ORF sll1058
Accession NP_439964.1
Symbol dapB
Category Aspartate family
Definition dihydrodipicolinate reductase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -301 -287 0.491246 0.207
NP_441061.1_2 Forward -289 -275 -0.492064 0.231
NP_441418.1_6 Reverse -281 -300 -19.9617 0.0997
NP_441453.1_4 Forward -231 -223 4.24765 0.259
NP_441453.1_7 Forward -342 -335 11.9372 0.298
NP_440120.1_4 Reverse -88 -102 14.7492 0.273
NP_440150.1_2 Forward -300 -281 11.3067 0.201
NP_443027.1_4 Reverse -123 -133 8.73149 0.191
NP_441812.1_4 Reverse -186 -204 16.4404 0.253
NP_440784.1_7 Reverse -339 -346 4.26735 0.272
NP_442062.1_8 Reverse -308 -318 6.56821 0.123
NP_442062.1_8 Reverse -222 -232 4.50326 0.212
NP_441900.1_2 Forward -103 -85 6.99988 0.13
NP_441043.1_10 Reverse -22 -36 12.0943 0.296
NP_440304.1_4 Reverse -100 -110 2.14332 0.299
NP_441200.1_4 Reverse -85 -104 5.40766 0.294
NP_441208.1_9 Forward -161 -147 8.35772 0.219
NP_441208.1_9 Reverse -278 -292 6.48943 0.244
NP_442110.1_7 Forward -79 -65 2.85119 0.222
NP_440856.1_4 Reverse -50 -69 -4.52377 0.261
NP_441083.1_5 Forward -140 -130 -1.10161 0.295
NP_441738.1_2 Reverse -283 -290 10.2652 0.101
NP_441558.1_5 Forward -233 -214 8.16093 0.159
NP_440209.1_1 Forward -134 -126 2.08437 0.286
NP_441444.1_1 Forward -107 -88 2.75272 0.295
NP_442889.1_10 Forward -51 -32 13.1174 0.181
NP_441770.1_4 Reverse -126 -145 0.58944 0.178
NP_442570.1_3 Forward -70 -51 -8.35868 0.285
NP_441163.1_9 Reverse -329 -348 17.6007 0.112
NP_440343.1_9 Reverse -298 -317 7.86593 0.278
NP_440747.1_10 Reverse -278 -290 -4.38592 0.0974
NP_441130.1_10 Forward -253 -239 6.09611 0.202
NP_441486.1_1 Reverse -219 -233 -3.44199 0.178
NP_441486.1_1 Forward -65 -51 -6.19526 0.283
NP_441486.1_1 Reverse -335 -349 -6.29359 0.288
NP_439964.1_1 Forward -73 -54 19.0757 0.101
NP_439964.1_10 Forward -28 -14 22.2224 0.143
NP_441014.1_10 Forward -348 -329 0.686995 0.239
NP_442848.1_1 Reverse -125 -139 0.196253 0.263
NP_442848.1_1 Forward -51 -37 -3.24533 0.263
NP_441012.1_4 Reverse -66 -79 11.4257 0.252
NP_443018.1_3 Reverse -126 -133 11.5438 0.0752
NP_443018.1_3 Reverse -223 -230 4.26735 0.267
NP_443018.1_3 Forward -230 -223 4.16902 0.278
NP_440376.1_1 Reverse -222 -231 4.52295 0.156
NP_440376.1_1 Forward -290 -281 3.04799 0.21
NP_440376.1_1 Reverse -308 -317 1.96635 0.236
NP_441588.1_4 Reverse -224 -234 6.07655 0.214
NP_442687.1_7 Reverse -52 -62 13.8447 0.0404
NP_442191.1_4 Reverse -282 -296 13.2231 0.158
NP_441797.1_7 Forward -76 -58 13.5888 0.229
NP_440642.1_10 Forward -106 -92 10.5204 0.169
NP_440642.1_10 Forward -356 -342 3.44058 0.273
NP_442296.1_5 Reverse -55 -74 -0.197208 0.293
NP_442599.1_4 Reverse -73 -92 12.9791 0.259
NP_442782.1_2 Forward -19 -5 6.3911 0.226
NP_442782.1_2 Reverse -216 -230 1.17956 0.282
NP_441958.1_5 Reverse -221 -231 0.668351 0.134
NP_440203.1_5 Forward -228 -218 9.616 0.25
NP_441377.1_3 Reverse -373 -389 21.6913 0.0637
NP_440153.1_8 Forward -231 -218 -1.94734 0.23
NP_442064.1_1 Forward -236 -217 -11.8003 0.262
NP_443055.1_6 Reverse -315 -333 -0.76823 0.266
NP_442002.1_9 Forward -8 -1 11.3472 0.185
NP_442002.1_9 Forward -291 -284 9.47889 0.282
NP_440021.1_3 Reverse -19 -38 14.3558 0.193
NP_442013.1_7 Reverse -131 -150 7.7676 0.299
NP_441294.1_4 Reverse -280 -299 12.7825 0.214
NP_441646.1_1 Forward -324 -305 4.916 0.188
NP_442438.1_10 Reverse -126 -140 7.57108 0.0921
NP_442438.1_10 Reverse -288 -302 5.99778 0.123
NP_440484.1_1 Reverse -289 -308 12.7816 0.191
NP_440147.1_4 Forward -304 -291 4.93583 0.142
NP_441916.1_10 Forward -291 -272 0.0977854 0.292
NP_441041.1_4 Reverse -281 -300 0.687771 0.084
NP_441041.1_4 Forward -140 -121 -12.7836 0.274
NP_441041.1_7 Forward -143 -131 5.95994 0.231
NP_442396.1_5 Forward -351 -338 12.114 0.0913
NP_440703.1_9 Reverse -64 -77 19.6848 0.0529
NP_441725.1_5 Forward -78 -68 0.0783647 0.215
NP_439966.1_7 Forward -136 -126 10.5993 0.0858
NP_442941.1_3 Reverse -339 -349 -0.609952 0.264
NP_442941.1_5 Forward -107 -93 15.5754 0.258
NP_440289.1_2 Forward -143 -130 -1.45568 0.237
NP_440983.1_5 Forward -302 -283 -9.24366 0.3
NP_440983.1_5 Forward -137 -118 -9.24366 0.3
NP_441514.1_6 Reverse -68 -75 12.7238 0.29
NP_442281.1_1 Reverse -276 -290 2.8506 0.253
NP_441556.1_10 Reverse -216 -230 9.54046 0.298
NP_441644.1_6 Forward -231 -221 5.48612 0.188
NP_441644.1_6 Forward -134 -124 3.22451 0.293
NP_441071.1_3 Reverse -249 -268 14.9449 0.146
NP_442215.1_2 Reverse -272 -288 1.82849 0.127
NP_442215.1_2 Forward -81 -65 1.5335 0.132
NP_442215.1_2 Forward -292 -276 0.156866 0.156
NP_442215.1_2 Forward -233 -217 -4.1697 0.228
NP_442029.1_1 Reverse -291 -310 -17.7985 0.272
NP_442029.1_6 Forward -236 -217 9.93088 0.182
NP_442029.1_6 Reverse -275 -294 2.94938 0.286
NP_442933.1_10 Forward -347 -338 5.89959 0.16
NP_442933.1_10 Reverse -222 -231 5.01461 0.204
NP_442554.1_8 Forward -230 -220 5.87989 0.135
NP_442554.1_8 Forward -133 -123 4.89658 0.168
NP_442292.1_1 Forward -230 -221 5.11294 0.162
NP_442292.1_1 Forward -133 -124 4.12963 0.185
NP_442292.1_1 Reverse -339 -348 -0.295266 0.24
NP_443009.1_5 Forward -348 -337 6.35136 0.165
NP_441715.1_4 Reverse -71 -81 5.87989 0.172
NP_440881.1_3 Forward -301 -282 18.3865 0.158
NP_441468.1_1 Reverse -223 -230 4.36568 0.237
NP_441468.1_1 Reverse -126 -133 4.07068 0.263
NP_441015.1_10 Reverse -288 -307 5.40766 0.115
NP_441015.1_10 Reverse -291 -310 -10.227 0.283
NP_441673.1_1 Reverse -338 -347 -8.06341 0.254
NP_441731.1_9 Reverse -294 -311 10.3636 0.292
NP_441826.1_2 Forward -140 -126 -0.393733 0.212
NP_441826.1_2 Forward -289 -275 -4.22864 0.293
NP_441330.1_9 Reverse -243 -262 13.4708 0.2
NP_442719.1_2 Reverse -10 -28 -6.66806 0.226
NP_443058.1_7 Reverse -280 -299 13.5691 0.184
NP_443058.1_7 Reverse -118 -137 7.66927 0.232
NP_441882.1_6 Forward -355 -336 -4.42544 0.277
NP_440145.1_4 Forward -301 -291 14.0409 0.264
NP_442542.1_9 Reverse -118 -132 8.25877 0.166
NP_441518.1_4 Reverse -318 -337 2.16195 0.288
NP_441878.1_6 Reverse -221 -231 -7.29646 0.217
NP_441036.1_8 Reverse -337 -347 15.0247 0.0137
NP_441036.1_8 Reverse -356 -366 7.15819 0.208
NP_441557.1_5 Reverse -222 -231 -0.590259 0.219
NP_441557.1_5 Forward -347 -338 -0.68859 0.229
NP_441590.1_4 Forward -317 -298 9.24175 0.249
NP_441590.1_6 Forward -234 -215 12.1917 0.245
NP_441458.1_10 Reverse -329 -348 1.67108 0.285
NP_440595.1_9 Reverse -297 -316 9.53756 0.187
NP_440547.1_8 Forward -349 -330 12.9791 0.298
NP_442594.1_8 Reverse -291 -310 9.93088 0.185
NP_440136.1_2 Reverse -339 -346 4.26735 0.218
NP_442998.1_5 Reverse -200 -210 12.0747 0.176
NP_442998.1_5 Forward -143 -133 10.7964 0.204
NP_442998.1_5 Forward -374 -364 8.4365 0.263
NP_440299.1_1 Forward -306 -293 6.0169 0.155
NP_440299.1_1 Forward -351 -338 3.65697 0.237
NP_440299.1_1 Reverse -127 -140 3.55864 0.241
NP_441799.1_1 Reverse -277 -291 11.307 0.0591
NP_441799.1_1 Reverse -218 -232 5.40719 0.21
NP_441799.1_1 Forward -235 -221 4.42388 0.25
NP_441007.1_10 Reverse -120 -133 -0.177378 0.268
NP_440256.1_1 Forward -350 -331 -4.52377 0.158
NP_440256.1_1 Forward -86 -67 -9.44032 0.28
NP_440915.1_6 Reverse -334 -348 -0.885388 0.212
NP_442866.1_1 Forward -84 -65 -2.85214 0.216
NP_442386.1_9 Forward -232 -223 11.3073 0.0971
NP_442386.1_9 Reverse -337 -346 5.9975 0.23
NP_442386.1_9 Forward -135 -126 4.62087 0.294
NP_441750.1_1 Reverse -287 -306 -13.3736 0.3
NP_441340.1_5 Forward -230 -223 4.07068 0.239
NP_440146.1_8 Forward -249 -231 16.1474 0.255
NP_440586.1_1 Reverse -115 -134 -5.9004 0.291
NP_440586.1_8 Reverse -126 -133 10.9535 0.119
NP_440586.1_8 Forward -230 -223 7.70858 0.227
NP_441262.1_3 Reverse -125 -132 5.34899 0.181
NP_443051.1_1 Reverse -221 -230 0.29472 0.195
NP_440408.1_7 Forward -290 -271 7.7676 0.284
NP_441789.1_7 Reverse -155 -174 -5.40949 0.298
NP_440819.1_5 Forward -122 -114 7.8859 0.266
NP_442488.1_1 Forward -350 -331 14.6508 0.0993
NP_439977.1_5 Reverse -332 -351 3.53937 0.159
NP_440139.1_1 Forward -85 -66 0.785326 0.281
NP_441155.1_10 Forward -313 -294 19.6648 0.157
NP_442384.1_7 Forward -267 -253 16.9125 0.216
NP_442384.1_10 Forward -231 -218 2.37923 0.228
NP_441018.1_7 Reverse -211 -230 6.29264 0.294
NP_442262.1_10 Reverse -126 -133 11.7405 0.0841
NP_440344.1_6 Reverse -159 -173 19.4691 0.128
NP_440344.1_10 Reverse -331 -348 -0.846137 0.0466
NP_440344.1_10 Forward -297 -280 -9.10594 0.139
NP_440344.1_10 Forward -354 -337 -13.6292 0.29
NP_441640.1_8 Reverse -282 -301 -6.29373 0.299
NP_440894.1_10 Forward -145 -126 10.9142 0.155
NP_440999.1_9 Reverse -248 -262 11.111 0.0474
NP_440999.1_9 Reverse -334 -348 5.01447 0.114
NP_440600.1_4 Forward -239 -221 5.72234 0.105
NP_442277.1_2 Reverse -321 -335 9.83269 0.297
NP_441543.1_2 Forward -230 -221 4.22796 0.267
NP_442845.1_2 Reverse -216 -230 5.89945 0.22
NP_442845.1_2 Forward -353 -339 5.80112 0.224
NP_442845.1_2 Forward -237 -223 4.32615 0.261
NP_441258.1_9 Forward -137 -118 11.2092 0.192
NP_441306.1_10 Forward -81 -67 11.1104 0.273
NP_442578.1_7 Reverse -126 -133 5.15232 0.291
NP_440071.1_5 Reverse -65 -84 13.4708 0.179
NP_441621.1_4 Reverse -21 -34 15.5556 0.246
NP_442204.1_1 Reverse -121 -132 1.33697 0.274
NP_442204.1_1 Reverse -289 -300 0.550326 0.281
NP_442204.1_5 Reverse -49 -68 7.47261 0.128
NP_442428.1_5 Reverse -223 -230 4.66067 0.244
NP_442428.1_5 Reverse -126 -133 4.46401 0.267
NP_442120.1_10 Forward -283 -264 -15.7335 0.294
NP_440673.1_3 Forward -60 -53 7.02061 0.274
NP_442219.1_8 Forward -144 -125 10.5829 0.202
NP_442219.1_9 Reverse -223 -232 5.80125 0.113
NP_440436.1_4 Forward -346 -337 11.3073 0.0574
NP_441884.1_9 Forward -143 -124 -23.2067 0.284
NP_442864.1_2 Forward -139 -120 12.2908 0.246
NP_441719.1_4 Reverse -126 -133 3.77569 0.285
NP_441004.1_1 Reverse -287 -306 -14.5535 0.268
NP_441004.1_1 Reverse -275 -294 -14.7502 0.27
NP_441004.1_1 Reverse -224 -243 -14.8485 0.271
NP_441004.1_1 Forward -71 -52 -15.8318 0.279
NP_441004.1_1 Reverse -281 -300 -16.2252 0.283
NP_441004.1_2 Reverse -219 -238 6.98095 0.175
NP_441004.1_2 Forward -76 -57 -0.39387 0.258
NP_441004.1_4 Forward -68 -58 8.23984 0.28
NP_441004.1_5 Reverse -226 -240 8.16106 0.276
NP_442366.1_3 Forward -291 -273 3.95239 0.102
NP_442366.1_3 Reverse -214 -232 -2.73412 0.232
NP_442366.1_3 Forward -387 -369 -4.8974 0.278
NP_440129.1_10 Forward -297 -283 11.8976 0.0945
NP_443054.1_2 Forward -285 -271 0.294584 0.269
NP_441851.1_10 Forward -348 -338 5.5849 0.207
NP_441501.1_1 Forward -67 -48 15.7316 0.115
NP_442856.1_7 Reverse -329 -348 -1.47551 0.226
NP_441668.1_4 Reverse -271 -290 7.47261 0.151
NP_441668.1_4 Forward -357 -338 0.392778 0.241
NP_441668.1_4 Reverse -60 -79 0.196116 0.245
NP_440593.1_3 Reverse -250 -269 -6.78538 0.28
NP_441349.1_10 Forward -357 -338 -9.53865 0.294
NP_441349.1_10 Forward -72 -53 -9.83364 0.297
NP_439960.1_4 Reverse -286 -305 17.7965 0.125
NP_440431.1_4 Reverse -378 -397 -5.87318 0.248
NP_440943.1_4 Forward -35 -23 14.297 0.297
NP_442006.1_2 Reverse -116 -133 -15.3008 0.221
NP_441078.1_4 Reverse -222 -231 -1.96689 0.282
NP_440526.1_3 Forward -301 -290 5.85971 0.229
NP_440526.1_3 Reverse -132 -143 0.353199 0.287
NP_441432.1_8 Reverse -221 -230 11.3078 0.0569
NP_441432.1_8 Reverse -280 -289 5.21127 0.185
NP_442320.1_8 Forward -353 -339 -5.90027 0.254
NP_441945.1_10 Reverse -280 -299 14.8474 0.168
NP_441057.1_3 Reverse -300 -319 -11.2103 0.223
NP_441057.1_4 Reverse -292 -310 1.39578 0.253
NP_442968.1_8 Forward -82 -63 11.7008 0.285
NP_441072.1_2 Reverse -211 -230 8.06259 0.24
NP_440713.1_4 Reverse -287 -306 3.53937 0.242
NP_442489.1_7 Reverse -222 -231 -1.47524 0.203
NP_442489.1_7 Forward -290 -281 -1.57357 0.213
NP_441659.2_8 Forward -231 -221 7.25653 0.0622
NP_442913.1_10 Reverse -116 -135 4.22769 0.0922
NP_442913.1_10 Reverse -265 -284 -2.85214 0.192
NP_441040.1_2 Reverse -279 -298 -15.3402 0.286
NP_441040.1_2 Reverse -152 -171 -16.1268 0.294
NP_441040.1_5 Forward -307 -288 6.88262 0.229
NP_441040.1_5 Reverse -48 -67 3.24438 0.275
NP_442346.1_5 Reverse -52 -62 9.51814 0.118
NP_442346.1_5 Reverse -221 -231 5.48657 0.243
NP_442346.1_5 Reverse -292 -302 4.40493 0.29
NP_440545.1_3 Forward -138 -121 -6.746 0.287
NP_441629.1_3 Forward -238 -219 -4.72118 0.297
NP_440459.1_2 Reverse -213 -230 12.1336 0.158
NP_440459.1_2 Forward -292 -275 10.5603 0.196
NP_440010.1_3 Reverse -113 -132 -4.91709 0.25
NP_439970.1_4 Reverse -355 -374 3.83436 0.205
NP_441047.1_2 Reverse -54 -73 -2.65548 0.281
NP_442140.1_3 Reverse -294 -304 3.71661 0.283
NP_442723.1_1 Forward -109 -90 2.16195 0.291
NP_440875.1_9 Forward -132 -122 9.24806 0.233
NP_441813.1_5 Reverse -336 -346 -0.511621 0.247
NP_440590.1_4 Reverse -339 -352 -0.177378 0.179
NP_442497.1_4 Reverse -121 -140 12.6523 0.271
NP_441892.1_1 Reverse -116 -133 -4.09106 0.255
NP_440665.1_1 Forward -302 -283 -11.9969 0.244
NP_441782.1_1 Reverse -89 -108 16.7744 0.292
NP_440462.1_6 Reverse -336 -346 5.38824 0.156
NP_440868.1_4 Forward -138 -126 5.34885 0.101
NP_442499.1_1 Reverse -126 -145 4.32602 0.243
NP_440341.1_7 Forward -210 -196 11.8976 0.226
NP_440696.1_3 Forward -363 -345 -3.81576 0.29
NP_442882.1_7 Forward -34 -20 13.9619 0.261
NP_442039.1_4 Forward -346 -339 9.47889 0.145
NP_442039.1_7 Reverse -224 -234 6.96153 0.286
NP_440825.1_6 Reverse -294 -313 13.6675 0.244
NP_442837.1_3 Forward -346 -339 9.38056 0.132
NP_442053.1_1 Reverse -338 -347 4.52295 0.242
NP_440351.1_8 Reverse -150 -168 6.01734 0.26
NP_441252.1_6 Reverse -50 -57 14.3954 0.168
NP_441252.1_6 Forward -10 -3 11.9372 0.25
NP_441203.1_1 Forward -78 -59 -20.5517 0.297
NP_442009.1_9 Reverse -7 -26 7.96426 0.277
NP_440914.1_1 Forward -289 -279 6.07773 0.297
NP_441011.1_8 Forward -65 -56 5.3096 0.271
NP_441011.1_8 Forward -346 -337 5.11294 0.283
NP_442533.1_1 Forward -24 -5 -12.6852 0.236
NP_442533.1_1 Reverse -293 -312 -15.6352 0.257
NP_442533.1_6 Forward -347 -338 5.11294 0.155
NP_442533.1_6 Reverse -222 -231 4.81794 0.172
NP_442533.1_6 Reverse -70 -79 1.37636 0.3
NP_442229.1_1 Reverse -291 -305 5.80051 0.25
NP_441482.1_7 Reverse -64 -78 -9.34185 0.198
NP_442664.1_8 Forward -321 -302 12.4867 0.233
NP_440007.1_9 Forward -255 -241 6.19444 0.231
NP_440007.1_9 Forward -293 -279 1.37622 0.285
NP_441602.1_3 Reverse -275 -294 10.3242 0.116
NP_441602.1_4 Reverse -353 -372 11.1109 0.278
NP_441972.1_3 Forward -159 -140 11.3075 0.284
NP_441106.1_1 Reverse -221 -230 5.80125 0.124
NP_441106.1_1 Reverse -337 -346 4.81794 0.202
NP_442588.1_6 Reverse -66 -85 -0.197208 0.262
NP_440444.1_6 Reverse -201 -214 17.4239 0.228
NP_440444.1_10 Reverse -21 -40 15.3382 0.167
NP_441286.1_1 Reverse -130 -142 2.10393 0.0737
NP_440670.1_8 Forward -290 -281 5.40793 0.158
NP_440670.1_8 Forward -140 -131 3.53964 0.257
NP_440886.1_7 Forward -225 -215 5.58445 0.175
NP_442614.1_2 Forward -290 -276 6.98109 0.276
NP_442072.1_9 Forward -284 -266 -14.1405 0.133
NP_442072.1_9 Reverse -214 -232 -16.1071 0.196
NP_442072.1_9 Forward -232 -214 -22.1053 0.22
NP_442401.1_3 Reverse -293 -312 17.0107 0.175
NP_441463.1_3 Reverse -32 -51 -6.09707 0.239
NP_442842.1_8 Forward -172 -153 17.8782 0.125
NP_442893.1_4 Forward -367 -348 4.62021 0.177
NP_442615.1_1 Reverse -206 -224 0.21581 0.106
NP_442615.1_1 Reverse -272 -290 -4.70074 0.192
NP_441836.1_2 Forward -308 -289 -0.688862 0.214
NP_442805.1_5 Forward -315 -296 -4.91784 0.269
NP_440293.1_9 Reverse -269 -283 12.214 0.247
NP_440766.1_4 Reverse -289 -303 0.294584 0.291
NP_440766.1_6 Forward -169 -150 13.1758 0.26
NP_439910.1_2 Reverse -349 -366 -22.3806 0.232
NP_440457.1_1 Reverse -121 -133 1.61227 0.232
NP_440798.1_6 Forward -230 -217 3.26421 0.151
NP_441801.1_6 Forward -320 -301 17.8948 0.0667
NP_441984.1_3 Reverse -211 -229 4.83737 0.3
NP_442514.1_5 Reverse -56 -75 -4.62285 0.244
NP_442514.1_5 Reverse -169 -188 -7.57277 0.276
NP_440554.1_4 Forward -133 -123 4.10993 0.201
NP_441885.1_5 Reverse -222 -232 0.373358 0.164
NP_441885.1_5 Forward -290 -280 -0.609952 0.215
NP_441885.1_5 Forward -347 -337 -1.59326 0.273
NP_442341.1_7 Reverse -280 -294 6.6861 0.12
NP_441173.1_9 Forward -234 -226 12.1137 0.21
NP_441842.1_10 Reverse -118 -132 11.7993 0.119
NP_441842.1_10 Reverse -286 -300 9.43936 0.192
NP_442451.1_2 Reverse -123 -142 -9.24366 0.259
NP_441105.1_3 Forward -242 -223 -7.37537 0.251
NP_441105.1_3 Reverse -269 -288 -9.24366 0.286
NP_440216.1_1 Forward -231 -217 -11.5051 0.192
NP_440216.1_9 Reverse -66 -75 6.78456 0.289
NP_440172.1_1 Reverse -222 -232 4.99491 0.157
NP_442015.1_10 Forward -202 -189 3.85419 0.178
NP_441226.1_7 Forward -230 -223 11.2485 0.0971
NP_441111.1_7 Reverse -339 -347 -0.472234 0.131
NP_441111.1_7 Forward -230 -222 -0.570565 0.233
NP_440416.1_9 Reverse -273 -292 -9.73531 0.134
NP_440416.1_9 Forward -297 -278 -15.7335 0.198
NP_440416.1_9 Reverse -286 -305 -18.7818 0.264
NP_440416.1_9 Forward -354 -335 -20.65 0.287
NP_443052.1_9 Forward -300 -281 -3.04881 0.245
NP_442154.1_1 Reverse -294 -312 -15.3205 0.218
NP_442564.1_9 Reverse -160 -174 14.122 0.256
NP_440988.1_10 Forward -253 -239 5.67333 0.24
NP_440988.1_10 Forward -136 -122 4.22114 0.27
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACAACTTTGATAACCTCGTTCTTCAATGTCCAAAACCGATCTTGGTTTACTTTGGCGCTCCCTGGTGCGGACTATGTCACTTTGTCAAACCCCTGCTCAACCATCTCCACGGCGAATGGCAAGAGCAACTCGTTTGTGTGGAGGTTAATGCTGATGTCAACCTGCATTTAGCCAACGCCTACCGCTTAAAAAATCTTCCCACTCTGATCCTCTTTAACCGTGGTCAGGTGATTCAACGGCTAGAGGATTTTCGGGTTAGGGAAGATCTCCATCGCATCCGGGAACAAATAGCAGTTTCCCTTTTCTCTCCCTGAACCATCCAGTGCTTGCCCTGGGTTAACGGTTGCCCAACAATGGAGAGATTAATCAGTTGAGCAATTCGGATAAAGCTGGGGCAATT

CDS

ATGGCTAATCAAGATTTAATTCCTGTGGTAGTGAACGGTGCGGCTGGAAAAATGGGCCGGGAAGTAATTAAAGCCGTAGCCCAAGCCCCCGATCTCCAATTGGTGGGGGCAGTGGATCATAATCCCAGTCTCCAAGGTCAAGACATTGGCGAAGTGGTGGGCATTGCCCCCCTGGAAGTTCCTGTCTTAGCTGATCTCCAGAGTGTGTTGGTGTTGGCCACCCAGGAAAAAATTCAAGGGGTAATGGTGGACTTCACCCATCCCAGCGGCGTTTATGACAATGTTCGTTCGGCGATCGCCTATGGGGTGCGGCCAGTGGTGGGTACCACCGGATTGAGTGAGCAACAAATCCAAGACCTAGGGGATTTTGCTGAAAAAGCTAGTACAGGTTGTCTGATTGCCCCTAACTTTGCCATTGGAGTTCTGTTGATGCAACAAGCTGCTGTGCAAGCCTGCCAATACTTTGACCACGTGGAAATTATCGAATTACACCATAACCAGAAAGCCGACGCCCCTAGCGGCACTGCCATTAAAACCGCCCAAATGTTAGCGGAAATGGGCAAAACATTTAACCCACCGGCCGTAGAAGAAAAGGAAACCATTGCGGGAGCTAAGGGAGGACTAGGGCCAGGGCAAATTCCCATCCACAGCATTCGTTTACCGGGGCTAATCGCCCATCAAGAAGTCCTATTTGGTTCCCCAGGGCAACTTTATACCATCCGTCACGACACCACCGACCGGGCTTGCTATATGCCGGGGGTACTTTTAGGCATTCGTAAAGTGGTAGAACTGAAGGGCTTAGTTTACGGTCTGGAAAAACTACTCTAG

Protein

MANQDLIPVVVNGAAGKMGREVIKAVAQAPDLQLVGAVDHNPSLQGQDIGEVVGIAPLEVPVLADLQSVLVLATQEKIQGVMVDFTHPSGVYDNVRSAIAYGVRPVVGTTGLSEQQIQDLGDFAEKASTGCLIAPNFAIGVLLMQQAAVQACQYFDHVEIIELHHNQKADAPSGTAIKTAQMLAEMGKTFNPPAVEEKETIAGAKGGLGPGQIPIHSIRLPGLIAHQEVLFGSPGQLYTIRHDTTDRACYMPGVLLGIRKVVELKGLVYGLEKLL