Your browser is old and dusty. Try Google Chrome!

Details for sll1051

ORF sll1051
Accession NP_439974.1
Symbol cpcF
Category Phycobilisome
Definition phycocyanin alpha-subunit phycocyanobilin lyase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -164 -178 -0.393733 0.228
NP_441418.1_6 Reverse -351 -370 -29.4015 0.224
NP_441623.1_1 Reverse -175 -193 4.24738 0.184
NP_442151.1_6 Forward -244 -230 9.2427 0.155
NP_443043.1_10 Reverse -353 -372 5.60432 0.19
NP_441818.1_9 Reverse -358 -377 -0.4922 0.196
NP_441818.1_9 Forward -78 -59 -8.06369 0.274
NP_440931.1_7 Reverse -102 -120 11.5231 0.258
NP_442655.1_2 Reverse -334 -353 0.884433 0.291
NP_443002.1_5 Forward -315 -297 11.3264 0.247
NP_442062.1_3 Forward -57 -38 0.58944 0.237
NP_442062.1_8 Forward -223 -213 3.51995 0.267
NP_441859.1_2 Reverse -164 -183 11.405 0.215
NP_441859.1_3 Forward -376 -357 2.9486 0.253
NP_439918.1_2 Forward -190 -171 -2.55715 0.244
NP_441208.1_1 Forward -65 -46 1.17943 0.245
NP_442742.1_9 Reverse -1 -20 -14.1602 0.293
NP_442475.1_5 Reverse -223 -242 16.3224 0.287
NP_441925.1_4 Forward -359 -340 -16.5208 0.284
NP_441083.1_3 Forward -361 -351 12.7626 0.248
NP_441083.1_5 Forward -208 -198 4.10993 0.158
NP_441434.1_7 Forward -358 -344 1.57289 0.299
NP_442889.1_1 Forward -112 -93 -10.9153 0.217
NP_441713.1_5 Forward -370 -351 25.7622 0.00877
NP_441713.1_8 Forward -121 -103 7.29564 0.294
NP_442570.1_3 Forward -181 -162 -3.93378 0.225
NP_442570.1_3 Reverse -77 -96 -6.49039 0.258
NP_441792.1_5 Reverse -56 -72 8.71166 0.258
NP_441598.1_1 Reverse -54 -73 6.09597 0.295
NP_441163.1_1 Reverse -248 -265 6.62629 0.254
NP_441486.1_1 Forward -226 -212 -4.22864 0.192
NP_442634.1_2 Forward -133 -114 -0.197208 0.293
NP_442848.1_5 Reverse -54 -72 -1.94747 0.276
NP_443018.1_3 Reverse -115 -122 10.2655 0.107
NP_443018.1_3 Forward -390 -383 7.11894 0.16
NP_441634.1_9 Forward -122 -103 11.3067 0.252
NP_442687.1_7 Reverse -350 -360 13.1564 0.0574
NP_442485.1_3 Forward -312 -293 -4.6221 0.285
NP_441013.1_2 Reverse -103 -121 -0.669169 0.274
NP_440181.1_2 Forward -371 -353 18.0137 0.0812
NP_440141.1_8 Forward -238 -219 4.22769 0.292
NP_439968.1_8 Forward -370 -354 14.7098 0.204
NP_439968.1_8 Reverse -354 -370 13.2349 0.269
NP_442300.1_4 Forward -125 -106 18.2882 0.152
NP_441127.1_5 Reverse -254 -273 13.6679 0.274
NP_440203.1_5 Reverse -258 -268 10.206 0.235
NP_439905.1_1 Reverse -58 -71 7.29578 0.263
NP_439990.1_5 Reverse -293 -306 7.09911 0.212
NP_443055.1_6 Forward -360 -342 9.26148 0.137
NP_441646.1_1 Forward -359 -340 0.294447 0.252
NP_442438.1_10 Forward -365 -351 -0.885388 0.283
NP_440484.1_6 Forward -328 -309 9.63589 0.225
NP_441547.1_2 Forward -76 -58 2.96908 0.292
NP_441725.1_5 Reverse -256 -266 0.275027 0.192
NP_442281.1_1 Reverse -224 -238 8.55376 0.0798
NP_442281.1_1 Reverse -109 -123 4.62054 0.187
NP_441087.1_6 Forward -361 -343 7.68819 0.233
NP_441556.1_7 Reverse -381 -400 -0.984623 0.3
NP_440375.1_8 Forward -122 -103 3.73603 0.213
NP_441644.1_6 Forward -391 -381 3.22451 0.293
NP_442215.1_2 Forward -400 -384 -1.51476 0.186
NP_442215.1_2 Forward -225 -209 -5.54633 0.251
NP_442215.1_2 Reverse -349 -365 -5.74299 0.256
NP_442215.1_2 Reverse -105 -121 -7.51295 0.297
NP_442247.1_8 Reverse -296 -310 11.5043 0.247
NP_442142.1_4 Forward -304 -291 4.93527 0.206
NP_443009.1_5 Forward -266 -255 10.3829 0.0792
NP_442408.2_1 Forward -208 -189 -5.31042 0.27
NP_440464.1_10 Reverse -215 -225 11.5758 0.298
NP_441020.2_6 Reverse -253 -270 11.7402 0.112
NP_441020.2_6 Reverse -296 -313 5.84037 0.289
NP_441673.1_1 Forward -360 -351 -8.06341 0.254
NP_441876.1_9 Reverse -53 -63 13.7459 0.267
NP_441826.1_2 Reverse -351 -365 -2.75368 0.275
NP_442490.1_9 Reverse -339 -358 -7.57203 0.278
NP_442868.1_6 Reverse -349 -359 -0.314959 0.284
NP_442719.1_2 Reverse -49 -67 -11.8796 0.297
NP_442808.1_1 Reverse -56 -66 3.32285 0.244
NP_441101.1_7 Forward -368 -349 12.6841 0.29
NP_441101.1_10 Forward -360 -341 -0.000545616 0.184
NP_442542.1_9 Reverse -351 -365 6.0955 0.252
NP_440342.1_1 Reverse -335 -354 13.7658 0.207
NP_440558.1_2 Forward -357 -338 1.17943 0.183
NP_441878.1_6 Reverse -350 -360 -0.118297 0.167
NP_441878.1_6 Forward -361 -351 -7.19813 0.21
NP_441878.1_6 Reverse -344 -354 -7.88644 0.278
NP_441590.1_4 Reverse -58 -77 7.07848 0.251
NP_442579.1_6 Forward -309 -290 11.2092 0.144
NP_442135.1_4 Reverse -275 -294 17.9217 0.224
NP_442494.1_7 Forward -121 -102 1.47442 0.246
NP_441549.1_9 Forward -110 -92 -8.83064 0.238
NP_442347.1_2 Reverse -53 -62 5.99792 0.201
NP_442347.1_2 Reverse -215 -224 4.81794 0.257
NP_442645.1_2 Forward -114 -95 -13.4719 0.154
NP_440547.1_1 Forward -371 -352 15.5349 0.127
NP_442590.1_9 Reverse -291 -310 11.3075 0.223
NP_442590.1_9 Forward -182 -163 5.80098 0.267
NP_442998.1_5 Reverse -162 -172 11.0914 0.196
NP_440299.1_1 Reverse -110 -123 4.34528 0.209
NP_442333.2_5 Forward -371 -352 -13.9635 0.271
NP_442333.2_5 Reverse -171 -190 -15.3402 0.291
NP_440256.1_1 Reverse -348 -367 -8.65367 0.264
NP_441559.1_8 Reverse -251 -265 3.24451 0.143
NP_441559.1_8 Reverse -103 -117 -5.40861 0.261
NP_441559.1_8 Forward -270 -256 -7.57189 0.295
NP_441270.1_5 Reverse -357 -376 10.9448 0.296
NP_440915.1_6 Reverse -86 -100 -2.16369 0.26
NP_441704.1_8 Forward -234 -215 5.89851 0.273
NP_442866.1_1 Forward -334 -315 -5.9004 0.245
NP_441464.1_8 Forward -353 -339 4.81781 0.263
NP_442993.1_1 Reverse -90 -106 -4.66135 0.141
NP_442993.1_1 Forward -360 -344 -12.1345 0.266
NP_440677.1_6 Reverse -190 -209 17.6007 0.116
NP_442386.1_9 Reverse -255 -264 5.60418 0.245
NP_441750.1_4 Forward -313 -294 3.34271 0.233
NP_442791.1_9 Reverse -173 -192 13.47 0.234
NP_440327.1_6 Forward -241 -222 3.73603 0.28
NP_440586.1_8 Reverse -115 -122 9.08521 0.178
NP_442239.1_8 Reverse -357 -376 5.70265 0.266
NP_442239.1_8 Reverse -163 -182 4.916 0.288
NP_442511.1_6 Forward -172 -153 10.3242 0.202
NP_441803.1_2 Forward -375 -356 3.83436 0.189
NP_441018.1_7 Forward -333 -314 6.19431 0.297
NP_442262.1_10 Reverse -115 -122 9.18389 0.211
NP_442262.1_10 Forward -390 -383 8.20058 0.25
NP_440531.1_6 Forward -131 -112 2.94938 0.148
NP_440531.1_8 Forward -193 -174 4.22769 0.269
NP_441965.1_10 Forward -268 -252 2.12349 0.289
NP_440297.1_9 Reverse -256 -266 3.61828 0.263
NP_442280.1_10 Reverse -104 -122 5.55182 0.283
NP_441592.1_4 Forward -360 -341 -2.26216 0.261
NP_441896.1_5 Forward -323 -316 12.2322 0.273
NP_440894.1_10 Reverse -371 -390 5.01433 0.24
NP_440894.1_10 Reverse -4 -23 3.53937 0.271
NP_440999.1_9 Reverse -347 -361 -3.63866 0.299
NP_440888.1_2 Reverse -351 -365 7.66879 0.186
NP_440888.1_2 Forward -265 -251 7.17714 0.205
NP_440888.1_2 Forward -99 -85 7.17714 0.205
NP_442845.1_2 Forward -118 -104 11.701 0.124
NP_442845.1_2 Reverse -108 -122 5.99778 0.219
NP_439904.1_4 Forward -198 -179 19.1693 0.172
NP_443062.1_1 Forward -123 -105 8.54592 0.152
NP_443062.1_6 Forward -368 -349 9.53756 0.125
NP_440516.1_2 Forward -133 -115 2.96908 0.159
NP_440783.1_5 Reverse -333 -352 0.491109 0.209
NP_442120.1_10 Reverse -280 -299 -14.5535 0.288
NP_441004.1_1 Reverse -339 -358 -14.7502 0.27
NP_441004.1_2 Forward -69 -50 -2.95047 0.269
NP_441231.1_1 Forward -78 -59 19.0757 0.234
NP_442694.1_4 Forward -78 -69 10.8161 0.294
NP_442622.1_3 Reverse -224 -243 4.22769 0.215
NP_442856.1_7 Forward -98 -79 -0.787193 0.21
NP_442515.1_1 Reverse -234 -248 -3.34366 0.29
NP_439950.1_1 Forward -193 -184 14.4544 0.224
NP_440195.1_4 Reverse -10 -29 5.60432 0.284
NP_440195.1_4 Forward -372 -353 4.42435 0.295
NP_440943.1_4 Forward -289 -277 18.5252 0.0959
NP_442006.1_2 Reverse -220 -237 -9.89259 0.197
NP_440483.1_1 Forward -71 -52 -2.75381 0.208
NP_441570.1_1 Reverse -351 -369 -11.6822 0.201
NP_441570.1_1 Forward -244 -226 -11.7806 0.203
NP_441570.1_1 Forward -208 -190 -17.5821 0.283
NP_441078.1_4 Forward -360 -351 -1.77023 0.266
NP_442443.1_1 Forward -180 -161 9.83255 0.108
NP_441030.1_6 Forward -101 -82 12.9477 0.23
NP_440913.1_1 Reverse -349 -367 6.31233 0.228
NP_441072.1_2 Forward -110 -91 5.50599 0.296
NP_442489.1_7 Forward -360 -351 -1.08191 0.179
NP_441659.2_8 Reverse -351 -361 9.81313 0.0269
NP_441040.1_2 Forward -362 -343 -15.6352 0.286
NP_441040.1_5 Reverse -92 -111 4.81767 0.244
NP_439956.1_7 Reverse -250 -269 2.65439 0.273
NP_439956.1_7 Forward -123 -104 0.982764 0.292
NP_442008.1_2 Forward -180 -161 2.26107 0.295
NP_440708.1_6 Reverse -40 -59 -0.0988766 0.188
NP_442346.1_1 Forward -78 -59 12.7825 0.27
NP_442346.1_5 Reverse -350 -360 11.5831 0.0634
NP_441856.1_6 Reverse -356 -370 14.8476 0.265
NP_441629.1_3 Reverse -8 -27 -0.0996487 0.238
NP_440459.1_2 Forward -125 -108 7.217 0.299
NP_441653.1_2 Forward -371 -352 3.14308 0.274
NP_441233.1_1 Forward -237 -218 9.14423 0.28
NP_441585.1_5 Reverse -174 -193 -0.689632 0.296
NP_441888.1_7 Forward -347 -333 0.982901 0.272
NP_440449.1_6 Reverse -49 -67 9.52025 0.174
NP_440449.1_6 Forward -107 -89 7.86678 0.208
NP_440671.1_4 Reverse -351 -365 7.47274 0.217
NP_440875.1_9 Forward -389 -379 7.30133 0.269
NP_440875.1_9 Forward -97 -87 6.81464 0.297
NP_441951.1_9 Forward -180 -161 0.196116 0.261
NP_440400.1_1 Reverse -18 -37 0.686995 0.27
NP_441892.1_1 Reverse -105 -122 -0.157821 0.179
NP_440665.1_1 Forward -372 -353 -3.83545 0.186
NP_442643.1_3 Forward -122 -103 -6.29373 0.261
NP_442629.1_3 Reverse -362 -381 3.6377 0.275
NP_440949.1_7 Reverse -221 -240 8.25844 0.293
NP_440055.1_2 Forward -234 -215 11.6025 0.205
NP_440812.1_10 Reverse -158 -171 16.6372 0.259
NP_441848.1_4 Forward -148 -132 7.45517 0.288
NP_442696.1_6 Reverse -315 -334 -3.04881 0.147
NP_440160.1_2 Forward -59 -40 -8.752 0.288
NP_440505.1_3 Forward -108 -98 14.4347 0.0217
NP_441959.1_5 Reverse -45 -64 7.66927 0.26
NP_440520.1_9 Reverse -169 -188 17.5024 0.119
NP_440914.1_1 Reverse -256 -266 8.41992 0.191
NP_440914.1_1 Reverse -320 -330 6.46809 0.279
NP_442533.1_6 Forward -360 -351 4.0313 0.194
NP_442533.1_6 Forward -353 -344 2.06468 0.275
NP_442533.1_6 Forward -99 -90 2.06468 0.275
NP_442541.1_10 Forward -354 -340 0.687325 0.3
NP_442322.1_4 Reverse -54 -71 -1.43681 0.226
NP_441482.1_7 Forward -270 -256 -9.93184 0.209
NP_440007.1_9 Forward -268 -254 5.1128 0.265
NP_440007.1_9 Reverse -316 -330 1.96621 0.281
NP_441680.1_4 Forward -121 -102 2.94938 0.224
NP_441972.1_5 Reverse -223 -242 -9.34199 0.283
NP_439903.1_6 Reverse -252 -271 -0.984623 0.289
NP_441886.1_2 Forward -201 -182 11.7992 0.163
NP_440886.1_7 Forward -308 -298 4.50281 0.232
NP_440828.1_4 Forward -311 -292 -0.29631 0.19
NP_442072.1_9 Reverse -350 -368 -22.9903 0.271
NP_441463.1_3 Reverse -245 -264 -5.50708 0.229
NP_442211.1_3 Forward -372 -353 10.1954 0.257
NP_442238.1_3 Forward -117 -98 5.30933 0.254
NP_441065.1_3 Forward -289 -270 19.2723 0.0948
NP_441993.1_1 Reverse -358 -377 4.96787 0.21
NP_441993.1_1 Forward -237 -218 3.40855 0.235
NP_441993.1_1 Forward -105 -86 2.23906 0.261
NP_442805.1_5 Reverse -59 -78 -6.29447 0.284
NP_439988.1_7 Forward -373 -359 15.9285 0.292
NP_441133.1_1 Forward -72 -53 12.7825 0.253
NP_441984.1_3 Reverse -347 -365 8.08229 0.237
NP_441756.1_5 Forward -181 -162 -4.91709 0.297
NP_440423.1_6 Reverse -343 -362 -17.6018 0.232
NP_443000.1_3 Reverse -306 -325 10.6499 0.267
NP_441122.1_1 Forward -227 -212 8.53469 0.28
NP_442495.1_4 Reverse -381 -391 13.0581 0.198
NP_440149.1_8 Forward -307 -288 -4.42544 0.207
NP_440216.1_9 Reverse -230 -239 12.3894 0.241
NP_440216.1_9 Forward -121 -112 7.37455 0.286
NP_440216.1_9 Reverse -316 -325 6.68623 0.289
NP_440172.1_1 Forward -223 -213 2.92996 0.258
NP_442371.1_1 Forward -195 -185 15.1225 0.176
NP_441226.1_7 Reverse -58 -65 5.34865 0.289
NP_441177.1_6 Reverse -58 -77 17.6982 0.135
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TGGTTGGTTGCCCATGGAATCTAACCCCGACGACACCAATGACGGTGGCCCGTACCCCACCCGTTTCTTTATGGGTTTGGCTTGGTACCATGCCGAAACCGCCAAGGATGTACCCTTTGAGCAATTATTGAGTCAGGGCATTCCCGTCAATAAGCAGGTGGTTTCCATTGGTGAGTTGGCGATTAATCATGTGCAGTTCACCATCCTGGAGGAATTAGACCCGGCGGCGCATTTGGCCCATTAATTCAGCTCTGATAAGAGAGAAACTTCGTCTACGATCCATGGCTAAGGGCTGGGAATAGCTCAGCGCCTGTCAATACCAGGTATTTGTGCAGGGGTTGGGGTCAAACCAATGTTAAGGTGGTTCACTGTCATTAGCGTAGGCTTCAGGGGCTAAACC

CDS

ATGGAGGGTAATAGCGTCGTAACTCCAGAAATCGAAAGATTGATCCAAGCGGTGGAAACCGCAGACTCGGCAGCCAAATTAGTGGGGGCTGTGCGGGCTTTGGCGGCCACCCGATCGCCGTTGGCAGTGCCCCAATTAACCACGGTGTTGCGCTACAACAATCCAGGGGCAGCGGTGGCGGCGGTGGATGGGCTGATCCAAATCGGCGATGCGGCCATGACTCACTTGCTGGCCAATATGGATGGCTACAATTATGGCGCTAGGGCCTGGGCCACCAGAGCCTGTGCTGGCATCGGCGACCCCAGGGCATTGGCCCTATTGCAGGAAGCGGCCCTGACGGATTTTGCCTTGAGTGTGCGGCGGGCGGCGGCCAAGGGACTGGGTTTTCTCCGTTGGCAATCCCTACCCCAGGAAGAACAAGAGACAGTACAAAAAGCCATTTACGACACTCTGATCCAAGTTTGTGAAGATCCTGAATGGGTGGTACGCTACGGGGCGATCGCCGGTCTGGAAAATTTAGCCAAGCAGGCCCAGCATTACCGCCAACCCCTAAAGGATTTTCTCCAGTCTTTTGTAGAACAAGAACCAGAGGCGATCGTGGGGGAACGCATCCTTTGGACCCTGGAAAACATCGGCCCAATCTAG

Protein

MEGNSVVTPEIERLIQAVETADSAAKLVGAVRALAATRSPLAVPQLTTVLRYNNPGAAVAAVDGLIQIGDAAMTHLLANMDGYNYGARAWATRACAGIGDPRALALLQEAALTDFALSVRRAAAKGLGFLRWQSLPQEEQETVQKAIYDTLIQVCEDPEWVVRYGAIAGLENLAKQAQHYRQPLKDFLQSFVEQEPEAIVGERILWTLENIGPI