Your browser is old and dusty. Try Google Chrome!

Details for sll1032

ORF sll1032
Accession NP_440092.1
Symbol ccmN
Category Other
Definition carbon dioxide concentrating mechanism protein CcmN, putative carboxysome assembly protein
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -392 -378 9.63603 0.0708
NP_441061.1_2 Reverse -320 -334 9.34103 0.0754
NP_441061.1_2 Reverse -332 -346 2.06454 0.179
NP_441061.1_2 Reverse -326 -340 0.196253 0.215
NP_441061.1_2 Reverse -293 -307 -2.36035 0.29
NP_440795.1_7 Forward -392 -385 14.6904 0.0123
NP_440795.1_7 Reverse -385 -392 14.6904 0.0123
NP_441418.1_6 Forward -393 -374 6.98095 0.00675
NP_441418.1_6 Forward -334 -315 -17.8968 0.0825
NP_441418.1_6 Forward -328 -309 -29.1065 0.216
NP_442291.1_5 Forward -394 -378 7.2367 0.0657
NP_441453.1_1 Forward -186 -168 7.49153 0.216
NP_441453.1_4 Reverse -384 -392 16.539 0.00633
NP_441453.1_4 Forward -393 -385 16.539 0.00633
NP_441453.1_4 Reverse -337 -345 4.24765 0.259
NP_442151.1_6 Reverse -384 -398 7.17775 0.206
NP_441818.1_1 Forward -392 -381 9.30127 0.246
NP_440226.1_1 Forward -393 -374 11.0125 0.0571
NP_440150.1_2 Reverse -321 -340 6.98015 0.254
NP_440150.1_6 Reverse -381 -400 4.71934 0.235
NP_442744.1_9 Reverse -378 -392 15.5501 0.266
NP_443002.1_5 Reverse -320 -338 15.5546 0.192
NP_442173.1_1 Forward -392 -384 15.4574 0.00633
NP_442173.1_1 Reverse -385 -393 15.4574 0.00633
NP_442173.1_1 Reverse -338 -346 4.93597 0.241
NP_442752.1_4 Forward -393 -386 13.8055 0.0199
NP_442752.1_4 Reverse -384 -391 13.8055 0.0199
NP_443027.1_4 Reverse -382 -392 14.828 0.0437
NP_441812.1_3 Forward -394 -380 7.47274 0.272
NP_442975.1_10 Reverse -380 -394 13.077 0.0459
NP_440784.1_7 Forward -392 -385 15.9687 0.0123
NP_440784.1_7 Reverse -385 -392 15.9687 0.0123
NP_442909.1_7 Forward -392 -378 9.43874 0.148
NP_440061.1_9 Reverse -382 -396 10.5204 0.124
NP_441145.1_1 Forward -394 -375 6.39097 0.254
NP_439979.1_9 Forward -333 -315 9.85225 0.236
NP_442062.1_8 Forward -393 -383 19.4496 0.000558
NP_442062.1_8 Reverse -384 -394 17.6796 0.00193
NP_442062.1_8 Reverse -337 -347 11.6814 0.0419
NP_440304.1_4 Reverse -382 -392 10.8948 0.051
NP_440304.1_4 Forward -395 -385 9.91146 0.051
NP_442242.1_4 Forward -392 -385 14.3954 0.0124
NP_442242.1_4 Reverse -385 -392 14.3954 0.0124
NP_439918.1_2 Forward -346 -327 -2.0655 0.24
NP_441208.1_9 Forward -396 -382 15.0442 0.0896
NP_442742.1_9 Forward -187 -168 -4.6221 0.221
NP_440132.1_1 Reverse -382 -400 11.0322 0.217
NP_441925.1_4 Reverse -136 -155 -0.39464 0.155
NP_440856.1_7 Forward -284 -265 -9.63698 0.294
NP_441083.1_5 Reverse -384 -394 19.3512 0.000718
NP_441083.1_5 Forward -393 -383 11.3864 0.0159
NP_441083.1_5 Forward -179 -169 5.38824 0.12
NP_442827.1_8 Reverse -376 -395 3.34192 0.148
NP_441738.1_2 Forward -391 -384 15.28 0.0102
NP_441738.1_2 Reverse -386 -393 15.28 0.0102
NP_441738.1_2 Forward -86 -79 6.03696 0.295
NP_440209.1_1 Reverse -384 -392 18.1123 0.00295
NP_440209.1_1 Forward -393 -385 18.1123 0.00295
NP_442889.1_8 Reverse -381 -395 4.12889 0.27
NP_441713.1_1 Forward -399 -380 6.09597 0.0568
NP_440178.1_7 Forward -394 -375 -20.8467 0.201
NP_441792.1_5 Reverse -320 -336 9.7933 0.234
NP_441716.1_1 Forward -393 -379 11.111 0.0936
NP_441716.1_1 Reverse -384 -398 11.111 0.0936
NP_441327.1_5 Forward -92 -83 13.8644 0.27
NP_442111.1_4 Reverse -383 -397 9.34103 0.0609
NP_442111.1_4 Forward -394 -380 5.50613 0.162
NP_441387.1_7 Forward -158 -139 12.0942 0.145
NP_441533.1_7 Reverse -315 -333 11.3264 0.299
NP_440851.1_5 Reverse -74 -93 16.6165 0.159
NP_440906.1_5 Forward -392 -385 15.8704 0.0124
NP_440906.1_5 Reverse -385 -392 15.8704 0.0124
NP_440747.1_10 Forward -396 -384 15.2803 0.0019
NP_440747.1_10 Reverse -381 -393 -2.02597 0.0196
NP_440747.1_10 Forward -304 -292 -12.0557 0.199
NP_441486.1_1 Reverse -381 -395 22.714 0.00162
NP_441486.1_1 Forward -396 -382 2.35953 0.0844
NP_442634.1_2 Forward -399 -380 12.4875 0.133
NP_442634.1_4 Forward -348 -334 -3.147 0.161
NP_442634.1_4 Forward -395 -381 -3.63866 0.161
NP_441265.1_3 Forward -399 -385 14.4542 0.059
NP_442760.1_4 Forward -183 -164 9.14423 0.29
NP_440403.1_4 Reverse -375 -394 -5.80207 0.221
NP_441014.1_8 Forward -82 -63 5.60432 0.19
NP_441014.1_8 Forward -226 -207 -8.06369 0.282
NP_442848.1_1 Reverse -378 -392 -1.5737 0.263
NP_442848.1_1 Forward -346 -332 -4.32697 0.287
NP_442848.1_5 Reverse -330 -348 0.0191479 0.276
NP_441012.1_4 Reverse -333 -346 7.29578 0.272
NP_441012.1_4 Forward -326 -313 6.21414 0.284
NP_441012.1_4 Reverse -59 -72 5.91914 0.286
NP_443018.1_3 Forward -392 -385 14.8871 0.0123
NP_443018.1_3 Reverse -385 -392 14.8871 0.0123
NP_443018.1_3 Reverse -338 -345 10.7572 0.0907
NP_443018.1_3 Forward -345 -338 4.56234 0.241
NP_441316.1_7 Reverse -382 -397 3.51981 0.141
NP_441634.1_8 Reverse -269 -283 -2.16369 0.295
NP_441634.1_8 Forward -395 -381 -3.63866 0.295
NP_441634.1_9 Forward -388 -369 8.55343 0.294
NP_440376.1_1 Forward -393 -384 19.4693 0.000692
NP_440376.1_1 Reverse -384 -393 19.4693 0.000692
NP_441857.1_6 Reverse -193 -203 16.7946 0.163
NP_442687.1_7 Forward -394 -384 18.5646 0.0028
NP_442687.1_7 Reverse -383 -393 15.8113 0.0125
NP_442687.1_7 Forward -221 -211 3.81494 0.286
NP_442485.1_3 Reverse -373 -392 -4.22878 0.278
NP_440642.1_8 Forward -391 -372 12.925 0.289
NP_441013.1_2 Forward -351 -333 0.412472 0.254
NP_442658.1_1 Reverse -382 -392 15.9091 0.00966
NP_442658.1_1 Forward -395 -385 14.8275 0.0188
NP_442658.1_1 Forward -348 -338 13.7459 0.0325
NP_441855.2_4 Reverse -311 -330 13.0901 0.173
NP_442782.1_2 Forward -346 -332 9.2427 0.198
NP_442782.1_2 Forward -328 -314 4.71948 0.25
NP_442205.1_9 Reverse -378 -394 -0.531451 0.264
NP_440656.1_8 Reverse -373 -392 -1.67217 0.184
NP_442937.1_5 Forward -333 -314 13.4708 0.0906
NP_442937.1_5 Forward -339 -320 12.7825 0.101
NP_442321.1_1 Reverse -242 -261 -6.88371 0.246
NP_441958.1_5 Forward -394 -384 20.5312 0.000966
NP_441958.1_5 Reverse -383 -393 12.2714 0.00183
NP_441958.1_5 Reverse -291 -301 -0.0199663 0.178
NP_440203.1_5 Reverse -387 -397 10.6976 0.215
NP_442911.1_2 Reverse -374 -393 -5.31042 0.155
NP_441580.1_6 Reverse -326 -345 1.67108 0.117
NP_441580.1_6 Reverse -247 -266 -9.14533 0.286
NP_440153.1_5 Forward -392 -378 16.5192 0.0551
NP_440369.1_5 Reverse -1 -20 11.8975 0.221
NP_441099.1_5 Reverse -58 -77 0.196116 0.0825
NP_442002.1_9 Forward -394 -387 14.1004 0.074
NP_442002.1_9 Reverse -383 -390 10.7572 0.185
NP_442002.1_9 Forward -113 -106 9.47889 0.282
NP_440809.1_9 Reverse -375 -393 -6.56903 0.225
NP_441294.1_4 Forward -341 -322 6.98095 0.257
NP_441294.1_7 Reverse -380 -394 12.7062 0.0876
NP_442438.1_10 Reverse -379 -393 3.63784 0.159
NP_441000.1_6 Forward -394 -380 13.5693 0.0396
NP_441000.1_6 Reverse -383 -397 -5.01529 0.257
NP_442771.1_1 Reverse -382 -400 -4.30741 0.166
NP_440147.1_4 Forward -395 -382 11.9173 0.0326
NP_440147.1_4 Reverse -382 -395 3.75586 0.181
NP_440147.1_4 Reverse -290 -303 -0.177378 0.276
NP_441550.1_8 Forward -395 -385 17.6791 0.00754
NP_441550.1_8 Reverse -221 -231 6.37109 0.212
NP_441550.1_8 Reverse -382 -392 6.0761 0.214
NP_441916.1_7 Forward -393 -383 18.4663 0.00144
NP_441916.1_7 Reverse -384 -394 16.893 0.00407
NP_441916.1_7 Forward -346 -336 5.09324 0.146
NP_440383.1_6 Forward -289 -270 12.6841 0.22
NP_440206.1_4 Reverse -315 -334 -0.00131823 0.289
NP_440465.1_10 Forward -396 -377 -1.7705 0.297
NP_441041.1_1 Forward -334 -315 15.8307 0.164
NP_441041.1_4 Forward -340 -321 0.687771 0.084
NP_441041.1_4 Forward -346 -327 0.0977854 0.0907
NP_441041.1_4 Forward -334 -315 -3.83545 0.126
NP_441041.1_4 Forward -352 -333 -11.8986 0.254
NP_441041.1_7 Forward -396 -384 18.01 0.00663
NP_441041.1_7 Forward -270 -258 6.25147 0.216
NP_441547.1_2 Forward -339 -321 4.24738 0.254
NP_442004.1_6 Reverse -384 -398 5.70279 0.184
NP_442004.1_6 Forward -346 -332 3.63784 0.235
NP_441725.1_5 Reverse -385 -395 11.7798 0.0247
NP_441725.1_5 Forward -392 -382 11.2881 0.0247
NP_439966.1_7 Reverse -382 -392 18.4657 0.00473
NP_439966.1_9 Reverse -382 -391 0.983037 0.253
NP_442941.1_3 Forward -392 -382 11.4848 0.0116
NP_442941.1_3 Reverse -385 -395 2.53664 0.14
NP_440289.1_2 Reverse -381 -394 14.7689 0.0107
NP_440289.1_2 Forward -396 -383 -2.34066 0.254
NP_440983.1_5 Reverse -313 -332 -3.83545 0.244
NP_442281.1_1 Reverse -379 -393 12.192 0.0396
NP_442281.1_1 Forward -398 -384 5.01387 0.172
NP_442281.1_1 Forward -351 -337 1.5723 0.296
NP_442847.1_3 Forward -272 -253 7.37347 0.235
NP_440437.1_1 Forward -399 -380 2.3594 0.135
NP_442012.1_1 Forward -399 -380 3.53937 0.18
NP_442012.1_5 Forward -335 -316 6.98095 0.252
NP_442012.1_5 Forward -341 -322 -1.18052 0.288
NP_441457.1_7 Forward -395 -376 5.50599 0.186
NP_440498.1_1 Reverse -375 -393 5.82068 0.0965
NP_443030.1_4 Reverse -319 -338 1.17943 0.222
NP_442068.1_4 Forward -181 -162 6.78348 0.23
NP_441644.1_6 Reverse -384 -394 15.7125 0.0048
NP_441644.1_6 Forward -393 -383 10.1076 0.0628
NP_442215.1_2 Reverse -382 -398 5.95839 0.0749
NP_442215.1_2 Forward -262 -246 -4.66135 0.237
NP_442215.1_2 Forward -337 -321 -5.84132 0.26
NP_442029.1_1 Forward -330 -311 -18.1918 0.272
NP_442029.1_6 Forward -339 -320 7.86593 0.219
NP_442029.1_6 Forward -340 -321 2.45773 0.296
NP_440253.1_2 Forward -393 -375 -2.73412 0.274
NP_440929.1_8 Forward -393 -384 19.2726 0.000701
NP_440929.1_8 Reverse -384 -393 19.2726 0.000701
NP_440929.1_8 Reverse -292 -301 5.50626 0.132
NP_442933.1_10 Forward -393 -384 17.601 0.00325
NP_442933.1_10 Reverse -384 -393 17.601 0.00325
NP_442933.1_10 Forward -346 -337 4.52295 0.24
NP_441751.2_8 Reverse -385 -399 6.29277 0.0368
NP_441751.2_8 Forward -392 -378 -0.0987402 0.125
NP_442554.1_8 Reverse -385 -395 14.238 0.0144
NP_442554.1_8 Forward -392 -382 13.8447 0.0145
NP_442554.1_8 Reverse -75 -85 1.84832 0.292
NP_441762.1_7 Forward -394 -382 11.4454 0.0142
NP_441762.1_7 Reverse -383 -395 9.47875 0.0142
NP_442142.1_4 Reverse -316 -329 16.3416 0.0264
NP_442142.1_4 Forward -396 -383 14.4733 0.0311
NP_442142.1_4 Reverse -334 -347 5.23026 0.197
NP_442292.1_1 Forward -392 -383 9.63616 0.0183
NP_442292.1_1 Reverse -385 -394 9.53783 0.0183
NP_441525.1_1 Reverse -271 -284 15.1623 0.21
NP_442476.1_6 Reverse -385 -399 0.589577 0.252
NP_443009.1_5 Forward -394 -383 20.6093 0.001
NP_443009.1_5 Reverse -383 -394 9.10461 0.0965
NP_443009.1_5 Reverse -336 -347 8.51463 0.106
NP_441726.1_3 Reverse -321 -340 20.059 0.235
NP_442408.2_1 Forward -393 -374 -5.60541 0.274
NP_441715.1_4 Forward -392 -382 16.303 0.0117
NP_441715.1_4 Reverse -338 -348 5.19158 0.224
NP_440881.1_3 Reverse -320 -339 19.5664 0.132
NP_440183.1_9 Reverse -339 -358 -17.8968 0.276
NP_441198.1_8 Forward -395 -385 12.5877 0.12
NP_441468.1_1 Forward -392 -385 15.8704 0.0124
NP_441468.1_1 Reverse -385 -392 15.8704 0.0124
NP_441468.1_1 Forward -345 -338 4.07068 0.263
NP_439939.1_7 Reverse -58 -77 15.5357 0.175
NP_441020.2_6 Reverse -256 -273 9.87194 0.159
NP_441015.1_10 Reverse -332 -351 -3.73712 0.191
NP_441015.1_10 Forward -333 -314 -6.49039 0.249
NP_441673.1_1 Forward -393 -384 20.8459 0.000698
NP_441673.1_1 Reverse -384 -393 20.8459 0.000698
NP_441673.1_1 Reverse -292 -301 -7.86675 0.187
NP_441673.1_1 Forward -301 -292 -7.96508 0.206
NP_440265.1_7 Forward -346 -332 17.6985 0.158
NP_441826.1_2 Reverse -378 -392 9.04604 0.065
NP_441826.1_2 Reverse -313 -327 3.73617 0.106
NP_441826.1_2 Reverse -252 -266 -3.73699 0.286
NP_442811.1_2 Forward -342 -323 10.1275 0.133
NP_442868.1_6 Forward -395 -385 9.12481 0.0539
NP_442868.1_6 Reverse -382 -392 0.963343 0.205
NP_441056.1_1 Reverse -331 -350 -8.06369 0.282
NP_442808.1_1 Reverse -383 -393 18.4657 0.00201
NP_442808.1_1 Forward -394 -384 8.73102 0.0481
NP_442808.1_1 Reverse -318 -328 5.68278 0.144
NP_442808.1_1 Reverse -330 -340 4.40448 0.199
NP_442808.1_1 Forward -281 -271 0.962914 0.299
NP_441101.1_10 Forward -397 -378 1.96607 0.173
NP_442775.1_6 Forward -333 -314 12.3892 0.277
NP_442775.1_6 Forward -351 -332 10.5209 0.277
NP_442775.1_6 Forward -345 -326 9.73422 0.292
NP_442692.1_1 Reverse -58 -77 -5.01543 0.274
NP_442542.1_9 Reverse -377 -391 11.012 0.111
NP_442050.1_5 Reverse -382 -392 9.12434 0.193
NP_442050.1_5 Forward -269 -259 7.35439 0.26
NP_442050.1_5 Forward -395 -385 6.96107 0.27
NP_440558.1_2 Reverse -316 -335 13.8641 0.0681
NP_440558.1_2 Reverse -322 -341 3.73603 0.153
NP_440558.1_2 Reverse -328 -347 3.53937 0.155
NP_440558.1_2 Forward -338 -319 -6.58872 0.277
NP_440558.1_2 Reverse -310 -329 -6.88371 0.283
NP_441518.1_3 Reverse -374 -393 0.687771 0.0785
NP_441878.1_6 Forward -394 -384 20.2362 0.0046
NP_441878.1_6 Reverse -383 -393 10.4031 0.0176
NP_441878.1_6 Reverse -12 -22 0.963343 0.128
NP_441036.1_8 Reverse -383 -393 17.7779 0.000554
NP_441036.1_8 Forward -394 -384 8.4365 0.174
NP_441557.1_5 Forward -393 -384 19.9609 0.000699
NP_441557.1_5 Reverse -384 -393 19.9609 0.000699
NP_441557.1_8 Forward -21 -11 13.0576 0.225
NP_441445.1_1 Reverse -375 -394 11.7992 0.0796
NP_441445.1_8 Reverse -246 -265 -10.227 0.277
NP_441433.1_2 Reverse -328 -347 15.3391 0.252
NP_441308.1_8 Reverse -382 -392 10.1081 0.22
NP_441458.1_10 Forward -349 -330 7.17762 0.196
NP_442183.1_1 Forward -393 -379 17.4042 0.011
NP_441574.1_1 Forward -322 -303 -1.67217 0.221
NP_441574.1_1 Forward -346 -327 -2.36049 0.226
NP_441574.1_1 Forward -340 -321 -3.44213 0.238
NP_441549.1_9 Reverse -380 -398 -4.79907 0.198
NP_442347.1_2 Forward -392 -383 11.1111 0.056
NP_442347.1_2 Reverse -385 -394 3.34298 0.284
NP_440547.1_1 Reverse -314 -333 12.585 0.177
NP_441037.1_4 Forward -395 -385 17.3558 0.0127
NP_441037.1_4 Reverse -382 -392 7.02532 0.237
NP_441037.1_4 Forward -269 -259 6.05075 0.283
NP_442594.1_8 Reverse -161 -180 2.55606 0.295
NP_442594.1_8 Forward -337 -318 1.57275 0.299
NP_441633.1_3 Reverse -382 -395 5.72248 0.0481
NP_441633.1_3 Forward -395 -382 1.29759 0.109
NP_441633.1_3 Reverse -308 -321 -7.15888 0.294
NP_440136.1_2 Forward -392 -385 15.9687 0.0123
NP_440136.1_2 Reverse -385 -392 15.9687 0.0123
NP_440136.1_2 Reverse -259 -266 4.26735 0.218
NP_442590.1_10 Forward -400 -381 6.88262 0.237
NP_442998.1_10 Forward -391 -384 15.5754 0.0102
NP_442998.1_10 Reverse -386 -393 15.5754 0.0102
NP_440731.1_2 Forward -334 -315 6.29264 0.293
NP_440299.1_1 Forward -397 -384 15.3583 0.017
NP_440299.1_1 Reverse -380 -393 8.18017 0.0964
NP_440299.1_1 Reverse -321 -334 6.50855 0.139
NP_440299.1_1 Reverse -327 -340 5.23026 0.184
NP_441799.1_1 Forward -397 -383 20.2551 0.00585
NP_441799.1_1 Reverse -380 -394 5.89884 0.19
NP_440640.1_6 Forward -334 -315 7.7676 0.17
NP_440640.1_6 Reverse -332 -351 3.44104 0.22
NP_440640.1_6 Reverse -1 -20 0.196116 0.276
NP_441007.1_10 Forward -333 -320 -0.865694 0.295
NP_441449.1_10 Reverse -3 -21 12.9988 0.295
NP_440256.1_1 Reverse -334 -353 9.83255 0.0195
NP_440256.1_1 Forward -396 -377 8.06259 0.0239
NP_440087.1_1 Reverse -375 -394 3.24438 0.167
NP_441559.1_8 Forward -398 -384 0.491246 0.166
NP_441559.1_8 Forward -15 -1 -4.7203 0.236
NP_441559.1_8 Reverse -379 -393 -6.88358 0.281
NP_440915.1_6 Forward -397 -383 2.85119 0.111
NP_440915.1_6 Reverse -254 -268 0.294584 0.17
NP_440915.1_6 Forward -350 -336 -0.492064 0.197
NP_441179.1_9 Reverse -317 -327 10.1076 0.28
NP_440748.1_5 Reverse -328 -347 7.57094 0.181
NP_440748.1_5 Reverse -322 -341 0.491109 0.25
NP_441464.1_8 Reverse -384 -398 6.19444 0.243
NP_440306.1_4 Reverse -208 -227 7.07928 0.299
NP_441199.1_6 Reverse -380 -399 3.04771 0.189
NP_441494.1_6 Reverse -332 -345 8.37742 0.23
NP_442993.1_1 Forward -393 -377 1.92682 0.0502
NP_442386.1_9 Reverse -383 -392 15.7322 0.0144
NP_442386.1_9 Forward -347 -338 10.914 0.111
NP_442386.1_9 Forward -394 -385 6.39082 0.219
NP_440570.1_5 Forward -20 -1 2.45773 0.234
NP_440570.1_5 Forward -344 -325 -2.95047 0.283
NP_441750.1_1 Forward -334 -315 -4.81876 0.204
NP_441750.1_1 Forward -328 -309 -11.6036 0.3
NP_441750.1_1 Reverse -164 -183 -13.3736 0.3
NP_441340.1_5 Forward -392 -385 15.6737 0.0124
NP_441340.1_5 Reverse -385 -392 15.6737 0.0124
NP_441340.1_5 Reverse -338 -345 3.97235 0.274
NP_442484.1_2 Forward -345 -326 3.53937 0.205
NP_442506.1_2 Reverse -326 -345 4.62101 0.269
NP_440586.1_1 Forward -338 -319 5.11266 0.189
NP_440586.1_8 Forward -392 -385 13.2151 0.026
NP_440586.1_8 Reverse -385 -392 13.2151 0.026
NP_442251.1_6 Forward -392 -385 15.2804 0.0124
NP_442251.1_6 Reverse -385 -392 15.2804 0.0124
NP_440684.1_9 Reverse -378 -392 17.5025 0.055
NP_441262.1_3 Reverse -384 -391 14.7888 0.0223
NP_441262.1_3 Forward -393 -386 14.7888 0.0223
NP_440027.1_3 Forward -242 -224 4.93494 0.249
NP_443051.1_1 Forward -394 -385 18.0926 0.00402
NP_443051.1_1 Reverse -383 -392 10.4228 0.00754
NP_439996.1_6 Forward -329 -310 6.1641 0.298
NP_439937.1_9 Reverse -383 -400 2.39808 0.0802
NP_439937.1_9 Reverse -318 -335 -14.7114 0.287
NP_439937.1_9 Forward -394 -377 -16.383 0.287
NP_441595.1_5 Reverse -251 -269 6.11567 0.229
NP_443039.1_7 Reverse -320 -334 8.94708 0.188
NP_440408.1_7 Forward -359 -340 12.2908 0.212
NP_440439.1_1 Reverse -381 -394 19.7838 0.0105
NP_440439.1_1 Forward -396 -383 0.412608 0.192
NP_440372.1_2 Forward -392 -385 16.3621 0.0124
NP_440372.1_2 Reverse -385 -392 16.3621 0.0124
NP_441789.1_7 Forward -180 -161 -3.54122 0.274
NP_441789.1_7 Reverse -315 -334 -5.01617 0.293
NP_441803.1_2 Reverse -314 -333 1.17943 0.238
NP_439977.1_5 Reverse -325 -344 5.89931 0.141
NP_440139.1_1 Reverse -378 -397 15.4366 0.0474
NP_442416.1_10 Forward -164 -145 11.2092 0.297
NP_441572.1_7 Forward -399 -380 -1.37718 0.188
NP_441572.1_7 Reverse -378 -397 -1.57384 0.188
NP_442384.1_10 Reverse -384 -397 17.0305 0.0065
NP_442384.1_10 Forward -393 -380 8.37742 0.0656
NP_441877.1_5 Forward -202 -183 -0.885524 0.283
NP_441018.1_7 Forward -338 -319 12.8808 0.147
NP_441018.1_7 Forward -332 -313 11.1109 0.192
NP_441018.1_7 Forward -350 -331 9.43923 0.223
NP_441018.1_7 Forward -344 -325 6.88262 0.281
NP_442790.1_4 Reverse -161 -180 -9.14533 0.18
NP_442790.1_4 Reverse -375 -394 -13.5702 0.264
NP_442262.1_10 Forward -392 -385 14.1988 0.0123
NP_442262.1_10 Reverse -385 -392 14.1988 0.0123
NP_442262.1_10 Reverse -338 -345 9.87221 0.164
NP_441689.1_5 Reverse -382 -392 8.53436 0.132
NP_441814.1_5 Forward -342 -323 11.1109 0.204
NP_440344.1_10 Forward -400 -383 -2.61609 0.0703
NP_440344.1_10 Reverse -377 -394 -9.10594 0.139
NP_440344.1_10 Forward -287 -270 -13.5308 0.287
NP_440282.1_10 Reverse -374 -393 -4.91709 0.25
NP_440282.1_10 Reverse -327 -346 -6.29373 0.25
NP_440531.1_6 Reverse -376 -395 0.687771 0.19
NP_441060.1_1 Forward -328 -309 11.9863 0.294
NP_442910.1_1 Forward -400 -381 -2.55715 0.254
NP_440562.1_3 Forward -266 -249 9.57695 0.15
NP_441965.1_10 Reverse -381 -397 4.48343 0.238
NP_442693.1_7 Reverse -324 -343 7.47261 0.282
NP_440297.1_9 Reverse -385 -395 9.61647 0.0917
NP_440297.1_9 Forward -392 -382 9.32148 0.0917
NP_442280.1_10 Forward -350 -332 6.91543 0.268
NP_443036.1_1 Forward -354 -335 12.7816 0.224
NP_440999.1_9 Reverse -380 -394 0.392915 0.187
NP_440999.1_9 Forward -388 -374 -3.24533 0.289
NP_440888.1_2 Forward -393 -379 14.2569 0.0193
NP_440888.1_2 Reverse -337 -351 10.5204 0.0919
NP_440888.1_2 Reverse -319 -333 5.89884 0.258
NP_441345.1_8 Forward -159 -140 15.4374 0.26
NP_440052.1_8 Forward -333 -314 11.1109 0.212
NP_439969.1_3 Forward -93 -74 5.11266 0.207
NP_442948.1_2 Forward -394 -375 6.58763 0.233
NP_441917.1_2 Forward -331 -313 5.42735 0.288
NP_441543.1_2 Forward -392 -383 18.486 0.00236
NP_441543.1_2 Reverse -385 -394 9.34117 0.0818
NP_442845.1_2 Reverse -331 -345 5.40779 0.233
NP_442845.1_2 Reverse -378 -392 4.91614 0.249
NP_442845.1_2 Forward -399 -385 3.34284 0.294
NP_441551.1_5 Reverse -380 -396 8.80929 0.228
NP_440982.1_1 Forward -179 -160 10.2251 0.212
NP_441469.1_8 Reverse -383 -392 16.126 0.00797
NP_441469.1_8 Forward -394 -385 13.3727 0.073
NP_443064.1_6 Reverse -384 -394 13.8273 0.0796
NP_442578.1_7 Forward -392 -385 14.5921 0.026
NP_442578.1_7 Reverse -385 -392 14.5921 0.026
NP_441462.1_2 Reverse -384 -394 20.1379 0.000967
NP_441462.1_2 Forward -393 -383 11.5831 0.00406
NP_441621.1_7 Reverse -382 -396 -3.24533 0.188
NP_441621.1_7 Forward -395 -381 -5.40861 0.252
NP_442822.1_1 Reverse -330 -349 3.34271 0.24
NP_443062.1_6 Reverse -376 -395 2.94938 0.247
NP_440519.1_8 Forward -334 -318 11.9566 0.181
NP_441560.1_10 Forward -140 -121 9.83255 0.225
NP_440516.1_2 Forward -399 -381 -2.63579 0.299
NP_440516.1_8 Forward -393 -384 16.9127 0.00442
NP_440516.1_8 Reverse -384 -393 16.9127 0.00442
NP_440516.1_8 Reverse -170 -179 -0.590259 0.283
NP_442080.1_7 Forward -398 -379 6.09597 0.122
NP_442080.1_7 Reverse -267 -286 -3.93378 0.291
NP_442428.1_5 Forward -392 -385 15.8704 0.0124
NP_442428.1_5 Reverse -385 -392 15.8704 0.0124
NP_442428.1_5 Forward -345 -338 4.46401 0.267
NP_440818.1_6 Reverse -247 -266 12.6841 0.228
NP_441443.1_7 Forward -331 -312 8.94757 0.112
NP_442120.1_10 Forward -334 -315 -7.67036 0.222
NP_442120.1_10 Forward -346 -327 -10.3253 0.257
NP_442120.1_10 Forward -352 -333 -16.3235 0.3
NP_440673.1_3 Forward -391 -384 12.4288 0.0426
NP_440673.1_3 Reverse -386 -393 12.4288 0.0426
NP_440673.1_3 Reverse -339 -346 10.5605 0.123
NP_440673.1_3 Reverse -321 -328 8.98723 0.203
NP_440673.1_7 Reverse -247 -266 6.78429 0.155
NP_440865.1_9 Reverse -378 -397 -7.08038 0.24
NP_441052.1_2 Forward -393 -383 10.5014 0.0285
NP_441052.1_2 Reverse -384 -394 10.4031 0.0285
NP_441052.1_2 Forward -179 -169 4.40493 0.159
NP_442219.1_9 Forward -392 -383 8.35786 0.0681
NP_442219.1_9 Reverse -385 -394 8.25953 0.0681
NP_442219.1_9 Forward -266 -257 3.04799 0.206
NP_440436.1_4 Forward -392 -383 18.1905 0.00233
NP_440436.1_4 Reverse -385 -394 15.9289 0.00508
NP_440436.1_4 Reverse -338 -347 10.7174 0.0743
NP_440436.1_4 Reverse -320 -329 7.76745 0.124
NP_441884.1_9 Forward -396 -377 -24.78 0.289
NP_442412.1_3 Reverse -240 -259 10.0292 0.281
NP_441719.1_4 Forward -392 -385 16.3621 0.0124
NP_441719.1_4 Reverse -385 -392 16.3621 0.0124
NP_441733.1_10 Forward -270 -257 8.18076 0.14
NP_441733.1_10 Forward -396 -383 7.09911 0.156
NP_441004.1_1 Forward -334 -315 18.6823 0.0121
NP_441004.1_1 Forward -340 -321 -2.85214 0.15
NP_441004.1_1 Forward -352 -333 -14.5535 0.268
NP_441004.1_2 Forward -357 -338 -0.4922 0.259
NP_441004.1_2 Forward -345 -326 -3.04881 0.271
NP_441004.1_3 Forward -325 -306 2.65439 0.265
NP_441004.1_5 Forward -332 -318 9.04604 0.263
NP_442366.1_3 Forward -394 -376 -3.81576 0.258
NP_442366.1_3 Reverse -318 -336 -5.29072 0.286
NP_442366.1_5 Forward -396 -386 14.0409 0.0497
NP_440296.1_10 Reverse -10 -29 -12.0953 0.269
NP_442206.1_1 Forward -92 -73 -14.8485 0.283
NP_442206.1_10 Forward -334 -319 2.04485 0.208
NP_442206.1_10 Forward -301 -286 -0.315096 0.29
NP_440094.1_9 Forward -341 -322 2.75272 0.173
NP_443054.1_2 Reverse -382 -396 9.04604 0.102
NP_442586.1_5 Reverse -167 -186 15.9291 0.227
NP_441851.1_10 Forward -394 -384 17.4829 0.0027
NP_441851.1_10 Reverse -383 -393 16.008 0.00552
NP_441851.1_10 Forward -268 -258 5.68323 0.203
NP_441851.1_10 Reverse -257 -267 4.20827 0.282
NP_442622.1_8 Forward -393 -375 -9.42063 0.145
NP_442515.1_1 Forward -394 -380 9.73436 0.0603
NP_440593.1_3 Reverse -321 -340 -0.688862 0.209
NP_440593.1_3 Forward -339 -320 -3.54046 0.236
NP_440593.1_3 Forward -345 -326 -7.37537 0.293
NP_441349.1_10 Reverse -374 -393 -7.27704 0.247
NP_441409.1_6 Forward -399 -380 -4.6221 0.0931
NP_440389.1_5 Forward -196 -177 16.6572 0.186
NP_439960.1_6 Reverse -331 -350 14.8474 0.176
NP_442944.1_10 Reverse -141 -160 6.98095 0.269
NP_440474.1_8 Forward -392 -378 14.4536 0.0624
NP_440431.1_3 Reverse -336 -355 -6.29373 0.188
NP_442450.1_5 Forward -395 -385 17.3846 0.0267
NP_442450.1_5 Reverse -382 -392 9.32148 0.115
NP_440588.1_2 Forward -396 -377 -6.49039 0.283
NP_442006.1_2 Reverse -250 -267 -15.7924 0.228
NP_442006.1_2 Reverse -375 -392 -16.9724 0.267
NP_441570.1_1 Forward -393 -375 1.59244 0.0299
NP_441570.1_1 Forward -334 -316 -10.4039 0.17
NP_440078.1_8 Reverse -183 -202 3.6377 0.257
NP_441078.1_4 Forward -393 -384 19.6659 0.0007
NP_441078.1_4 Reverse -384 -393 19.6659 0.0007
NP_442729.1_5 Forward -329 -319 9.12481 0.235
NP_441663.1_8 Reverse -378 -397 -1.57384 0.243
NP_442443.1_1 Forward -160 -141 -3.04881 0.264
NP_440526.1_3 Reverse -385 -396 8.71129 0.116
NP_440526.1_3 Reverse -320 -331 7.33466 0.153
NP_440526.1_3 Forward -21 -10 5.76138 0.233
NP_440526.1_3 Forward -266 -255 1.43483 0.267
NP_441432.1_8 Forward -341 -332 10.0295 0.0681
NP_441432.1_8 Forward -394 -385 8.35786 0.0755
NP_441432.1_8 Reverse -383 -392 8.25953 0.0755
NP_441432.1_8 Forward -335 -326 5.80125 0.137
NP_441432.1_8 Forward -329 -320 5.40793 0.158
NP_442320.1_8 Reverse -378 -392 4.52282 0.0482
NP_441732.1_2 Forward -397 -381 -7.41462 0.0849
NP_441732.1_2 Reverse -380 -396 -17.2477 0.247
NP_442540.1_5 Reverse -332 -351 18.2882 0.233
NP_440290.1_1 Forward -245 -236 16.0328 0.292
NP_442274.1_8 Reverse -318 -336 13.4743 0.286
NP_440199.1_10 Reverse -381 -391 13.2547 0.108
NP_441945.1_10 Forward -335 -316 23.8939 0.00877
NP_441945.1_10 Forward -341 -322 7.57094 0.284
NP_442489.1_7 Forward -393 -384 20.1576 0.000695
NP_442489.1_7 Reverse -384 -393 20.1576 0.000695
NP_440565.1_3 Forward -337 -318 15.4833 0.227
NP_442079.1_7 Forward -345 -326 3.44104 0.212
NP_440559.1_1 Reverse -385 -394 17.306 0.00658
NP_440559.1_1 Forward -392 -383 8.75118 0.0586
NP_441659.2_8 Reverse -384 -394 19.3512 0.000966
NP_441659.2_8 Forward -393 -383 11.9764 0.0147
NP_439956.1_7 Forward -352 -333 6.88262 0.257
NP_442008.1_2 Forward -396 -377 4.52268 0.237
NP_440708.1_7 Reverse -139 -158 11.0125 0.129
NP_441800.1_3 Forward -339 -321 4.24738 0.289
NP_442776.1_1 Reverse -326 -345 22.4189 0.0328
NP_440779.1_5 Reverse -258 -275 -4.87771 0.12
NP_442346.1_5 Forward -394 -384 17.9746 0.00128
NP_442346.1_5 Reverse -383 -393 9.02648 0.118
NP_440545.1_3 Forward -397 -380 13.5102 0.0171
NP_440545.1_3 Reverse -380 -397 -2.12444 0.179
NP_441856.1_3 Reverse -381 -400 0.884433 0.213
NP_440831.1_3 Reverse -375 -394 5.7076 0.28
NP_441653.1_2 Reverse -373 -392 12.2267 0.0984
NP_440010.1_3 Reverse -247 -266 -5.9004 0.25
NP_440010.1_4 Reverse -374 -393 -0.787962 0.262
NP_441888.1_7 Forward -351 -337 10.226 0.126
NP_441888.1_7 Reverse -379 -393 3.93283 0.225
NP_441948.1_4 Forward -400 -382 1.00246 0.134
NP_441833.1_4 Forward -392 -385 15.9687 0.0124
NP_441833.1_4 Reverse -385 -392 15.9687 0.0124
NP_442162.1_9 Forward -392 -385 16.2637 0.0124
NP_442162.1_9 Reverse -385 -392 16.2637 0.0124
NP_440671.1_4 Reverse -378 -392 10.521 0.155
NP_440671.1_4 Reverse -331 -345 8.16106 0.202
NP_440671.1_4 Forward -399 -385 5.80112 0.271
NP_442140.1_3 Reverse -385 -395 13.5497 0.0542
NP_442140.1_3 Forward -392 -382 8.33817 0.119
NP_441671.1_6 Forward -345 -326 8.75091 0.179
NP_442547.1_7 Forward -344 -325 14.6025 0.171
NP_441813.1_5 Reverse -382 -392 17.188 0.00979
NP_441813.1_5 Forward -395 -385 8.82982 0.0367
NP_441813.1_5 Forward -348 -338 -0.806614 0.285
NP_440590.1_4 Reverse -320 -333 -1.45568 0.22
NP_440590.1_4 Forward -392 -379 -3.52063 0.255
NP_440590.1_4 Reverse -385 -398 -5.29059 0.277
NP_440567.1_1 Reverse -385 -399 9.83269 0.0414
NP_440567.1_1 Forward -392 -378 6.3911 0.0837
NP_440567.1_1 Forward -266 -252 2.5562 0.17
NP_442497.1_10 Reverse -385 -394 19.8626 0.00532
NP_442497.1_10 Forward -392 -383 10.4228 0.0087
NP_442497.1_10 Reverse -259 -268 -1.18024 0.256
NP_440821.1_4 Reverse -382 -392 19.0562 0.00399
NP_440821.1_4 Forward -395 -385 10.9931 0.0146
NP_440821.1_4 Forward -269 -259 -0.41329 0.257
NP_441239.1_9 Reverse -382 -394 16.8536 0.0155
NP_441239.1_9 Forward -395 -383 13.3137 0.037
NP_441239.1_9 Forward -348 -336 6.1355 0.2
NP_441239.1_9 Forward -262 -250 3.77555 0.276
NP_441951.1_4 Reverse -68 -87 1.37609 0.283
NP_441892.1_1 Reverse -375 -392 1.90713 0.147
NP_440665.1_1 Forward -22 -3 -15.0452 0.264
NP_442193.1_1 Forward -334 -316 11.2289 0.228
NP_442270.1_9 Forward -351 -332 1.17943 0.14
NP_442270.1_9 Forward -339 -320 -7.17871 0.213
NP_441017.1_6 Reverse -380 -394 11.307 0.273
NP_441017.1_8 Forward -59 -44 10.5996 0.188
NP_440876.1_5 Reverse -321 -340 6.19431 0.283
NP_442138.1_10 Forward -393 -374 19.9606 0.012
NP_442138.1_10 Reverse -103 -122 1.27776 0.126
NP_442052.1_6 Reverse -317 -335 16.1446 0.261
NP_442052.1_8 Forward -395 -385 12.7631 0.253
NP_440546.1_4 Reverse -384 -394 12.8578 0.0572
NP_440546.1_4 Forward -393 -383 11.8882 0.0679
NP_440546.1_6 Forward -335 -316 9.53756 0.247
NP_440462.1_6 Reverse -382 -392 15.418 0.0142
NP_440462.1_6 Forward -395 -385 1.455 0.294
NP_442340.1_3 Reverse -321 -340 5.01433 0.113
NP_440868.1_4 Reverse -380 -392 18.0335 0.0124
NP_440868.1_4 Forward -397 -385 6.52882 0.0878
NP_441084.1_6 Reverse -335 -349 12.0589 0.175
NP_440653.1_10 Reverse -326 -345 8.84924 0.19
NP_442923.1_4 Forward -334 -315 10.0292 0.0739
NP_442923.1_4 Forward -340 -321 1.76941 0.179
NP_442039.1_4 Forward -392 -385 15.1821 0.0124
NP_442039.1_4 Reverse -385 -392 15.1821 0.0124
NP_441811.1_4 Reverse -168 -187 1.0811 0.29
NP_441811.1_8 Reverse -77 -91 5.60446 0.294
NP_440825.1_7 Reverse -385 -395 11.8361 0.2
NP_442837.1_3 Forward -392 -385 15.7721 0.0124
NP_442837.1_3 Reverse -385 -392 15.7721 0.0124
NP_442053.1_1 Forward -393 -384 18.3876 0.0007
NP_442053.1_1 Reverse -384 -393 18.3876 0.0007
NP_442053.1_1 Forward -301 -292 12.1928 0.0312
NP_440505.1_3 Reverse -382 -392 13.8447 0.0247
NP_440505.1_3 Reverse -168 -178 6.17489 0.192
NP_440505.1_3 Forward -330 -320 4.60159 0.277
NP_440505.1_7 Reverse -190 -209 -2.16383 0.289
NP_442360.1_5 Reverse -245 -255 12.9597 0.298
NP_441701.1_3 Forward -338 -321 11.2486 0.213
NP_442532.1_7 Forward -393 -379 3.44117 0.197
NP_440914.1_1 Forward -393 -383 8.6151 0.186
NP_440914.1_1 Reverse -384 -394 8.51751 0.186
NP_440914.1_4 Reverse -317 -333 12.0542 0.271
NP_441011.1_8 Forward -392 -383 16.9127 0.00602
NP_441011.1_8 Reverse -385 -394 14.356 0.0249
NP_442533.1_6 Forward -393 -384 17.2076 0.00137
NP_442533.1_6 Reverse -384 -393 17.2076 0.00137
NP_442533.1_6 Forward -22 -13 4.62128 0.179
NP_442533.1_6 Forward -301 -292 2.26134 0.266
NP_442229.1_1 Reverse -382 -396 9.83206 0.184
NP_441482.1_7 Forward -399 -385 -8.8502 0.193
NP_441482.1_7 Reverse -378 -392 -10.8168 0.216
NP_441482.1_7 Reverse -331 -345 -11.8001 0.284
NP_439944.1_9 Forward -392 -382 10.3048 0.0887
NP_439944.1_9 Reverse -385 -395 8.82982 0.101
NP_440116.1_8 Forward -266 -247 -6.58872 0.211
NP_440115.1_6 Forward -396 -386 9.61647 0.115
NP_441972.1_5 Forward -345 -326 -2.65548 0.187
NP_441106.1_1 Reverse -383 -392 18.191 0.0028
NP_441106.1_1 Forward -394 -385 9.73449 0.0311
NP_441106.1_1 Forward -347 -338 4.42462 0.226
NP_440429.1_2 Reverse -326 -345 7.07928 0.295
NP_439903.1_6 Reverse -316 -335 -0.29631 0.28
NP_442306.1_10 Forward -398 -379 -21.1417 0.247
NP_441286.1_1 Reverse -383 -395 5.93884 0.0258
NP_441286.1_1 Forward -394 -382 5.05386 0.0259
NP_442674.1_3 Forward -348 -329 7.86512 0.213
NP_440092.1_1 Forward -229 -210 31.1704 0.000213
NP_440092.1_2 Forward -109 -90 29.7937 0.000716
NP_440092.1_3 Forward -202 -183 27.9255 0.00189
NP_440092.1_4 Forward -250 -231 29.4004 0.000522
NP_440092.1_5 Forward -76 -57 28.6138 0.00061
NP_440092.1_6 Forward -56 -37 28.1212 0.000512
NP_440092.1_7 Forward -136 -117 25.5042 0.00772
NP_440092.1_9 Forward -156 -137 21.2389 0.149
NP_440092.1_10 Forward -178 -159 22.0247 0.0771
NP_440670.1_8 Forward -393 -384 18.3876 0.000699
NP_440670.1_8 Reverse -384 -393 18.3876 0.000699
NP_441930.1_1 Forward -397 -378 17.5024 0.162
NP_440886.1_7 Reverse -383 -393 17.7774 0.0011
NP_440886.1_7 Forward -180 -170 15.3192 0.0296
NP_440886.1_7 Forward -394 -384 8.04271 0.0805
NP_440828.1_1 Forward -180 -161 -1.47628 0.287
NP_442614.1_2 Reverse -384 -398 16.6175 0.0675
NP_442072.1_9 Forward -394 -376 -12.5672 0.0852
NP_440907.2_8 Reverse -385 -395 16.2041 0.0161
NP_440907.2_8 Forward -392 -382 7.84605 0.117
NP_440907.2_8 Forward -266 -256 6.0761 0.179
NP_440907.2_8 Reverse -259 -269 5.19112 0.215
NP_441021.1_1 Reverse -320 -339 8.75091 0.0482
NP_441021.1_1 Reverse -326 -345 1.17943 0.0848
NP_441021.1_1 Reverse -259 -278 -12.9802 0.3
NP_441021.1_8 Forward -398 -380 7.68896 0.184
NP_441463.1_3 Reverse -374 -393 2.55606 0.115
NP_441463.1_3 Reverse -321 -340 -2.26216 0.152
NP_441463.1_3 Reverse -315 -334 -4.81876 0.215
NP_441463.1_3 Reverse -327 -346 -7.76869 0.261
NP_441626.1_2 Forward -392 -385 15.7721 0.0124
NP_441626.1_2 Reverse -385 -392 15.7721 0.0124
NP_442211.1_3 Reverse -326 -345 11.8488 0.257
NP_442211.1_3 Forward -352 -333 7.37474 0.283
NP_441589.1_3 Forward -272 -258 20.8458 0.0738
NP_442794.1_1 Forward -338 -326 4.5622 0.256
NP_442794.1_1 Forward -397 -385 2.79224 0.286
NP_441962.1_4 Forward -333 -314 -3.3438 0.146
NP_441962.1_4 Forward -339 -320 -8.06369 0.195
NP_441962.1_4 Forward -360 -341 -9.83364 0.222
NP_440387.1_1 Forward -393 -377 7.92501 0.0282
NP_440387.1_1 Reverse -384 -400 -1.41643 0.142
NP_441431.1_2 Reverse -381 -395 12.0937 0.128
NP_441431.1_2 Forward -396 -382 6.29216 0.275
NP_441993.1_1 Reverse -331 -350 1.36194 0.28
NP_441993.1_1 Forward -328 -309 0.582284 0.297
NP_442084.1_6 Forward -337 -319 13.8838 0.16
NP_440114.1_10 Forward -393 -379 13.8643 0.0481
NP_440725.1_4 Forward -272 -253 7.27595 0.137
NP_441510.2_7 Reverse -378 -392 11.307 0.28
NP_441272.1_4 Forward -337 -318 7.47261 0.189
NP_440293.1_10 Forward -331 -312 -3.3438 0.294
NP_440766.1_4 Reverse -380 -394 5.50613 0.11
NP_441237.1_9 Reverse -385 -395 17.188 0.00445
NP_441237.1_9 Reverse -259 -269 12.8614 0.102
NP_440643.1_6 Reverse -320 -339 11.1109 0.112
NP_439910.1_2 Reverse -376 -393 -11.6625 0.0788
NP_440457.1_1 Forward -397 -385 11.937 0.092
NP_440457.1_1 Reverse -75 -87 4.46387 0.161
NP_440457.1_1 Reverse -380 -392 1.90727 0.223
NP_440457.1_1 Forward -69 -57 -1.23932 0.3
NP_440798.1_6 Reverse -385 -398 11.524 0.0592
NP_440798.1_6 Forward -392 -379 4.73917 0.143
NP_440801.1_10 Reverse -333 -352 7.47261 0.272
NP_440473.1_9 Reverse -373 -392 1.37609 0.108
NP_442509.1_9 Reverse -384 -394 17.3841 0.00128
NP_442509.1_9 Forward -393 -383 16.2041 0.00739
NP_442509.1_9 Forward -76 -66 7.15773 0.234
NP_442784.1_3 Reverse -344 -363 13.9625 0.264
NP_441253.1_8 Forward -398 -384 10.4745 0.282
NP_442439.1_8 Reverse -318 -337 10.3242 0.246
NP_440554.1_4 Forward -392 -382 14.6313 0.02
NP_440554.1_4 Reverse -338 -348 5.78156 0.132
NP_441885.1_5 Forward -393 -383 11.4848 0.00668
NP_441885.1_5 Reverse -384 -394 11.3864 0.00668
NP_441885.1_5 Reverse -292 -302 -0.314959 0.195
NP_440478.1_9 Reverse -329 -348 10.4225 0.255
NP_442341.1_7 Forward -394 -380 7.37441 0.107
NP_442341.1_7 Reverse -383 -397 5.1128 0.167
NP_442341.1_9 Reverse -382 -396 17.1085 0.0304
NP_441756.1_5 Reverse -9 -28 0.294447 0.238
NP_441756.1_5 Forward -284 -265 -1.96717 0.267
NP_442395.2_9 Reverse -193 -209 15.2015 0.226
NP_443000.1_7 Reverse -382 -392 8.73149 0.0437
NP_443000.1_7 Forward -395 -385 2.04498 0.226
NP_440275.1_3 Forward -395 -385 9.91146 0.046
NP_440275.1_3 Reverse -382 -392 8.4365 0.0602
NP_440091.1_1 Reverse -380 -392 15.8703 0.0161
NP_442275.1_1 Forward -202 -183 1.96607 0.284
NP_440679.1_10 Reverse -377 -396 -12.7836 0.213
NP_440127.1_4 Forward -333 -319 17.1092 0.275
NP_443010.1_10 Reverse -381 -398 9.63179 0.135
NP_441359.1_5 Reverse -316 -335 1.17943 0.29
NP_442451.1_2 Reverse -376 -395 -7.96535 0.241
NP_441122.1_1 Forward -339 -324 3.61814 0.281
NP_442753.1_6 Reverse -316 -335 7.27514 0.239
NP_439962.1_4 Reverse -139 -158 -7.76869 0.29
NP_439962.1_6 Reverse -322 -340 6.90232 0.288
NP_440175.1_7 Forward -350 -332 10.0463 0.268
NP_440149.1_8 Forward -346 -327 1.47442 0.124
NP_440149.1_8 Forward -334 -315 -6.39206 0.25
NP_441105.1_3 Reverse -326 -345 -8.94866 0.281
NP_442373.1_2 Forward -337 -318 -0.983855 0.198
NP_440216.1_1 Reverse -384 -398 7.07942 0.01
NP_440216.1_1 Forward -393 -379 6.58777 0.0145
NP_440172.1_1 Reverse -384 -394 16.303 0.00854
NP_440172.1_1 Forward -393 -383 8.73149 0.0586
NP_440172.1_1 Forward -346 -336 4.10993 0.205
NP_442015.1_10 Forward -397 -384 11.0324 0.0384
NP_442015.1_10 Reverse -380 -393 9.85238 0.0433
NP_442015.1_10 Reverse -327 -340 -0.472371 0.268
NP_441226.1_7 Forward -392 -385 14.4934 0.0123
NP_441226.1_7 Reverse -385 -392 14.4934 0.0123
NP_440198.1_10 Reverse -192 -211 21.2389 0.0533
NP_441111.1_7 Forward -392 -384 18.7023 0.00294
NP_441111.1_7 Reverse -385 -393 18.7023 0.00294
NP_442379.1_10 Reverse -377 -394 -2.61609 0.238
NP_441766.1_2 Forward -393 -384 17.5026 0.00297
NP_441766.1_2 Reverse -384 -393 17.5026 0.00297
NP_440416.1_9 Forward -400 -381 -16.8151 0.223
NP_443052.1_8 Reverse -374 -393 0.196116 0.0669
NP_443052.1_9 Reverse -315 -334 7.07928 0.136
NP_443052.1_9 Forward -363 -344 6.19431 0.138
NP_443052.1_9 Reverse -321 -340 -6.09707 0.276
NP_443052.1_9 Forward -351 -332 -7.08038 0.293
NP_440072.1_5 Forward -334 -316 -3.22577 0.277
NP_442403.1_9 Reverse -211 -230 2.45773 0.285
NP_442154.1_1 Forward -333 -315 -13.5505 0.217
NP_442154.1_1 Forward -327 -309 -14.2388 0.217
NP_442154.1_1 Forward -283 -265 -19.3521 0.298
NP_442226.1_8 Forward -131 -121 15.6147 0.167
NP_440261.1_5 Reverse -385 -398 6.80412 0.0316
NP_440261.1_5 Reverse -135 -148 -8.14219 0.201
NP_440261.1_5 Forward -392 -379 -12.1738 0.272
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTTGCTGGGCGATCGCCGTCTTCGTCTAGTGCTAGTACATCCAGTAGTGCCTCCAGCAATGGCTTTGGCAGTGGCAATGGTGGTGGTTACAGTAATTCTGCCGTGCGCCTAGATAACAGCGTGGTTACCCAGGTGCGTTCCCTCCTGGCCCAGGGTTACAAAATTGGCACCGAACACACGGATAAACGTCGCTTTAAAGCCAAATCCTGGCAGAGTTGTGCCCCTATCACCAGTACCCACGAGTCGGAAGTGTTGCGGGCCCTAGAAGGTTGTTTGGCAGACCATAACGGCGAATATGTCCGCTTACTAGGCATAGATCCCACGGCTAAACGGCGGGTGTTGGAAACCATTATTCAGCGTCCCTAGTAATTACTAGTTGACCAGCCCCCCGGATTTTGCC

CDS

ATGCAGTTACCGCCCGTTCACAGTGTTAGTCTTTCTGAATATTTTGTGAGTGGTAACGTGATCATTCACGAAACAGCGGTCATTGCTCCGGGGGTTATTTTAGAAGCGGCTCCGGATTGTCAAATTACCATTGAAGCCGGAGTCTGCATTGGTTTAGGCAGTGTGATTAGCGCCCATGCCGGTGACGTGAAAATTCAGGAGCAGACGGCGATCGCCCCTGGCTGTCTAGTAATCGGGCCAGTGACCATTGGGGCAACAGCTTGTCTCGGTTCCCGGAGTACCGTTTTTCAGCAGGATATTGATGCCCAGGTCCTAATTCCTCCCGGCTCCTTATTAATGAATCGGGTTGCCGATGTCCAGACGGTAGGGGCTAGTTCTCCAACAACTGACAGCGTTACTGAAAAAAAATCCCCTTCAACCGCAAACCCCATTGCCCCTATTCCTTCCCCCTGGGACAACGAGCCCCCTGCAAAGGGGACAGATTCCCCGTCAGATCAAGCAAAAGAATCCATTGCCAGGCAATCAAGGCCATCAACCGCCGAGGCCGCAGAACAGATTTCCTCAAATCGATCCCCTGGGGAATCGACGCCAACTGCTCCGACGGTGGTCACCACTGCGCCATTAGTTTCAGAAGAAGTACAAGAAAAGCCTCCCGTAGTGGGTCAGGTTTACATTAATCAGTTACTCTTAACCCTATTTCCGGAACGACGATATTTTAGTTCTTAA

Protein

MQLPPVHSVSLSEYFVSGNVIIHETAVIAPGVILEAAPDCQITIEAGVCIGLGSVISAHAGDVKIQEQTAIAPGCLVIGPVTIGATACLGSRSTVFQQDIDAQVLIPPGSLLMNRVADVQTVGASSPTTDSVTEKKSPSTANPIAPIPSPWDNEPPAKGTDSPSDQAKESIARQSRPSTAEAAEQISSNRSPGESTPTAPTVVTTAPLVSEEVQEKPPVVGQVYINQLLLTLFPERRYFSS