Your browser is old and dusty. Try Google Chrome!

Details for sll1030

ORF sll1030
Accession NP_440094.1
Symbol ccmL
Category CO2 fixation
Definition carbon dioxide concentrating mechanism protein CcmL, putative carboxysome assembly protein
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_440795.1_7 Reverse -193 -200 13.1171 0.0477
NP_440795.1_7 Forward -229 -222 6.43063 0.265
NP_441480.1_1 Forward -301 -282 -0.983855 0.293
NP_441453.1_7 Forward -390 -383 14.1988 0.175
NP_441453.1_7 Forward -340 -333 11.6422 0.298
NP_441623.1_1 Forward -44 -26 -5.48739 0.29
NP_442877.1_4 Reverse -299 -318 22.0247 0.114
NP_442975.1_10 Reverse -305 -319 4.52221 0.245
NP_441054.1_2 Forward -167 -148 13.6675 0.197
NP_441476.1_5 Forward -359 -340 -7.37537 0.288
NP_442826.1_3 Reverse -324 -343 11.9958 0.121
NP_441900.1_2 Reverse -308 -326 -0.571569 0.27
NP_442181.1_7 Reverse -286 -304 20.767 0.0658
NP_440893.1_3 Reverse -181 -200 -0.591301 0.281
NP_441594.1_6 Reverse -186 -205 6.58763 0.189
NP_442726.1_7 Forward -325 -307 0.904127 0.254
NP_441925.1_4 Reverse -65 -84 -14.7509 0.263
NP_440856.1_7 Forward -336 -317 2.16274 0.157
NP_440856.1_7 Forward -252 -233 -6.29373 0.238
NP_442827.1_8 Reverse -334 -353 -3.04956 0.296
NP_441434.1_7 Reverse -344 -358 10.9143 0.147
NP_441738.1_2 Forward -99 -92 6.52862 0.261
NP_441783.1_2 Reverse -77 -86 17.2076 0.108
NP_441327.1_1 Forward -35 -16 8.82662 0.211
NP_440944.1_2 Forward -78 -59 0.884433 0.256
NP_441634.1_8 Forward -338 -324 0.88457 0.215
NP_440376.1_1 Reverse -125 -134 7.66954 0.0706
NP_441857.1_5 Forward -204 -186 1.59244 0.297
NP_442687.1_7 Forward -172 -162 11.8781 0.0928
NP_442687.1_7 Forward -67 -57 7.05986 0.142
NP_442191.1_4 Forward -395 -381 16.5197 0.0365
NP_441422.1_7 Reverse -190 -207 -1.14113 0.181
NP_440360.1_4 Reverse -310 -329 7.66927 0.229
NP_440446.1_6 Forward -343 -324 14.0608 0.298
NP_439959.1_5 Forward -290 -271 14.8474 0.189
NP_441958.1_3 Forward -332 -313 15.5357 0.218
NP_441127.1_1 Reverse -288 -302 8.94771 0.284
NP_442025.1_4 Forward -331 -312 10.6192 0.291
NP_442690.1_1 Forward -37 -18 7.27595 0.0645
NP_440934.1_2 Reverse -273 -292 2.0644 0.258
NP_440411.1_4 Forward -122 -103 14.5524 0.123
NP_442438.1_10 Forward -359 -345 3.24451 0.165
NP_442438.1_10 Reverse -337 -351 0.88457 0.213
NP_442438.1_10 Forward -191 -177 -0.492064 0.264
NP_442566.1_2 Forward -130 -111 1.67108 0.289
NP_442566.1_5 Reverse -260 -279 27.3346 0.00114
NP_440147.1_4 Reverse -307 -320 0.0192843 0.268
NP_441916.1_1 Reverse -299 -318 11.8975 0.171
NP_441916.1_7 Forward -201 -191 5.78156 0.12
NP_441916.1_7 Reverse -306 -316 2.04498 0.265
NP_440206.1_4 Forward -94 -75 -1.37794 0.29
NP_440465.1_10 Forward -318 -299 -0.295539 0.29
NP_441041.1_1 Forward -176 -157 5.99764 0.282
NP_441041.1_4 Reverse -192 -211 -12.0953 0.258
NP_441041.1_4 Reverse -291 -310 -12.2919 0.262
NP_442396.1_5 Forward -154 -141 7.19745 0.213
NP_439966.1_9 Forward -194 -185 3.7363 0.253
NP_440983.1_5 Reverse -345 -364 0.982764 0.214
NP_440983.1_5 Forward -134 -115 -5.50708 0.266
NP_440983.1_5 Reverse -309 -328 -8.16202 0.294
NP_440260.1_8 Forward -330 -312 -3.32411 0.251
NP_440395.1_9 Forward -242 -223 17.109 0.233
NP_440723.1_4 Reverse -323 -342 -9.53865 0.272
NP_442029.1_1 Forward -284 -265 -12.9802 0.263
NP_442933.1_10 Forward -201 -192 4.42462 0.246
NP_440435.1_4 Forward -326 -307 16.2241 0.24
NP_442075.1_1 Forward -331 -312 7.07928 0.269
NP_441762.1_7 Reverse -191 -203 -5.56589 0.217
NP_442142.1_4 Reverse -228 -241 2.57534 0.286
NP_442476.1_6 Forward -200 -186 -0.197071 0.29
NP_440357.1_3 Forward -194 -175 -0.983855 0.296
NP_440357.1_9 Forward -326 -307 16.2241 0.294
NP_440379.1_5 Forward -315 -296 -4.42544 0.215
NP_440379.1_5 Forward -330 -311 -6.29373 0.231
NP_440379.1_5 Reverse -309 -328 -9.047 0.259
NP_441020.2_6 Reverse -36 -53 8.00365 0.212
NP_441015.1_10 Reverse -114 -133 -3.63879 0.19
NP_441015.1_10 Forward -326 -307 -6.09707 0.241
NP_441673.1_1 Forward -318 -309 -7.86675 0.187
NP_441673.1_1 Reverse -309 -318 -7.96508 0.206
NP_441956.1_9 Forward -85 -66 8.65258 0.25
NP_441426.1_3 Forward -327 -308 10.3234 0.257
NP_441826.1_2 Reverse -189 -203 -0.787057 0.224
NP_442719.1_2 Reverse -142 -160 -8.43801 0.249
NP_442227.1_2 Reverse -157 -176 1.47442 0.245
NP_442808.1_1 Forward -126 -116 5.19112 0.168
NP_442808.1_1 Forward -288 -278 2.63453 0.26
NP_442808.1_1 Reverse -325 -335 1.15957 0.292
NP_442775.1_6 Forward -371 -352 10.3242 0.277
NP_440145.1_3 Reverse -47 -66 -4.81876 0.25
NP_442113.1_10 Reverse -71 -90 -7.57203 0.27
NP_440558.1_2 Forward -345 -326 0.392778 0.191
NP_440558.1_2 Forward -138 -119 -2.0655 0.222
NP_440162.1_2 Forward -330 -311 4.916 0.296
NP_442789.1_4 Reverse -307 -326 -0.0988766 0.198
NP_442789.1_4 Reverse -310 -329 -2.26216 0.233
NP_441445.1_1 Reverse -116 -135 5.30933 0.172
NP_441590.1_4 Forward -212 -193 2.06362 0.297
NP_442066.2_9 Forward -322 -309 13.9823 0.154
NP_442777.1_1 Forward -48 -29 3.9319 0.3
NP_440101.1_3 Reverse -187 -206 0.392778 0.299
NP_440101.1_10 Reverse -291 -310 3.44104 0.236
NP_440356.1_1 Reverse -159 -178 11.7 0.285
NP_441574.1_1 Forward -318 -299 -5.70374 0.267
NP_441574.1_1 Forward -213 -194 -6.09707 0.273
NP_442347.1_2 Forward -17 -8 6.09625 0.191
NP_442645.1_2 Reverse -49 -68 -15.2418 0.194
NP_442738.1_2 Forward -245 -226 18.879 0.00254
NP_442738.1_5 Forward -362 -343 11.3075 0.199
NP_441633.1_3 Reverse -340 -353 -6.96221 0.283
NP_440299.1_1 Forward -205 -192 3.55864 0.241
NP_441799.1_1 Forward -105 -91 5.01387 0.227
NP_441799.1_1 Reverse -188 -202 3.44058 0.298
NP_440640.1_6 Reverse -26 -45 -0.4922 0.285
NP_442802.1_2 Reverse -308 -327 17.3048 0.203
NP_441007.1_10 Forward -323 -310 0.412608 0.23
NP_441007.1_10 Forward -89 -76 -0.275709 0.273
NP_441007.1_10 Reverse -301 -314 -0.669033 0.287
NP_441435.1_5 Forward -352 -333 5.80098 0.216
NP_441362.1_2 Reverse -16 -35 6.70529 0.243
NP_442007.1_6 Reverse -1 -20 9.24257 0.212
NP_441559.1_8 Forward -292 -278 -3.73699 0.209
NP_441559.1_8 Forward -341 -327 -5.01529 0.245
NP_441559.1_8 Reverse -382 -396 -5.21195 0.254
NP_441270.1_5 Forward -333 -314 11.14 0.294
NP_440915.1_6 Reverse -88 -102 -2.65535 0.278
NP_442158.1_4 Reverse -260 -270 10.6981 0.283
NP_442158.1_4 Forward -393 -383 10.4031 0.297
NP_442855.1_3 Reverse -300 -319 16.4207 0.149
NP_441261.1_1 Forward -294 -275 -1.37718 0.205
NP_442866.1_1 Forward -245 -226 -6.39206 0.255
NP_441464.1_8 Reverse -309 -323 5.70279 0.253
NP_441199.1_6 Reverse -272 -291 3.93269 0.175
NP_441199.1_6 Reverse -305 -324 2.26107 0.198
NP_441199.1_6 Forward -292 -273 0.392778 0.243
NP_442993.1_1 Reverse -284 -300 -12.8228 0.281
NP_442386.1_9 Reverse -326 -335 5.60418 0.245
NP_440570.1_5 Forward -310 -291 5.11266 0.204
NP_440570.1_5 Reverse -293 -312 -3.04881 0.286
NP_441340.1_9 Reverse -24 -34 8.25522 0.256
NP_442791.1_5 Reverse -191 -210 -6.09707 0.279
NP_442791.1_5 Forward -209 -190 -9.63698 0.279
NP_440768.1_2 Forward -140 -121 1.0811 0.27
NP_440327.1_6 Reverse -291 -310 10.6192 0.189
NP_440684.1_9 Forward -207 -193 8.55439 0.226
NP_439984.1_3 Forward -73 -59 12.6836 0.263
NP_439937.1_8 Forward -326 -307 6.68596 0.192
NP_439937.1_8 Reverse -310 -329 -4.03212 0.276
NP_442239.1_8 Reverse -299 -318 8.65258 0.249
NP_440574.1_3 Reverse -352 -371 -0.0988766 0.265
NP_440210.1_2 Forward -97 -78 13.0775 0.269
NP_440210.1_3 Reverse -333 -352 18.9773 0.0996
NP_441877.1_7 Reverse -187 -206 15.8299 0.0595
NP_441018.1_7 Reverse -188 -207 7.17762 0.276
NP_440189.1_10 Reverse -64 -83 5.30933 0.279
NP_441640.1_8 Reverse -352 -371 1.76941 0.168
NP_440937.1_8 Forward -366 -347 3.24438 0.293
NP_442845.1_2 Reverse -119 -133 3.44117 0.29
NP_442578.1_7 Reverse -193 -200 9.87221 0.122
NP_441621.1_7 Reverse -313 -327 2.94952 0.123
NP_441621.1_7 Reverse -73 -87 0.392915 0.153
NP_441929.1_6 Reverse -14 -33 6.98095 0.294
NP_443062.1_6 Reverse -30 -49 3.04771 0.245
NP_442204.1_1 Forward -88 -77 3.50026 0.266
NP_440255.1_7 Reverse -18 -35 10.6586 0.264
NP_440783.1_5 Forward -245 -226 -5.50708 0.277
NP_442120.1_10 Forward -318 -299 -15.8318 0.296
NP_440603.1_9 Forward -326 -307 8.94757 0.217
NP_442219.1_8 Reverse -172 -191 11.5493 0.175
NP_441884.1_9 Reverse -306 -325 -21.0434 0.225
NP_442086.1_3 Forward -253 -234 6.39097 0.288
NP_440314.1_3 Forward -64 -48 18.6431 0.0474
NP_441004.1_1 Forward -176 -157 -10.4236 0.219
NP_441004.1_1 Reverse -291 -310 -14.5535 0.268
NP_441004.1_2 Forward -181 -162 -2.16383 0.263
NP_442366.1_3 Reverse -191 -209 -5.09406 0.281
NP_442366.1_3 Reverse -74 -92 -5.09406 0.281
NP_442873.1_9 Forward -328 -309 16.3215 0.0693
NP_441115.1_9 Reverse -311 -329 24.7002 0.00663
NP_440094.1_1 Forward -134 -115 38.9385 0.000000631
NP_440094.1_2 Forward -311 -292 28.4171 0.000154
NP_440094.1_3 Forward -101 -82 35.6936 0.00000467
NP_440094.1_4 Forward -224 -205 30.0887 0.000307
NP_440094.1_5 Forward -275 -256 34.317 0.00000253
NP_440094.1_6 Forward -251 -232 31.1704 0.000136
NP_440094.1_7 Forward -80 -61 29.0071 0.00101
NP_440094.1_8 Forward -344 -325 31.5637 0.000189
NP_440094.1_8 Forward -343 -324 3.83436 0.215
NP_440094.1_9 Forward -367 -348 34.317 0.0000262
NP_440094.1_10 Forward -155 -136 27.7279 0.00117
NP_442430.1_6 Forward -270 -251 5.99764 0.271
NP_441966.1_7 Reverse -221 -240 -1.96793 0.297
NP_442208.1_5 Forward -320 -301 -10.4236 0.299
NP_440682.1_2 Reverse -310 -329 -16.6185 0.25
NP_441501.1_9 Reverse -283 -302 15.9282 0.214
NP_442515.1_1 Reverse -341 -355 -4.7203 0.298
NP_442515.1_1 Reverse -308 -322 -4.7203 0.298
NP_440463.1_8 Forward -328 -309 11.4692 0.203
NP_441046.1_2 Reverse -27 -46 3.6377 0.231
NP_440338.1_4 Forward -63 -44 5.01354 0.298
NP_442689.1_8 Forward -33 -16 0.137172 0.191
NP_442843.1_1 Forward -83 -64 -10.522 0.278
NP_439960.1_10 Forward -328 -310 13.8838 0.0769
NP_439950.1_1 Reverse -48 -57 12.2911 0.287
NP_442006.1_2 Forward -93 -76 -16.1858 0.243
NP_442038.1_1 Reverse -6 -25 -0.295539 0.278
NP_441570.1_1 Forward -351 -333 0.707465 0.0372
NP_440707.1_9 Forward -83 -64 9.24257 0.202
NP_442443.1_1 Forward -83 -64 -1.27885 0.233
NP_440526.1_3 Reverse -346 -357 5.36805 0.249
NP_441732.1_2 Forward -304 -288 -16.3627 0.165
NP_440760.1_1 Reverse -309 -328 -15.1435 0.142
NP_440760.1_1 Reverse -342 -361 -16.7168 0.184
NP_442274.1_8 Reverse -112 -130 13.6652 0.286
NP_442274.1_8 Reverse -256 -274 13.3789 0.286
NP_441072.1_2 Reverse -188 -207 7.37428 0.257
NP_441092.1_3 Reverse -59 -78 5.70265 0.183
NP_440352.1_5 Forward -277 -258 15.0891 0.13
NP_440545.1_3 Reverse -71 -88 6.23369 0.0568
NP_440545.1_3 Reverse -302 -319 -4.77938 0.232
NP_440545.1_3 Forward -319 -302 -4.97604 0.237
NP_440831.1_3 Forward -327 -308 7.16376 0.263
NP_440486.1_6 Reverse -311 -330 5.70265 0.293
NP_440010.1_6 Forward -329 -310 4.71934 0.236
NP_440847.1_5 Reverse -205 -224 12.2908 0.281
NP_442828.1_7 Forward -174 -155 -4.32711 0.276
NP_441585.1_5 Reverse -281 -300 -0.886293 0.298
NP_441047.1_2 Reverse -313 -332 0.982764 0.239
NP_440204.1_5 Forward -35 -16 13.2234 0.23
NP_440875.1_9 Reverse -185 -195 8.76138 0.233
NP_441813.1_5 Reverse -190 -200 -0.511621 0.247
NP_440594.1_6 Reverse -303 -322 7.07848 0.257
NP_441227.1_10 Forward -86 -67 18.9773 0.0634
NP_440665.1_1 Reverse -345 -364 -17.1101 0.298
NP_441508.1_3 Forward -380 -361 18.9699 0.193
NP_439974.1_4 Forward -95 -76 9.3409 0.252
NP_440462.1_4 Forward -241 -227 9.93102 0.242
NP_442611.1_1 Forward -326 -307 -0.983855 0.273
NP_442402.1_4 Reverse -63 -82 -5.1145 0.236
NP_442402.1_4 Reverse -330 -349 -7.47443 0.276
NP_442402.1_4 Reverse -156 -175 -10.2277 0.298
NP_440696.1_3 Forward -201 -183 -3.6191 0.287
NP_441811.1_8 Forward -357 -343 8.25939 0.238
NP_440753.1_5 Reverse -48 -67 8.75091 0.274
NP_442679.1_1 Reverse -25 -44 -4.22878 0.274
NP_439994.1_3 Forward -109 -90 8.24345 0.291
NP_441203.1_1 Forward -346 -327 -17.3068 0.288
NP_441408.2_7 Forward -308 -289 0.786102 0.215
NP_441011.1_8 Forward -200 -191 5.99792 0.208
NP_442533.1_6 Forward -134 -125 11.2095 0.046
NP_441089.1_6 Forward -56 -37 9.14423 0.258
NP_441028.1_6 Forward -332 -322 6.0761 0.232
NP_441028.1_6 Forward -33 -23 4.89613 0.275
NP_440115.1_6 Forward -257 -247 4.60159 0.293
NP_441680.1_4 Reverse -313 -332 15.6341 0.122
NP_441680.1_4 Forward -206 -187 3.24438 0.218
NP_441106.1_1 Forward -202 -193 4.71961 0.21
NP_441286.1_1 Reverse -341 -353 0.825626 0.107
NP_441809.1_1 Reverse -283 -302 12.585 0.223
NP_440886.1_7 Reverse -308 -318 5.48612 0.181
NP_442614.1_2 Reverse -125 -139 8.16106 0.255
NP_442382.1_9 Forward -340 -321 11.7 0.266
NP_440767.1_2 Forward -308 -289 11.2092 0.0465
NP_440767.1_4 Forward -347 -328 13.4708 0.104
NP_440223.1_3 Forward -323 -307 23.2646 0.0597
NP_442963.1_3 Forward -188 -170 15.5554 0.273
NP_441463.1_1 Reverse -39 -57 13.3922 0.273
NP_441463.1_3 Reverse -347 -366 -10.4236 0.294
NP_442615.1_1 Forward -356 -338 -7.15901 0.278
NP_440855.1_5 Reverse -301 -320 4.03023 0.287
NP_442352.1_8 Forward -131 -117 16.4202 0.242
NP_440095.1_1 Forward -134 -115 38.4469 0.000000631
NP_440095.1_2 Forward -95 -76 31.4654 0.0000623
NP_440095.1_3 Forward -317 -298 12.3892 0.0599
NP_440095.1_4 Forward -275 -256 35.5953 0.00000137
NP_440095.1_5 Forward -224 -205 21.5339 0.00773
NP_440095.1_6 Forward -251 -232 32.0554 0.0000648
NP_440095.1_7 Forward -296 -277 32.6453 0.0000629
NP_440095.1_8 Forward -170 -151 18.0924 0.0639
NP_440095.1_9 Forward -359 -340 27.2371 0.000137
NP_440095.1_10 Forward -203 -184 18.4857 0.0647
NP_440293.1_3 Reverse -289 -308 -6.29373 0.288
NP_440766.1_5 Reverse -145 -157 8.03776 0.286
NP_439988.1_10 Reverse -14 -33 7.38595 0.231
NP_442743.1_4 Reverse -315 -334 -6.49039 0.279
NP_442103.1_1 Forward -128 -114 14.2576 0.254
NP_442103.1_2 Forward -330 -312 7.09821 0.292
NP_440457.1_1 Forward -88 -76 1.61227 0.232
NP_442680.1_7 Reverse -18 -37 -7.17871 0.279
NP_440473.1_3 Reverse -75 -94 14.1591 0.287
NP_441765.1_4 Forward -273 -254 12.9791 0.162
NP_442514.1_5 Forward -137 -118 -9.83437 0.298
NP_440478.1_9 Reverse -309 -328 9.14423 0.259
NP_442341.1_9 Reverse -282 -296 4.52221 0.299
NP_441756.1_5 Forward -291 -272 8.65258 0.134
NP_441756.1_5 Reverse -272 -291 -0.885524 0.25
NP_441756.1_9 Forward -191 -172 17.7329 0.257
NP_440507.2_3 Reverse -228 -247 10.3234 0.208
NP_440679.1_10 Forward -247 -228 -14.9469 0.25
NP_440679.1_10 Reverse -233 -252 -15.0452 0.25
NP_439962.1_4 Reverse -310 -329 1.76941 0.197
NP_439962.1_4 Reverse -307 -326 -7.27704 0.288
NP_440216.1_9 Forward -190 -181 11.1111 0.277
NP_440216.1_9 Forward -127 -118 10.3245 0.286
NP_440678.1_9 Forward -356 -337 9.43923 0.279
NP_440249.1_2 Reverse -13 -23 15.7125 0.268
NP_441226.1_7 Forward -133 -126 5.64364 0.286
NP_440416.1_9 Forward -208 -189 -15.5368 0.193
NP_440416.1_9 Reverse -310 -329 -21.535 0.295
NP_442154.1_1 Forward -290 -272 -7.65067 0.146
NP_442154.1_1 Forward -326 -308 -14.2388 0.217
NP_441430.1_10 Forward -323 -304 13.4708 0.257
NP_440261.1_5 Reverse -58 -71 -4.89726 0.178
NP_440988.1_10 Forward -136 -122 7.41596 0.216
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GATTTGATATTCCCTGGGAGTAACTTAAACCTATGTCAATTGCAGTTGGGATGATCGAAACCCTTGGGTTTCCCGCCGTTGTGGAGGCCGCCGACTCCATGGTTAAAGCCGCCCGGGTTACCCTGGTGGGCTACGAAAAAATTGGTAGCGGCCGAGTCACCGTGATTGTGCGGGGTGACGTGTCCGAGGTACAGGCCTCAGTGACCGCTGGCATTGAAAACATCCGTCGGGTAAACGGTGGTGAAGTTTTGTCTAACCACATTATTGCCCGTCCCCACGAAAACCTGGAGTATGTGCTACCCATTCGCTACACCGAGGCGGTGGAACAGTTCCGGGAAATCGTTAATCCTTCCATCATCCGCCGTTAATTTTCCCTATAAATTTTGAGCCCAATTAAGCC

CDS

ATGCAACTTGCCAAAGTTTTGGGGACCGTGGTCAGTACATCGAAGACACCGAACTTAACCGGCGTCAAGCTGCTTTTAGTTCAGTTCCTCGACACCAAAGGTCAACCCCTGGAACGCTATGAAGTGGCGGGGGATGTGGTAGGTGCAGGCTTAAATGAATGGGTGCTGGTGGCCCGGGGTAGTGCCGCCCGTAAGGAACGGGGCAATGGCGATCGCCCTTTGGATGCCATGGTGGTGGGCATCATCGACACAGTTAATGTGGCTAGTGGCTCCCTCTACAACAAGAGGGATGATGGGAGATAA

Protein

MQLAKVLGTVVSTSKTPNLTGVKLLLVQFLDTKGQPLERYEVAGDVVGAGLNEWVLVARGSAARKERGNGDRPLDAMVVGIIDTVNVASGSLYNKRDDGR