Your browser is old and dusty. Try Google Chrome!

Details for sll1035

ORF sll1035
Accession NP_440088.1
Symbol
Category Interconversions and salvage of nucleosides and nucleotides
Definition uracil phosphoribosyltransferase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -170 -156 -2.16369 0.285
NP_441418.1_6 Reverse -282 -301 -12.6852 0.0683
NP_442657.1_1 Reverse -30 -47 11.3202 0.245
NP_441480.1_5 Reverse -283 -302 12.9791 0.175
NP_440295.1_2 Reverse -35 -54 6.39097 0.283
NP_441453.1_1 Reverse -320 -338 6.01657 0.242
NP_441453.1_4 Reverse -282 -290 4.93597 0.224
NP_441453.1_8 Forward -57 -40 7.11867 0.275
NP_440226.1_1 Reverse -282 -301 5.211 0.163
NP_442169.1_1 Reverse -155 -174 -2.16383 0.272
NP_441098.1_3 Forward -46 -27 5.46114 0.25
NP_441519.1_3 Forward -351 -332 16.2241 0.104
NP_442173.1_3 Reverse -336 -346 16.598 0.196
NP_442752.1_4 Forward -291 -284 4.26735 0.293
NP_442909.1_7 Forward -290 -276 7.66879 0.208
NP_440061.1_9 Forward -274 -260 8.94708 0.157
NP_440061.1_9 Forward -167 -153 6.19383 0.255
NP_441476.1_5 Reverse -274 -293 -8.26035 0.3
NP_441900.1_2 Forward -292 -274 0.411736 0.258
NP_441208.1_9 Reverse -279 -293 18.3875 0.0647
NP_441594.1_6 Reverse -273 -292 10.0292 0.134
NP_441083.1_5 Forward -291 -281 14.238 0.0159
NP_441083.1_5 Reverse -282 -292 0.471689 0.226
NP_442827.1_8 Forward -299 -280 10.815 0.0577
NP_441434.1_7 Forward -147 -133 1.57289 0.299
NP_440209.1_2 Reverse -67 -83 12.8416 0.17
NP_442889.1_1 Forward -382 -363 -4.42544 0.156
NP_442889.1_1 Reverse -360 -379 -11.2103 0.217
NP_441713.1_1 Forward -119 -100 -10.6203 0.204
NP_441770.1_10 Reverse -280 -299 11.0125 0.23
NP_441327.1_1 Forward -31 -12 4.59781 0.264
NP_441327.1_1 Reverse -17 -36 2.57952 0.289
NP_441387.1_8 Forward -47 -28 16.1855 0.18
NP_440343.1_3 Forward -63 -45 10.2448 0.171
NP_441130.1_10 Reverse -280 -294 11.5043 0.106
NP_441695.1_6 Forward -307 -288 14.6508 0.218
NP_442848.1_5 Forward -291 -273 1.00246 0.276
NP_441316.1_10 Forward -225 -208 15.7718 0.298
NP_440376.1_1 Forward -291 -282 5.99792 0.111
NP_440376.1_1 Reverse -282 -291 -0.000272808 0.285
NP_442730.1_8 Forward -167 -148 10.815 0.185
NP_442687.1_7 Reverse -281 -291 7.74818 0.125
NP_442687.1_7 Forward -292 -282 3.81494 0.286
NP_441077.1_6 Reverse -8 -24 3.57312 0.268
NP_442485.1_3 Forward -293 -274 0.786102 0.234
NP_441846.1_10 Reverse -263 -282 -6.39206 0.19
NP_440667.1_2 Reverse -82 -101 -1.47551 0.231
NP_440141.1_8 Reverse -147 -166 11.7008 0.196
NP_442782.1_2 Reverse -167 -181 2.65453 0.275
NP_442205.1_9 Reverse -276 -292 -2.79306 0.272
NP_442937.1_5 Forward -296 -277 9.53756 0.187
NP_441958.1_5 Reverse -281 -291 0.865012 0.12
NP_441958.1_5 Forward -292 -282 0.275027 0.162
NP_440318.1_1 Reverse -174 -193 6.19431 0.218
NP_439905.1_1 Forward -164 -151 12.9006 0.178
NP_441338.2_5 Reverse -259 -278 3.24438 0.299
NP_442690.1_1 Reverse -28 -47 -14.3569 0.272
NP_441580.1_6 Forward -283 -264 -9.047 0.282
NP_440153.1_5 Forward -290 -276 1.96621 0.241
NP_440153.1_5 Reverse -283 -297 0.491246 0.299
NP_440993.1_3 Reverse -317 -336 -2.26292 0.299
NP_439975.1_2 Reverse -156 -174 4.9357 0.283
NP_441099.1_5 Reverse -104 -123 -10.817 0.262
NP_442002.1_1 Reverse -146 -164 -0.472507 0.192
NP_442002.1_1 Reverse -182 -200 -9.0273 0.272
NP_442002.1_9 Forward -292 -285 10.7572 0.185
NP_442002.1_9 Reverse -237 -244 9.77388 0.258
NP_441294.1_7 Forward -295 -281 9.63458 0.236
NP_441646.1_1 Forward -298 -279 1.37609 0.231
NP_441000.1_6 Reverse -281 -295 1.47456 0.168
NP_442771.1_1 Reverse -280 -298 -6.37237 0.168
NP_440147.1_4 Forward -293 -280 8.27909 0.0533
NP_441550.1_8 Reverse -280 -290 16.3025 0.0132
NP_440465.1_10 Reverse -279 -298 9.3409 0.173
NP_440465.1_10 Forward -291 -272 1.96607 0.275
NP_441725.1_5 Forward -290 -280 -0.708283 0.267
NP_439966.1_9 Forward -293 -284 0.983037 0.253
NP_440983.1_5 Reverse -198 -217 -8.45701 0.295
NP_441079.1_7 Reverse -14 -33 0.0970122 0.194
NP_440437.1_1 Forward -278 -259 -5.9004 0.296
NP_441164.1_4 Forward -335 -316 14.2566 0.208
NP_442049.1_6 Reverse -39 -58 5.30933 0.234
NP_441860.1_1 Forward -315 -301 16.8098 0.276
NP_441556.1_4 Forward -303 -284 16.7536 0.119
NP_441556.1_10 Reverse -361 -375 11.2925 0.231
NP_442215.1_2 Reverse -325 -341 0.845183 0.147
NP_440253.1_2 Reverse -282 -300 5.82068 0.0889
NP_440929.1_8 Reverse -282 -291 6.68623 0.0887
NP_440780.1_1 Forward -51 -32 9.69201 0.274
NP_442933.1_10 Reverse -282 -291 4.42462 0.246
NP_441751.2_8 Forward -290 -276 -5.40861 0.206
NP_442554.1_4 Forward -190 -171 10.1275 0.277
NP_442554.1_8 Forward -290 -280 4.89658 0.168
NP_442075.1_1 Reverse -43 -62 6.19431 0.269
NP_441762.1_7 Reverse -281 -293 1.31728 0.0747
NP_442142.1_4 Forward -279 -266 4.54195 0.217
NP_442292.1_5 Forward -127 -108 5.11266 0.233
NP_441525.1_1 Reverse -278 -291 11.229 0.296
NP_441899.1_8 Forward -54 -35 15.9291 0.184
NP_441523.1_6 Forward -341 -322 6.4893 0.215
NP_443009.1_5 Forward -205 -194 7.92465 0.118
NP_443009.1_5 Reverse -281 -292 7.33466 0.132
NP_442301.1_2 Forward -292 -273 4.22689 0.281
NP_440357.1_3 Reverse -193 -212 3.44104 0.242
NP_440357.1_3 Forward -293 -274 -0.000545616 0.285
NP_441198.1_4 Reverse -270 -289 9.63589 0.276
NP_441673.1_1 Forward -291 -282 1.37636 0.114
NP_441673.1_1 Reverse -282 -291 1.1797 0.163
NP_441826.1_2 Reverse -276 -290 -0.0987402 0.204
NP_442490.1_9 Forward -106 -87 -2.45882 0.21
NP_442868.1_6 Forward -206 -196 0.865012 0.205
NP_442719.1_2 Forward -79 -61 -11.1913 0.29
NP_442808.1_1 Reverse -113 -123 5.58445 0.146
NP_442542.1_9 Forward -265 -251 8.16044 0.17
NP_442050.1_1 Reverse -154 -173 6.98095 0.28
NP_442050.1_5 Forward -206 -196 6.96107 0.27
NP_440385.1_8 Reverse -11 -30 11.8883 0.206
NP_440346.1_7 Forward -321 -302 5.40766 0.29
NP_441114.1_3 Forward -163 -154 7.57121 0.231
NP_440558.1_2 Forward -208 -189 -2.75381 0.229
NP_442593.1_7 Forward -309 -290 13.3725 0.236
NP_441878.1_6 Reverse -281 -291 0.57002 0.14
NP_441878.1_10 Forward -51 -37 13.8643 0.289
NP_441036.1_8 Forward -292 -282 6.76487 0.215
NP_441557.1_5 Forward -291 -282 0.491382 0.144
NP_441557.1_5 Reverse -282 -291 0.29472 0.174
NP_441445.1_1 Reverse -273 -292 3.44104 0.213
NP_441433.1_8 Forward -218 -199 -4.72043 0.294
NP_440084.1_8 Reverse -25 -39 9.17885 0.29
NP_441458.1_8 Reverse -9 -28 1.81158 0.295
NP_442183.1_3 Forward -367 -348 14.3549 0.243
NP_440676.1_1 Forward -62 -43 14.9458 0.14
NP_442166.1_7 Forward -105 -91 9.04604 0.208
NP_441459.1_3 Forward -291 -272 11.4255 0.283
NP_442444.1_6 Forward -99 -81 12.05 0.293
NP_441549.1_9 Forward -295 -277 -9.71562 0.258
NP_442347.1_2 Reverse -283 -292 11.2095 0.056
NP_442645.1_2 Reverse -274 -293 -22.715 0.293
NP_442888.1_9 Reverse -144 -163 14.0608 0.222
NP_441633.1_3 Forward -293 -280 3.46087 0.0699
NP_442998.1_5 Forward -207 -197 8.33817 0.264
NP_442998.1_10 Reverse -284 -291 5.93897 0.206
NP_441799.1_1 Reverse -100 -114 5.99717 0.187
NP_441799.1_1 Forward -208 -194 5.70218 0.197
NP_441799.1_1 Reverse -278 -292 5.50552 0.206
NP_441559.1_8 Reverse -191 -205 11.2093 0.0574
NP_440717.1_3 Forward -288 -274 9.53707 0.25
NP_442452.1_3 Reverse -52 -71 -0.000545616 0.298
NP_441464.1_8 Forward -291 -277 15.8309 0.0995
NP_441199.1_6 Forward -295 -276 5.50599 0.152
NP_441199.1_6 Reverse -81 -100 -1.47551 0.292
NP_443028.1_4 Reverse -13 -32 8.44315 0.293
NP_440586.1_1 Reverse -275 -294 -5.11376 0.28
NP_442959.1_4 Reverse -186 -205 6.68596 0.224
NP_440027.1_3 Forward -294 -276 4.24662 0.262
NP_439937.1_9 Forward -205 -188 -6.55 0.157
NP_439937.1_9 Forward -292 -275 -6.74666 0.157
NP_439937.1_9 Reverse -194 -211 -11.5649 0.257
NP_439937.1_9 Reverse -193 -210 -13.3348 0.285
NP_439937.1_9 Reverse -281 -298 -16.973 0.291
NP_440408.1_7 Reverse -155 -174 12.9791 0.197
NP_440408.1_7 Forward -355 -336 8.45592 0.281
NP_440439.1_1 Forward -294 -281 9.06573 0.0475
NP_440439.1_1 Reverse -279 -292 0.412608 0.192
NP_442239.1_8 Reverse -336 -355 6.58763 0.263
NP_439943.1_4 Reverse -149 -168 6.4893 0.27
NP_440372.1_2 Forward -290 -283 4.07068 0.262
NP_439977.1_10 Reverse -48 -67 17.699 0.171
NP_442887.1_5 Forward -184 -165 -12.9802 0.281
NP_442384.1_7 Reverse -272 -286 17.3058 0.198
NP_442384.1_10 Reverse -367 -380 2.08423 0.237
NP_440693.1_8 Reverse -191 -210 12.2908 0.283
NP_440189.1_2 Reverse -274 -293 -0.983855 0.294
NP_441896.1_3 Forward -300 -281 -2.0655 0.275
NP_440894.1_10 Reverse -109 -128 9.53756 0.16
NP_442078.1_3 Forward -193 -174 2.55527 0.203
NP_440888.1_2 Reverse -282 -296 11.012 0.0783
NP_442454.1_2 Reverse -26 -45 9.31004 0.291
NP_441949.1_2 Forward -301 -282 9.83255 0.261
NP_442845.1_2 Forward -395 -381 8.65272 0.19
NP_442845.1_2 Reverse -48 -62 3.63784 0.282
NP_440089.1_1 Reverse -147 -165 24.3069 0.0115
NP_441469.1_8 Forward -205 -196 8.75118 0.227
NP_443064.1_6 Forward -291 -281 16.5422 0.0796
NP_441462.1_2 Forward -291 -281 8.63316 0.0339
NP_441621.1_7 Reverse -280 -294 -5.40861 0.252
NP_441621.1_7 Forward -96 -82 -6.09693 0.275
NP_442204.1_5 Forward -106 -87 9.0459 0.109
NP_441351.1_8 Reverse -94 -113 0.294447 0.289
NP_442487.1_6 Forward -70 -51 10.815 0.239
NP_440516.1_8 Forward -291 -282 7.17789 0.0754
NP_440516.1_8 Reverse -282 -291 5.01461 0.118
NP_440673.1_2 Forward -60 -41 7.85324 0.288
NP_440673.1_3 Reverse -284 -291 10.1672 0.149
NP_440673.1_7 Forward -283 -264 0.982764 0.258
NP_441884.1_9 Forward -339 -320 -23.5016 0.284
NP_441884.1_9 Reverse -111 -130 -23.7966 0.284
NP_441884.1_9 Reverse -279 -298 -24.6816 0.288
NP_441733.1_10 Forward -392 -379 3.95252 0.28
NP_441004.1_1 Reverse -150 -169 -15.5368 0.275
NP_441004.1_2 Reverse -145 -164 5.40766 0.193
NP_441004.1_4 Reverse -153 -163 16.1063 0.154
NP_441004.1_4 Forward -59 -49 9.7148 0.259
NP_441004.1_4 Reverse -45 -55 7.55152 0.298
NP_442873.1_5 Forward -163 -144 7.57013 0.276
NP_441115.1_4 Reverse -266 -284 8.86816 0.234
NP_441115.1_9 Reverse -263 -281 7.59063 0.288
NP_442011.1_1 Forward -292 -273 -3.24547 0.29
NP_441668.1_4 Reverse -182 -201 1.57275 0.212
NP_441668.1_10 Forward -170 -153 18.4259 0.07
NP_442515.1_1 Forward -337 -323 -0.688726 0.231
NP_442515.1_1 Forward -292 -278 -5.01529 0.298
NP_441396.1_5 Reverse -271 -280 7.37455 0.279
NP_441683.1_7 Reverse -155 -174 -11.9969 0.284
NP_441394.1_2 Forward -196 -177 16.1257 0.251
NP_442843.1_1 Reverse -139 -158 -11.5053 0.291
NP_442843.1_1 Reverse -163 -182 -11.6036 0.291
NP_440588.1_2 Reverse -273 -292 -2.26216 0.163
NP_440040.1_6 Forward -196 -177 8.75091 0.181
NP_442006.1_2 Forward -267 -250 -18.0541 0.287
NP_441570.1_1 Reverse -140 -158 -14.9272 0.227
NP_441078.1_4 Forward -375 -366 3.44131 0.14
NP_441078.1_4 Forward -291 -282 0.393051 0.205
NP_441078.1_4 Reverse -282 -291 -0.000272808 0.205
NP_440539.1_9 Forward -278 -259 -5.60541 0.286
NP_440539.1_9 Forward -192 -173 -6.39206 0.286
NP_442443.1_1 Reverse -274 -293 -3.63879 0.267
NP_441432.1_9 Forward -76 -63 17.5184 0.0642
NP_441732.1_2 Forward -379 -363 -17.641 0.281
NP_440313.1_5 Forward -165 -147 14.3747 0.214
NP_442797.1_7 Forward -292 -274 4.83737 0.217
NP_441057.1_3 Reverse -176 -195 -12.2919 0.255
NP_442353.1_4 Reverse -91 -110 6.78348 0.17
NP_442968.1_8 Reverse -181 -200 11.9958 0.278
NP_442489.1_7 Forward -291 -282 0.688044 0.152
NP_442489.1_7 Reverse -282 -291 0.688044 0.152
NP_440559.1_1 Forward -290 -281 4.81794 0.193
NP_441659.2_8 Forward -291 -281 0.0783647 0.277
NP_440860.1_8 Reverse -280 -299 21.7306 0.0264
NP_441040.1_5 Reverse -362 -381 2.75272 0.28
NP_440545.1_3 Reverse -278 -295 -0.354483 0.152
NP_440545.1_3 Forward -295 -278 -2.41943 0.184
NP_440459.1_2 Reverse -153 -170 7.41366 0.291
NP_441943.1_8 Reverse -119 -138 -5.9004 0.261
NP_441050.1_5 Reverse -188 -206 7.00065 0.181
NP_441050.1_5 Reverse -275 -293 -2.24246 0.279
NP_440946.1_6 Reverse -145 -164 11.2092 0.283
NP_442073.1_6 Reverse -252 -271 3.93269 0.25
NP_442546.1_2 Forward -81 -62 8.55343 0.141
NP_442140.1_3 Reverse -283 -293 5.5849 0.202
NP_441696.1_6 Forward -290 -271 0.392778 0.294
NP_440875.1_9 Reverse -284 -294 11.1948 0.179
NP_440590.1_4 Forward -122 -109 -5.29059 0.277
NP_440567.1_1 Forward -290 -276 1.47456 0.204
NP_442497.1_10 Forward -290 -281 0.393051 0.175
NP_440821.1_4 Reverse -280 -290 0.0783647 0.205
NP_440821.1_4 Forward -293 -283 -0.708283 0.287
NP_441239.1_9 Reverse -280 -292 6.1355 0.2
NP_441727.1_9 Forward -163 -144 10.4225 0.273
NP_440400.1_1 Forward -364 -345 -1.77127 0.285
NP_442044.1_1 Reverse -190 -209 -7.67036 0.227
NP_441874.1_1 Reverse -44 -58 9.14437 0.277
NP_442083.1_4 Reverse -363 -382 1.96607 0.201
NP_440833.1_6 Forward -179 -165 7.17714 0.285
NP_441617.1_6 Forward -189 -170 -4.32711 0.265
NP_440675.1_3 Reverse -282 -301 13.9625 0.161
NP_440462.1_4 Reverse -154 -168 9.73436 0.243
NP_441184.1_9 Reverse -169 -182 14.4739 0.241
NP_440868.1_4 Forward -295 -283 7.02048 0.0787
NP_441868.1_4 Reverse -160 -174 13.4709 0.282
NP_442402.1_2 Reverse -194 -208 10.8154 0.292
NP_442402.1_4 Reverse -189 -208 -7.57277 0.276
NP_442402.1_10 Reverse -199 -209 14.0409 0.182
NP_442402.1_10 Reverse -198 -208 11.8776 0.231
NP_441084.1_6 Reverse -370 -384 10.7015 0.231
NP_442023.1_2 Forward -58 -39 4.32602 0.286
NP_442039.1_7 Reverse -50 -60 11.6814 0.257
NP_442039.1_7 Forward -211 -201 7.55152 0.275
NP_441811.1_8 Reverse -276 -290 12.586 0.207
NP_440160.1_2 Forward -206 -187 -7.08038 0.283
NP_440160.1_9 Reverse -180 -199 10.2259 0.235
NP_442053.1_1 Reverse -282 -291 6.8829 0.111
NP_441252.1_6 Reverse -52 -59 11.6422 0.288
NP_442844.1_2 Forward -42 -27 14.7627 0.229
NP_442532.1_4 Reverse -63 -81 9.32234 0.273
NP_442532.1_7 Reverse -282 -296 2.35953 0.245
NP_440303.1_2 Forward -368 -349 4.52268 0.299
NP_442533.1_1 Reverse -270 -289 -7.96535 0.201
NP_442533.1_6 Forward -291 -282 4.91628 0.165
NP_442533.1_6 Reverse -282 -291 4.42462 0.179
NP_440263.1_5 Reverse -199 -213 9.43936 0.294
NP_442232.1_3 Reverse -274 -293 4.12936 0.0913
NP_441697.1_5 Reverse -2 -21 -9.59736 0.271
NP_441749.1_7 Forward -296 -277 11.4058 0.224
NP_441028.1_6 Reverse -200 -210 6.0761 0.232
NP_440115.1_6 Forward -294 -284 6.76487 0.167
NP_440115.1_6 Forward -207 -197 4.89658 0.28
NP_443045.1_5 Reverse -151 -164 17.1668 0.119
NP_441420.1_8 Forward -357 -338 16.1257 0.136
NP_442588.1_6 Reverse -164 -183 0.982764 0.248
NP_442306.1_10 Reverse -277 -296 -21.6334 0.282
NP_441286.1_1 Forward -292 -280 -4.48425 0.161
NP_440088.1_6 Forward -299 -280 23.9922 0.0212
NP_440670.1_8 Forward -291 -282 8.55452 0.066
NP_440670.1_8 Reverse -282 -291 5.99792 0.13
NP_441930.1_1 Forward -210 -191 9.93088 0.194
NP_441930.1_2 Reverse -155 -165 13.2547 0.248
NP_440886.1_7 Forward -292 -282 7.55106 0.0892
NP_440886.1_7 Forward -57 -47 3.22451 0.291
NP_442614.1_2 Forward -291 -277 9.63603 0.242
NP_442401.1_2 Forward -292 -273 12.88 0.159
NP_442800.1_7 Reverse -36 -55 1.57275 0.296
NP_441753.1_10 Forward -300 -281 0.392778 0.294
NP_440028.1_6 Reverse -156 -174 12.4089 0.24
NP_440907.2_8 Reverse -283 -293 6.0761 0.179
NP_441463.1_3 Forward -301 -282 -8.94866 0.276
NP_442238.1_3 Forward -387 -368 5.70265 0.254
NP_442794.1_1 Forward -168 -156 6.03717 0.198
NP_441962.1_4 Reverse -277 -296 -9.14533 0.213
NP_440387.1_1 Reverse -282 -298 -2.89139 0.152
NP_441488.1_7 Forward -210 -191 14.9458 0.0544
NP_441488.1_7 Reverse -321 -340 3.34271 0.227
NP_441488.1_7 Reverse -276 -295 2.85105 0.242
NP_441193.1_1 Forward -207 -188 20.5498 0.117
NP_441993.1_1 Reverse -250 -269 4.38312 0.221
NP_440814.1_4 Forward -256 -237 -13.1769 0.271
NP_440114.1_8 Reverse -48 -67 11.6025 0.287
NP_440114.1_10 Forward -291 -277 5.99778 0.289
NP_441425.1_2 Reverse -3 -22 18.8574 0.127
NP_441425.1_2 Reverse -23 -42 17.234 0.182
NP_442323.1_7 Forward -170 -151 5.30853 0.207
NP_440287.1_6 Reverse -280 -299 5.40766 0.182
NP_440293.1_3 Reverse -154 -173 -6.1954 0.287
NP_442743.1_4 Reverse -42 -61 -7.86702 0.281
NP_440457.1_1 Reverse -278 -290 0.137309 0.25
NP_440798.1_2 Forward -59 -45 17.0102 0.227
NP_440798.1_6 Reverse -283 -296 1.19926 0.228
NP_440798.1_6 Forward -290 -277 1.00259 0.24
NP_440142.1_7 Reverse -367 -386 5.60432 0.287
NP_441984.1_3 Forward -287 -269 6.50899 0.269
NP_442509.1_9 Reverse -282 -292 13.3526 0.0571
NP_442582.1_3 Forward -47 -33 17.4866 0.127
NP_442514.1_5 Forward -351 -332 -1.27961 0.198
NP_441885.1_5 Forward -291 -281 -0.314959 0.195
NP_442703.1_8 Forward -243 -225 11.9164 0.265
NP_442341.1_7 Reverse -113 -127 7.47274 0.105
NP_442341.1_7 Forward -292 -278 4.62115 0.185
NP_442341.1_7 Forward -337 -323 3.44117 0.224
NP_441756.1_5 Reverse -112 -131 -4.13045 0.292
NP_441173.1_9 Forward -372 -364 13.1954 0.184
NP_441173.1_9 Reverse -201 -209 11.3271 0.226
NP_441173.1_9 Reverse -200 -208 11.3271 0.226
NP_441173.1_9 Forward -76 -68 10.9338 0.242
NP_440191.1_6 Reverse -20 -34 16.6272 0.294
NP_440727.1_8 Forward -39 -25 15.0039 0.251
NP_441842.1_1 Reverse -197 -210 11.1301 0.267
NP_440275.1_3 Forward -293 -283 5.68323 0.136
NP_440091.1_1 Forward -295 -283 4.95553 0.132
NP_443010.1_10 Reverse -192 -209 7.89238 0.164
NP_443010.1_10 Forward -294 -277 7.40921 0.172
NP_440216.1_1 Reverse -282 -296 -5.50694 0.131
NP_440216.1_1 Forward -291 -277 -11.6035 0.203
NP_440172.1_1 Forward -291 -281 3.71661 0.219
NP_440249.1_2 Reverse -21 -31 14.4342 0.273
NP_440167.1_3 Reverse -272 -291 11.2092 0.231
NP_442015.1_10 Forward -169 -156 -1.16069 0.297
NP_441045.1_1 Forward -191 -172 12.5858 0.26
NP_441226.1_7 Forward -56 -49 6.52862 0.253
NP_441766.1_2 Reverse -282 -291 4.12963 0.194
NP_443052.1_8 Forward -301 -282 -0.983855 0.0754
NP_442116.1_6 Reverse -18 -35 7.88248 0.254
NP_442403.1_8 Reverse -284 -303 2.94938 0.226
NP_442154.1_1 Reverse -349 -367 -2.0458 0.124
NP_440261.1_5 Reverse -196 -209 -4.89726 0.178
NP_440261.1_5 Forward -290 -277 -12.4687 0.297
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TGCCTTCTAGTAGGGCTCCGTCCTGGGCTTTACCCAACACACTCAACACACCGGCTTGACCAGGGTTAATCACCACAAAGGAGTTAAAACTCAGCAGGACTAGCAAGGCGGCGATCAGCCCCCCCACAATGGACTGCCAGCCGTCAAAGGATGGTTGTTTGCTCATAATGCTTGCCTGTCTGTCGTTGAACTTGGGGGAAATCCCTGCCCAAAGTATGGCAGAAAACCTTTCCCTTCCCAATGCCCCAACTTCCGGTAACCCGATCTGAGCTACAGTGGAGTTCCGCGGTGAATTGTTACCGACGGTGAGACCACGTCCTAACTTTTAGCCCATTTTTCGGTTCCCCAACGGCCAAGATTAACAAAATTAAATTTTAGATATTAACTTTTAAGTTTTCCC

CDS

ATGGCTTCTCAATTACGTGTTTATGTGCCGGAGCATCCTCTAATTAAGCATTGGTTGGGGGTAGCTAGGGATGAAAACACGCCGCCGGTTTTGTTTAAAACTGCCATGGGGGAATTGGGACGTTGGTTGACCTATGAGGCCGCTCGTTATTGGTTGCCGACGGTGGATACGGAAGTGAAAACTCCCCTGGCGATCGCCAAGGCCAGTCTTATTGACCCCCAAACGCCCTTTGTCATTGTGCCCATTTTGCGGGCGGGGTTGGCTCTGGTGGAAGGGGCCCAGGGGTTGTTGCCCCTGGCAAAAATTTACCATCTGGGTTTAGTGCGCAATGAAACTACCCTGGAACCTAGTCTGTATCTGAACAAGTTGCCGGAGCGGTTTGCCCCCGGTACCCATCTTTTGTTGCTAGATCCCATGTTGGCTACGGGTAATACCATCATGGCTGCTTTGGATTTGCTGATGGCCCGGGACATTGATGCCAATTTAATCCGTTTGGTCTCCGTGGTGGCCGCCCCCACTGCCCTGCAAAAATTAAGTAATGCCCATCCCAATTTGACCATCTACACCGCCATGATTGACGAACAACTCAATGACCGGGGTTACATTGTGCCCGGCCTAGGGGATGCAGGCGATCGTTGCTTTGGTACTTGA

Protein

MASQLRVYVPEHPLIKHWLGVARDENTPPVLFKTAMGELGRWLTYEAARYWLPTVDTEVKTPLAIAKASLIDPQTPFVIVPILRAGLALVEGAQGLLPLAKIYHLGLVRNETTLEPSLYLNKLPERFAPGTHLLLLDPMLATGNTIMAALDLLMARDIDANLIRLVSVVAAPTALQKLSNAHPNLTIYTAMIDEQLNDRGYIVPGLGDAGDRCFGT