Your browser is old and dusty. Try Google Chrome!

Details for sll1024

ORF sll1024
Accession NP_440263.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -219 -233 11.2093 0.0531
NP_441061.1_2 Forward -226 -212 8.45605 0.0896
NP_441061.1_2 Forward -252 -238 2.35953 0.177
NP_441061.1_2 Forward -79 -65 1.37622 0.191
NP_441061.1_2 Reverse -8 -22 -2.65535 0.3
NP_440557.1_1 Reverse -219 -238 -0.688862 0.27
NP_440795.1_7 Forward -226 -219 14.6904 0.0123
NP_440795.1_7 Reverse -219 -226 14.6904 0.0123
NP_440795.1_7 Forward -15 -8 14.6904 0.0123
NP_440795.1_7 Reverse -8 -15 14.6904 0.0123
NP_441418.1_6 Reverse -65 -84 -10.4236 0.035
NP_441418.1_6 Forward -227 -208 -18.9784 0.0841
NP_441418.1_6 Reverse -349 -368 -28.3199 0.204
NP_441418.1_6 Reverse -7 -26 -28.4182 0.205
NP_440815.1_5 Reverse -136 -155 7.57094 0.249
NP_442291.1_5 Reverse -217 -233 3.30346 0.112
NP_442291.1_5 Forward -17 -1 -0.924775 0.19
NP_442291.1_5 Forward -42 -26 -1.90808 0.204
NP_441453.1_4 Reverse -218 -226 16.539 0.00633
NP_441453.1_4 Reverse -7 -15 16.539 0.00633
NP_441453.1_4 Forward -227 -219 16.539 0.00633
NP_441453.1_4 Forward -16 -8 16.539 0.00633
NP_441453.1_4 Reverse -65 -73 6.80426 0.121
NP_441453.1_4 Forward -74 -66 6.11594 0.121
NP_441453.1_4 Reverse -315 -323 3.36267 0.293
NP_441453.1_7 Reverse -173 -180 14.1988 0.175
NP_441623.1_1 Reverse -173 -191 -2.24246 0.241
NP_442151.1_6 Reverse -65 -79 13.2743 0.0554
NP_442151.1_6 Forward -16 -2 9.14437 0.157
NP_442151.1_6 Forward -227 -213 8.06273 0.183
NP_441818.1_1 Reverse -219 -230 9.69459 0.232
NP_441818.1_9 Reverse -248 -267 -9.53865 0.291
NP_440226.1_1 Reverse -7 -26 9.83255 0.0687
NP_440226.1_1 Forward -227 -208 2.85105 0.249
NP_440226.1_1 Forward -74 -55 2.26107 0.271
NP_440150.1_6 Forward -230 -211 2.94938 0.263
NP_442655.1_10 Reverse -62 -81 -8.94866 0.22
NP_442173.1_1 Forward -226 -218 15.4574 0.00633
NP_442173.1_1 Forward -15 -7 15.4574 0.00633
NP_442173.1_1 Reverse -219 -227 15.4574 0.00633
NP_442173.1_1 Reverse -8 -16 15.4574 0.00633
NP_442173.1_1 Forward -73 -65 12.0158 0.0316
NP_442173.1_1 Reverse -66 -74 4.83764 0.241
NP_442752.1_4 Forward -227 -220 13.8055 0.0199
NP_442752.1_4 Reverse -218 -225 13.8055 0.0199
NP_442752.1_4 Reverse -65 -72 13.8055 0.0199
NP_442752.1_4 Forward -16 -9 13.8055 0.0199
NP_442752.1_4 Reverse -7 -14 13.8055 0.0199
NP_443027.1_4 Reverse -5 -15 15.3197 0.0437
NP_443027.1_4 Forward -229 -219 14.828 0.0437
NP_443027.1_4 Forward -18 -8 11.8781 0.0872
NP_441812.1_1 Reverse -97 -111 15.2402 0.201
NP_441812.1_3 Reverse -217 -231 17.8958 0.0479
NP_442975.1_10 Forward -231 -217 22.32 0.000414
NP_442975.1_10 Forward -20 -6 3.93223 0.249
NP_442975.1_10 Reverse -3 -17 2.75226 0.269
NP_440784.1_7 Forward -226 -219 15.9687 0.0123
NP_440784.1_7 Reverse -219 -226 15.9687 0.0123
NP_440784.1_7 Forward -15 -8 15.9687 0.0123
NP_440784.1_7 Reverse -8 -15 15.9687 0.0123
NP_440784.1_7 Reverse -66 -73 6.23397 0.241
NP_440784.1_7 Forward -73 -66 6.13563 0.241
NP_440061.1_9 Forward -18 -4 13.5686 0.079
NP_440061.1_9 Forward -76 -62 9.6354 0.143
NP_440061.1_9 Forward -229 -215 9.53707 0.143
NP_440061.1_9 Reverse -375 -389 8.06211 0.183
NP_440110.1_8 Reverse -47 -66 -1.57384 0.244
NP_441054.1_2 Reverse -362 -381 11.6025 0.263
NP_441054.1_2 Forward -126 -107 10.2259 0.284
NP_441054.1_4 Forward -26 -8 0.0191479 0.177
NP_440878.1_9 Reverse -169 -188 -3.14714 0.289
NP_442062.1_8 Reverse -218 -228 19.4496 0.000558
NP_442062.1_8 Reverse -7 -17 19.4496 0.000558
NP_442062.1_8 Forward -227 -217 17.3846 0.00193
NP_442062.1_8 Forward -16 -6 10.3048 0.0493
NP_442062.1_8 Reverse -179 -189 4.99491 0.188
NP_441900.1_2 Forward -380 -362 3.16499 0.204
NP_442974.1_5 Forward -195 -176 10.9142 0.177
NP_441859.1_3 Forward -75 -56 4.52188 0.221
NP_441859.1_3 Reverse -6 -25 2.6536 0.258
NP_441859.1_3 Forward -228 -209 2.06362 0.267
NP_441802.1_1 Reverse -194 -213 8.06259 0.229
NP_440304.1_4 Reverse -5 -15 18.9579 0.00406
NP_440304.1_4 Forward -229 -219 10.8948 0.051
NP_440304.1_4 Reverse -63 -73 8.23984 0.0845
NP_440304.1_4 Reverse -216 -226 1.84832 0.299
NP_440304.1_4 Forward -18 -8 1.84832 0.299
NP_442242.1_4 Forward -226 -219 14.3954 0.0124
NP_442242.1_4 Reverse -219 -226 14.3954 0.0124
NP_442242.1_4 Forward -15 -8 14.3954 0.0124
NP_442242.1_4 Reverse -8 -15 14.3954 0.0124
NP_440044.1_8 Reverse -157 -176 1.17943 0.18
NP_440044.1_8 Reverse -219 -238 -0.787193 0.228
NP_439918.1_3 Reverse -346 -365 7.37428 0.263
NP_439923.1_5 Forward -178 -159 14.2574 0.0934
NP_441352.1_2 Forward -234 -215 2.94938 0.222
NP_441161.1_3 Forward -22 -4 10.3439 0.237
NP_441200.1_4 Forward -198 -179 7.07928 0.272
NP_441619.1_9 Forward -389 -370 7.7676 0.203
NP_441208.1_9 Reverse -4 -18 14.4542 0.0974
NP_441208.1_9 Reverse -215 -229 14.3559 0.0974
NP_441594.1_6 Forward -236 -217 5.89931 0.203
NP_442110.1_7 Forward -16 -2 9.14437 0.0755
NP_442110.1_7 Reverse -65 -79 6.29277 0.148
NP_442110.1_7 Forward -194 -180 3.34284 0.21
NP_442110.1_7 Reverse -218 -232 1.57289 0.222
NP_441082.1_10 Reverse -356 -369 8.18076 0.285
NP_440856.1_7 Reverse -59 -78 -9.73531 0.297
NP_441083.1_5 Forward -227 -217 20.3345 0.00053
NP_441083.1_5 Forward -74 -64 16.7946 0.00546
NP_441083.1_5 Reverse -218 -228 11.3864 0.0159
NP_441083.1_5 Reverse -7 -17 11.3864 0.0159
NP_441083.1_5 Forward -16 -6 11.2881 0.0159
NP_441083.1_5 Reverse -65 -75 8.04317 0.046
NP_442827.1_8 Forward -82 -63 2.6536 0.156
NP_441738.1_2 Forward -225 -218 15.28 0.0102
NP_441738.1_2 Reverse -220 -227 15.28 0.0102
NP_441738.1_2 Forward -72 -65 15.28 0.0102
NP_441738.1_2 Forward -14 -7 15.28 0.0102
NP_441738.1_2 Reverse -9 -16 15.28 0.0102
NP_441558.1_5 Forward -76 -57 4.42435 0.281
NP_441558.1_5 Forward -229 -210 3.93269 0.294
NP_440209.1_1 Reverse -218 -226 18.1123 0.00295
NP_440209.1_1 Reverse -7 -15 18.1123 0.00295
NP_440209.1_1 Forward -227 -219 18.1123 0.00295
NP_440209.1_1 Forward -16 -8 18.1123 0.00295
NP_440209.1_1 Reverse -65 -73 8.57422 0.0425
NP_440209.1_1 Forward -74 -66 5.52596 0.0821
NP_442889.1_1 Forward -194 -175 -14.4552 0.273
NP_442889.1_8 Forward -230 -216 22.615 0.00144
NP_442889.1_8 Forward -19 -5 4.03056 0.27
NP_440447.1_6 Forward -24 -6 3.16574 0.207
NP_441713.1_1 Forward -22 -3 -2.45882 0.113
NP_441713.1_1 Reverse -59 -78 -14.8485 0.259
NP_441770.1_5 Forward -235 -216 9.24257 0.135
NP_440178.1_7 Reverse -178 -197 -3.63879 0.0481
NP_440178.1_7 Reverse -217 -236 -22.5183 0.267
NP_442059.1_10 Reverse -82 -101 16.8141 0.114
NP_442706.1_5 Forward -107 -88 14.5932 0.245
NP_441716.1_1 Reverse -65 -79 11.3077 0.0936
NP_441716.1_1 Forward -16 -2 4.52282 0.255
NP_442111.1_4 Forward -75 -61 20.3541 0.00311
NP_442111.1_4 Forward -17 -3 9.04604 0.0655
NP_442111.1_4 Reverse -6 -20 8.84938 0.0677
NP_441624.1_7 Reverse -355 -369 7.86607 0.241
NP_441163.1_1 Forward -394 -377 8.69123 0.226
NP_440906.1_5 Forward -226 -219 15.8704 0.0124
NP_440906.1_5 Reverse -219 -226 15.8704 0.0124
NP_440906.1_5 Forward -15 -8 15.8704 0.0124
NP_440906.1_5 Reverse -8 -15 15.8704 0.0124
NP_440906.1_5 Reverse -66 -73 6.23397 0.234
NP_440906.1_5 Forward -73 -66 6.13563 0.241
NP_440747.1_10 Reverse -215 -227 24.7201 0.00036
NP_440747.1_10 Forward -19 -7 7.21714 0.00643
NP_440747.1_10 Reverse -4 -16 -1.92764 0.0192
NP_440747.1_10 Forward -230 -218 -2.02597 0.0196
NP_440747.1_10 Forward -77 -65 -2.4193 0.0434
NP_440747.1_10 Reverse -62 -74 -11.6624 0.131
NP_440747.1_10 Reverse -29 -41 -12.2524 0.254
NP_441130.1_10 Forward -18 -4 17.0108 0.0193
NP_441130.1_10 Forward -76 -62 7.07942 0.171
NP_442973.1_5 Forward -236 -217 13.8641 0.159
NP_441486.1_1 Forward -230 -216 22.5174 0.00162
NP_441486.1_1 Reverse -215 -229 11.3077 0.0164
NP_441486.1_1 Reverse -4 -18 -4.32697 0.194
NP_441486.1_1 Forward -191 -177 -6.09693 0.278
NP_442634.1_2 Reverse -1 -20 11.3075 0.133
NP_442634.1_4 Forward -18 -4 6.09611 0.051
NP_442634.1_4 Reverse -63 -77 -3.44199 0.161
NP_442634.1_4 Reverse -5 -19 -3.44199 0.161
NP_442634.1_4 Forward -196 -182 -4.13031 0.184
NP_441265.1_3 Reverse -59 -73 6.88276 0.181
NP_441265.1_3 Reverse -1 -15 4.62115 0.181
NP_441265.1_6 Forward -377 -358 13.3716 0.247
NP_440403.1_4 Reverse -368 -387 -8.45701 0.257
NP_440842.1_3 Forward -227 -208 10.5209 0.257
NP_440842.1_10 Reverse -360 -374 12.4876 0.251
NP_440842.1_10 Forward -373 -359 11.406 0.251
NP_440057.1_6 Forward -117 -98 10.1205 0.298
NP_441014.1_8 Forward -369 -350 -9.14533 0.291
NP_441014.1_10 Reverse -178 -197 -2.06626 0.27
NP_442848.1_1 Forward -233 -219 -3.54032 0.268
NP_442848.1_1 Forward -80 -66 -3.54032 0.268
NP_442848.1_1 Reverse -1 -15 -3.63866 0.268
NP_442848.1_4 Reverse -359 -373 18.2892 0.121
NP_442848.1_4 Reverse -170 -184 9.5377 0.282
NP_442848.1_4 Forward -373 -359 9.43936 0.282
NP_443018.1_3 Forward -226 -219 14.8871 0.0123
NP_443018.1_3 Reverse -219 -226 14.8871 0.0123
NP_443018.1_3 Forward -15 -8 14.8871 0.0123
NP_443018.1_3 Reverse -8 -15 14.8871 0.0123
NP_443018.1_3 Forward -73 -66 11.7405 0.0655
NP_443018.1_3 Reverse -66 -73 5.44732 0.193
NP_443018.1_3 Forward -40 -33 4.26735 0.267
NP_443018.1_3 Reverse -33 -40 4.16902 0.278
NP_441316.1_7 Forward -229 -214 13.1562 0.0486
NP_441316.1_7 Forward -18 -3 -3.26502 0.273
NP_441634.1_8 Forward -18 -4 5.89945 0.114
NP_441634.1_8 Reverse -216 -230 5.1128 0.114
NP_441634.1_8 Reverse -30 -44 4.32615 0.13
NP_440376.1_1 Forward -227 -218 19.4693 0.000692
NP_440376.1_1 Reverse -218 -227 19.4693 0.000692
NP_440376.1_1 Forward -16 -7 19.4693 0.000692
NP_440376.1_1 Reverse -7 -16 19.4693 0.000692
NP_440376.1_1 Forward -389 -380 7.66954 0.0706
NP_440376.1_1 Reverse -65 -74 5.99792 0.111
NP_440376.1_1 Forward -188 -179 4.62128 0.154
NP_440376.1_1 Forward -74 -65 -0.196935 0.285
NP_441588.1_4 Forward -225 -215 9.02648 0.14
NP_441588.1_4 Reverse -220 -230 6.96153 0.178
NP_443065.1_6 Reverse -214 -233 11.4058 0.141
NP_442687.1_7 Forward -228 -218 15.8113 0.0125
NP_442687.1_7 Forward -17 -7 15.8113 0.0125
NP_442687.1_7 Reverse -6 -16 9.02648 0.0994
NP_442687.1_7 Reverse -217 -227 8.92815 0.0994
NP_442687.1_7 Reverse -64 -74 7.25653 0.136
NP_442687.1_7 Reverse -178 -188 4.79825 0.234
NP_442191.1_4 Forward -15 -1 11.4779 0.256
NP_442485.1_3 Reverse -5 -24 -5.31042 0.289
NP_441846.1_10 Reverse -350 -369 -23.5016 0.289
NP_441846.1_10 Reverse -64 -83 -23.6 0.294
NP_441846.1_10 Forward -400 -381 -23.7966 0.298
NP_442530.1_2 Reverse -105 -115 14.0414 0.219
NP_442530.1_2 Forward -166 -156 11.2881 0.284
NP_440642.1_10 Reverse -171 -185 2.26061 0.281
NP_441013.1_2 Forward -199 -181 -2.24246 0.282
NP_441422.1_7 Forward -18 -1 4.85706 0.106
NP_440691.1_10 Forward -375 -356 12.5858 0.269
NP_442658.1_1 Forward -18 -8 17.0891 0.00615
NP_442658.1_1 Reverse -5 -15 15.9091 0.00966
NP_442658.1_1 Forward -229 -219 15.9091 0.00966
NP_442658.1_1 Reverse -63 -73 7.94438 0.199
NP_442658.1_1 Reverse -216 -226 6.76441 0.214
NP_442658.1_1 Forward -43 -33 6.66608 0.219
NP_441855.2_4 Forward -235 -216 9.13744 0.287
NP_442782.1_2 Reverse -349 -363 5.1128 0.247
NP_442782.1_2 Reverse -218 -232 1.37622 0.281
NP_442782.1_2 Forward -265 -251 0.786239 0.284
NP_442205.1_9 Forward -233 -217 6.74504 0.111
NP_442205.1_9 Reverse -1 -17 -1.02311 0.264
NP_441414.1_9 Reverse -7 -26 11.7992 0.0174
NP_441414.1_9 Forward -227 -208 6.98095 0.0368
NP_441487.1_9 Forward -387 -368 6.19431 0.131
NP_441256.1_1 Forward -230 -211 -6.49039 0.239
NP_439959.1_3 Forward -203 -184 8.65258 0.299
NP_442937.1_5 Forward -170 -151 10.0292 0.173
NP_442937.1_5 Forward -258 -239 7.96426 0.237
NP_442937.1_5 Reverse -213 -232 6.78429 0.27
NP_441958.1_5 Reverse -6 -16 21.2195 0.000805
NP_441958.1_5 Forward -228 -218 12.2714 0.00183
NP_441958.1_5 Reverse -217 -227 12.2714 0.00183
NP_441958.1_5 Forward -17 -7 12.2714 0.00183
NP_441958.1_5 Reverse -64 -74 9.12481 0.025
NP_441127.1_1 Reverse -361 -375 9.73436 0.268
NP_440203.1_5 Forward -224 -214 11.8776 0.171
NP_440203.1_5 Forward -71 -61 10.0093 0.242
NP_439905.1_1 Reverse -8 -21 10.934 0.204
NP_439905.1_1 Forward -15 -2 9.85238 0.216
NP_440984.1_7 Reverse -2 -16 13.3726 0.113
NP_440984.1_7 Forward -21 -7 11.6026 0.122
NP_440984.1_7 Reverse -213 -227 9.04604 0.131
NP_440984.1_7 Reverse -375 -389 7.37441 0.175
NP_439990.1_5 Reverse -213 -226 7.98409 0.183
NP_441338.2_5 Reverse -360 -379 9.3409 0.247
NP_442376.1_2 Reverse -60 -79 -3.24547 0.202
NP_442911.1_2 Forward -26 -7 4.81767 0.0367
NP_442911.1_2 Reverse -208 -227 -1.27885 0.0834
NP_442911.1_2 Reverse -55 -74 -3.44213 0.112
NP_442911.1_2 Forward -237 -218 -4.91709 0.145
NP_442911.1_2 Forward -51 -32 -10.0303 0.268
NP_440153.1_5 Forward -15 -1 15.0442 0.0551
NP_442064.1_1 Forward -21 -2 -11.3086 0.259
NP_442064.1_1 Reverse -213 -232 -11.6036 0.261
NP_442064.1_4 Reverse -214 -233 6.1935 0.256
NP_443055.1_6 Reverse -210 -228 -2.63651 0.298
NP_440993.1_2 Reverse -2 -18 13.2349 0.0656
NP_441099.1_5 Forward -84 -65 0.786102 0.073
NP_441099.1_5 Forward -26 -7 -0.787193 0.0989
NP_441099.1_5 Reverse -208 -227 -11.5053 0.283
NP_441099.1_10 Reverse -105 -115 17.1874 0.254
NP_442002.1_1 Reverse -144 -162 -10.0106 0.288
NP_442002.1_9 Reverse -64 -71 14.1004 0.074
NP_442002.1_9 Reverse -368 -375 12.2322 0.185
NP_442002.1_9 Forward -228 -221 10.7572 0.185
NP_442002.1_9 Forward -17 -10 10.7572 0.185
NP_441294.1_7 Forward -231 -217 16.6418 0.0133
NP_441294.1_7 Forward -356 -342 9.82656 0.223
NP_441294.1_7 Reverse -3 -17 8.86667 0.274
NP_441646.1_1 Forward -23 -4 3.73603 0.206
NP_441646.1_1 Reverse -211 -230 -1.08219 0.278
NP_442438.1_10 Reverse -2 -16 13.2743 0.0355
NP_442438.1_10 Forward -232 -218 10.9143 0.0478
NP_440811.1_8 Forward -21 -2 17.5024 0.0817
NP_441000.1_6 Reverse -217 -231 5.01447 0.0933
NP_441000.1_6 Forward -17 -3 3.04785 0.12
NP_441000.1_6 Reverse -6 -20 -2.36035 0.216
NP_441000.1_6 Forward -325 -311 -4.62196 0.248
NP_441674.1_4 Reverse -71 -90 -1.86883 0.245
NP_440147.1_4 Forward -18 -5 18.8005 0.00359
NP_440147.1_4 Reverse -216 -229 10.049 0.0355
NP_440147.1_4 Reverse -5 -18 10.049 0.0355
NP_440147.1_4 Forward -229 -216 3.46087 0.187
NP_441550.1_8 Reverse -63 -73 18.5641 0.00754
NP_441550.1_8 Reverse -5 -15 17.4824 0.00754
NP_441550.1_8 Reverse -216 -226 14.6309 0.0132
NP_441550.1_8 Forward -18 -8 8.82935 0.112
NP_441550.1_8 Forward -76 -66 7.74772 0.149
NP_441550.1_8 Forward -229 -219 6.0761 0.214
NP_441916.1_7 Forward -16 -6 18.9579 0.00144
NP_441916.1_7 Reverse -218 -228 18.4663 0.00144
NP_441916.1_7 Reverse -7 -17 18.4663 0.00144
NP_441916.1_7 Forward -227 -217 10.3048 0.0261
NP_441916.1_10 Forward -366 -347 9.73422 0.154
NP_441916.1_10 Reverse -92 -111 0.294447 0.286
NP_440465.1_4 Reverse -217 -236 13.8641 0.184
NP_440465.1_10 Reverse -4 -23 9.73422 0.173
NP_441041.1_4 Forward -227 -208 -0.197208 0.0941
NP_441041.1_4 Reverse -349 -368 -1.96717 0.106
NP_441041.1_4 Reverse -65 -84 -7.4737 0.188
NP_441041.1_4 Reverse -343 -362 -10.1286 0.228
NP_441041.1_4 Reverse -244 -263 -11.9969 0.256
NP_441041.1_7 Reverse -62 -74 14.0257 0.0415
NP_441041.1_7 Forward -230 -218 10.916 0.0864
NP_441041.1_7 Reverse -4 -16 8.97244 0.125
NP_441041.1_7 Reverse -215 -227 8.58373 0.133
NP_441041.1_7 Forward -19 -7 8.48655 0.135
NP_442396.1_5 Reverse -214 -227 11.6223 0.0913
NP_442396.1_5 Forward -20 -7 9.55739 0.129
NP_440569.1_10 Forward -117 -98 12.0793 0.208
NP_442004.1_6 Forward -16 -2 6.6861 0.171
NP_442004.1_6 Forward -227 -213 4.42448 0.215
NP_442004.1_6 Forward -358 -344 1.47456 0.288
NP_441725.1_4 Forward -21 -7 2.26061 0.287
NP_441725.1_5 Reverse -219 -229 11.2881 0.0247
NP_441725.1_5 Forward -73 -63 8.92815 0.0553
NP_441725.1_5 Forward -15 -5 8.92815 0.0553
NP_441725.1_5 Forward -226 -216 2.04498 0.115
NP_441725.1_5 Reverse -8 -18 2.04498 0.115
NP_441725.1_5 Reverse -66 -76 -0.41329 0.251
NP_439966.1_7 Forward -229 -219 18.4657 0.00473
NP_439966.1_7 Forward -18 -8 17.9741 0.00631
NP_439966.1_7 Forward -76 -66 15.5158 0.0152
NP_439966.1_7 Reverse -5 -15 13.8442 0.0234
NP_439966.1_7 Reverse -216 -226 7.25606 0.15
NP_439966.1_9 Forward -229 -220 0.983037 0.253
NP_439966.1_9 Reverse -63 -72 0.983037 0.253
NP_439966.1_9 Reverse -5 -14 0.983037 0.253
NP_439966.1_9 Forward -18 -9 0.884706 0.253
NP_442941.1_3 Reverse -219 -229 11.4848 0.0116
NP_442941.1_3 Forward -226 -216 11.0914 0.0116
NP_442941.1_3 Forward -15 -5 10.9931 0.0116
NP_442941.1_3 Reverse -8 -18 10.7964 0.0116
NP_442941.1_3 Reverse -66 -76 0.766681 0.171
NP_440289.1_2 Forward -230 -217 21.3571 0.00262
NP_440289.1_2 Forward -19 -6 4.34585 0.0673
NP_440289.1_2 Reverse -62 -75 0.412608 0.163
NP_440289.1_2 Forward -77 -64 -3.61896 0.267
NP_440289.1_2 Reverse -4 -17 -4.40561 0.288
NP_440983.1_5 Forward -357 -338 -7.96535 0.294
NP_440260.1_8 Reverse -209 -227 -5.19239 0.273
NP_440260.1_8 Forward -191 -173 -6.56903 0.293
NP_441514.1_6 Forward -332 -325 14.2971 0.248
NP_441514.1_6 Reverse -151 -158 12.8221 0.252
NP_442281.1_1 Forward -232 -218 18.7801 0.00389
NP_442281.1_1 Reverse -213 -227 17.6985 0.00542
NP_442281.1_1 Forward -21 -7 10.717 0.055
NP_442281.1_1 Forward -264 -250 4.42388 0.195
NP_442256.1_2 Forward -372 -354 2.28076 0.107
NP_442012.1_1 Reverse -212 -231 -0.000545616 0.249
NP_440723.1_4 Forward -155 -136 -5.11376 0.272
NP_441556.1_10 Reverse -174 -188 9.92981 0.281
NP_441556.1_10 Reverse -344 -358 9.73513 0.293
NP_440498.1_1 Reverse -209 -227 16.8337 0.0206
NP_440498.1_1 Forward -25 -7 -1.25915 0.222
NP_442982.1_4 Reverse -97 -116 15.2399 0.15
NP_440375.1_8 Forward -226 -207 -0.983855 0.277
NP_441644.1_6 Forward -16 -6 19.0557 0.000803
NP_441644.1_6 Forward -227 -217 17.3841 0.00127
NP_441644.1_6 Forward -74 -64 12.7626 0.0285
NP_441644.1_6 Reverse -218 -228 10.1076 0.0628
NP_441644.1_6 Reverse -7 -17 10.1076 0.0628
NP_441644.1_6 Reverse -65 -75 4.01116 0.253
NP_441644.1_6 Forward -370 -360 3.22451 0.293
NP_443049.1_6 Reverse -64 -74 14.5687 0.114
NP_442215.1_2 Forward -229 -213 3.40179 0.0967
NP_442215.1_2 Reverse -216 -232 -2.00642 0.191
NP_442029.1_1 Reverse -63 -82 -18.0934 0.272
NP_442247.1_8 Forward -18 -4 8.75105 0.266
NP_440253.1_2 Reverse -7 -25 7.29564 0.0731
NP_440253.1_2 Reverse -218 -236 0.904127 0.174
NP_440929.1_8 Forward -227 -218 19.2726 0.000701
NP_440929.1_8 Reverse -218 -227 19.2726 0.000701
NP_440929.1_8 Forward -16 -7 19.2726 0.000701
NP_440929.1_8 Reverse -7 -16 19.2726 0.000701
NP_440929.1_8 Forward -74 -65 7.07956 0.0713
NP_440929.1_8 Reverse -32 -41 2.94966 0.246
NP_441346.1_4 Reverse -64 -83 15.0441 0.223
NP_442933.1_10 Forward -227 -218 17.601 0.00325
NP_442933.1_10 Reverse -218 -227 17.601 0.00325
NP_442933.1_10 Forward -16 -7 17.601 0.00325
NP_442933.1_10 Reverse -7 -16 17.601 0.00325
NP_441751.2_8 Forward -226 -212 6.3911 0.0354
NP_441751.2_8 Reverse -219 -233 5.80112 0.0408
NP_441751.2_8 Forward -73 -59 4.03116 0.0563
NP_441751.2_8 Forward -15 -1 -2.26202 0.132
NP_441751.2_8 Reverse -8 -22 -3.83532 0.156
NP_440096.1_5 Reverse -338 -357 7.86593 0.259
NP_442554.1_8 Forward -15 -5 19.1546 0.00369
NP_442554.1_8 Forward -226 -216 15.3197 0.00882
NP_442554.1_8 Reverse -8 -18 14.1397 0.0144
NP_442554.1_8 Reverse -219 -229 13.8447 0.0145
NP_442554.1_8 Forward -73 -63 7.15819 0.0975
NP_442554.1_8 Reverse -66 -76 4.0116 0.2
NP_442554.1_8 Forward -40 -30 2.24165 0.276
NP_442554.1_8 Reverse -33 -43 2.14332 0.281
NP_442970.1_1 Reverse -102 -116 13.285 0.269
NP_441762.1_7 Forward -17 -5 11.7404 0.0142
NP_441762.1_7 Forward -228 -216 9.57708 0.0142
NP_441762.1_7 Reverse -6 -18 3.08724 0.0676
NP_441762.1_7 Reverse -217 -229 2.89058 0.0676
NP_441762.1_7 Reverse -64 -76 -5.95921 0.258
NP_442142.1_4 Forward -230 -217 15.85 0.0264
NP_442142.1_4 Reverse -215 -228 14.7683 0.0302
NP_442142.1_4 Forward -19 -6 6.50855 0.163
NP_442142.1_4 Reverse -4 -17 6.31189 0.169
NP_442142.1_4 Forward -77 -64 2.87033 0.273
NP_442292.1_1 Forward -226 -217 18.486 0.00229
NP_442292.1_1 Forward -15 -6 17.5026 0.00435
NP_442292.1_1 Reverse -219 -228 9.63616 0.0183
NP_442292.1_1 Reverse -8 -17 9.63616 0.0183
NP_442292.1_1 Reverse -66 -75 -0.0986038 0.239
NP_442292.1_1 Forward -73 -64 -0.295266 0.24
NP_441525.1_1 Reverse -152 -165 15.5556 0.206
NP_442476.1_6 Reverse -8 -22 20.2558 0.0222
NP_442476.1_6 Forward -15 -1 5.1128 0.139
NP_442476.1_6 Forward -226 -212 0.982901 0.233
NP_442381.1_8 Forward -230 -211 4.12936 0.0708
NP_441711.1_2 Reverse -381 -400 13.47 0.233
NP_443009.1_5 Reverse -6 -17 19.626 0.00102
NP_443009.1_5 Reverse -217 -228 18.3477 0.00265
NP_443009.1_5 Forward -17 -6 7.82632 0.118
NP_443009.1_5 Reverse -178 -189 5.17139 0.214
NP_440125.1_5 Forward -112 -96 17.9065 0.245
NP_441715.1_4 Reverse -8 -18 18.8596 0.00741
NP_441715.1_4 Reverse -219 -229 16.303 0.0117
NP_441715.1_4 Forward -226 -216 7.94484 0.107
NP_441715.1_4 Forward -15 -5 7.25653 0.108
NP_440357.1_3 Forward -229 -210 4.32602 0.242
NP_440357.1_6 Forward -84 -65 5.30933 0.279
NP_440279.1_2 Forward -176 -157 12.2908 0.116
NP_441198.1_5 Forward -14 -1 11.2284 0.294
NP_441198.1_8 Reverse -5 -15 15.4199 0.0427
NP_441198.1_8 Reverse -63 -73 10.8298 0.239
NP_440464.1_10 Forward -226 -216 13.0082 0.169
NP_441468.1_1 Forward -226 -219 15.8704 0.0124
NP_441468.1_1 Reverse -219 -226 15.8704 0.0124
NP_441468.1_1 Forward -15 -8 15.8704 0.0124
NP_441468.1_1 Reverse -8 -15 15.8704 0.0124
NP_441468.1_1 Reverse -66 -73 6.13563 0.209
NP_441468.1_1 Forward -73 -66 6.0373 0.223
NP_441468.1_1 Forward -40 -33 4.36568 0.237
NP_441020.2_6 Forward -229 -212 13.9035 0.0641
NP_441020.2_6 Reverse -5 -22 11.2486 0.124
NP_441020.2_7 Forward -370 -351 11.6017 0.22
NP_441673.1_1 Forward -227 -218 20.8459 0.000698
NP_441673.1_1 Reverse -218 -227 20.8459 0.000698
NP_441673.1_1 Forward -16 -7 20.8459 0.000698
NP_441673.1_1 Reverse -7 -16 20.8459 0.000698
NP_441673.1_1 Reverse -65 -74 1.37636 0.114
NP_441673.1_1 Forward -74 -65 1.1797 0.163
NP_442253.1_5 Reverse -23 -40 -3.40274 0.287
NP_441826.1_2 Forward -233 -219 4.22782 0.104
NP_441826.1_2 Reverse -1 -15 3.93283 0.105
NP_441826.1_2 Forward -80 -66 2.06454 0.136
NP_441826.1_2 Reverse -59 -73 1.47456 0.151
NP_441826.1_2 Reverse -244 -258 -3.24533 0.284
NP_442490.1_9 Forward -239 -220 4.916 0.165
NP_442490.1_10 Forward -182 -164 11.4255 0.204
NP_441764.1_8 Forward -121 -111 13.3205 0.284
NP_442868.1_6 Forward -18 -8 10.3048 0.038
NP_442868.1_6 Reverse -216 -226 9.81313 0.038
NP_442868.1_6 Reverse -5 -15 8.63316 0.0555
NP_442868.1_6 Reverse -63 -73 7.05986 0.0898
NP_442868.1_6 Forward -229 -219 0.963343 0.205
NP_442868.1_6 Forward -76 -66 -0.216628 0.273
NP_442719.1_2 Forward -171 -153 -0.276578 0.162
NP_441251.1_7 Forward -102 -89 14.7689 0.266
NP_441251.1_7 Forward -114 -101 10.4424 0.288
NP_441056.1_1 Reverse -65 -84 -1.27885 0.18
NP_440051.1_10 Reverse -203 -215 17.148 0.244
NP_441612.1_2 Forward -227 -217 8.54929 0.21
NP_442227.1_2 Forward -81 -62 -0.688862 0.257
NP_443058.1_7 Forward -75 -56 7.17762 0.233
NP_440789.1_8 Forward -331 -312 15.9291 0.197
NP_442808.1_1 Forward -228 -218 18.4657 0.00201
NP_442808.1_1 Forward -17 -7 18.4657 0.00201
NP_442808.1_1 Forward -75 -65 9.616 0.0481
NP_442808.1_1 Reverse -6 -16 8.73102 0.0481
NP_442808.1_1 Reverse -217 -227 8.63269 0.0481
NP_442542.1_2 Reverse -63 -76 20.4721 0.00702
NP_442050.1_5 Reverse -5 -15 17.1874 0.00812
NP_442050.1_5 Forward -76 -66 13.3526 0.0369
NP_442050.1_5 Forward -229 -219 9.12434 0.193
NP_442050.1_5 Reverse -216 -226 7.64939 0.243
NP_442050.1_5 Forward -18 -8 6.96107 0.27
NP_440038.1_8 Reverse -212 -231 16.7149 0.198
NP_441493.2_10 Reverse -207 -226 5.11266 0.275
NP_440558.1_6 Forward -175 -156 16.7157 0.254
NP_442576.1_2 Reverse -88 -107 9.73422 0.247
NP_441518.1_3 Forward -237 -218 -5.40875 0.123
NP_441878.1_6 Reverse -6 -16 10.5014 0.0176
NP_441878.1_6 Forward -228 -218 10.4031 0.0176
NP_441878.1_6 Reverse -217 -227 10.4031 0.0176
NP_441878.1_6 Forward -17 -7 10.4031 0.0176
NP_441878.1_6 Reverse -178 -188 1.55333 0.0937
NP_441878.1_6 Reverse -64 -74 0.766681 0.134
NP_441878.1_6 Forward -189 -179 -6.70647 0.194
NP_441878.1_6 Forward -390 -380 -7.78811 0.266
NP_441878.1_6 Forward -389 -379 -7.78811 0.266
NP_441036.1_8 Forward -228 -218 17.7779 0.000554
NP_441036.1_8 Forward -17 -7 17.7779 0.000554
NP_441036.1_8 Reverse -6 -16 15.713 0.00724
NP_441036.1_8 Reverse -217 -227 8.33817 0.174
NP_442650.1_2 Reverse -65 -79 4.71948 0.163
NP_441557.1_5 Forward -227 -218 19.9609 0.000699
NP_441557.1_5 Reverse -218 -227 19.9609 0.000699
NP_441557.1_5 Forward -16 -7 19.9609 0.000699
NP_441557.1_5 Reverse -7 -16 19.9609 0.000699
NP_441557.1_5 Reverse -65 -74 1.08137 0.0794
NP_441557.1_5 Forward -74 -65 0.589713 0.134
NP_441445.1_1 Reverse -56 -75 9.14423 0.11
NP_441445.1_1 Forward -236 -217 8.06259 0.122
NP_441445.1_1 Forward -83 -64 -0.688862 0.3
NP_442066.2_4 Reverse -71 -90 -7.67036 0.286
NP_442066.2_9 Forward -20 -7 20.3738 0.00699
NP_442419.1_2 Reverse -174 -193 -2.55715 0.247
NP_441308.1_8 Reverse -5 -15 12.4681 0.218
NP_441308.1_8 Forward -229 -219 10.1081 0.22
NP_440101.1_3 Reverse -2 -21 5.11266 0.202
NP_440101.1_3 Reverse -60 -79 3.04771 0.239
NP_440101.1_3 Forward -182 -163 0.982764 0.287
NP_441458.1_10 Forward -236 -217 6.39097 0.2
NP_442183.1_1 Reverse -218 -232 17.2075 0.0118
NP_442183.1_1 Reverse -7 -21 14.3559 0.0336
NP_442183.1_1 Forward -227 -213 8.94771 0.105
NP_442397.1_9 Forward -227 -208 3.04771 0.264
NP_441116.1_9 Forward -296 -282 11.996 0.266
NP_441574.1_1 Forward -194 -175 -7.17871 0.286
NP_441549.1_9 Forward -20 -2 10.7372 0.0392
NP_441549.1_9 Forward -78 -60 -10.0106 0.268
NP_442347.1_2 Forward -226 -217 12.4878 0.056
NP_442347.1_2 Reverse -219 -228 11.1111 0.056
NP_442347.1_2 Reverse -8 -17 11.1111 0.056
NP_442347.1_2 Forward -15 -6 3.34298 0.284
NP_442645.1_2 Forward -235 -216 -16.5201 0.235
NP_442645.1_2 Reverse -210 -229 -22.6167 0.292
NP_442965.1_2 Reverse -362 -381 -6.98204 0.262
NP_440547.1_8 Reverse -349 -368 13.0775 0.298
NP_441037.1_4 Reverse -5 -15 16.5761 0.0168
NP_441037.1_4 Reverse -63 -73 9.85159 0.21
NP_441037.1_4 Reverse -216 -226 7.9999 0.237
NP_441037.1_4 Forward -229 -219 7.02532 0.237
NP_441037.1_4 Forward -18 -8 6.92787 0.237
NP_442594.1_8 Reverse -63 -82 8.06259 0.208
NP_442508.1_8 Reverse -336 -353 14.7885 0.256
NP_440932.1_9 Reverse -361 -380 11.1109 0.156
NP_442317.1_6 Forward -21 -2 5.30933 0.24
NP_442317.1_6 Reverse -213 -232 4.42435 0.247
NP_442317.1_6 Forward -170 -151 2.75272 0.27
NP_441633.1_3 Forward -18 -5 15.3589 0.0103
NP_441633.1_3 Reverse -216 -229 8.47575 0.0377
NP_441633.1_3 Forward -229 -216 -3.71729 0.177
NP_441633.1_3 Forward -76 -63 -4.11062 0.181
NP_441633.1_3 Reverse -5 -18 -5.78224 0.236
NP_441633.1_3 Reverse -30 -43 -5.97891 0.236
NP_440136.1_2 Forward -226 -219 15.9687 0.0123
NP_440136.1_2 Reverse -219 -226 15.9687 0.0123
NP_440136.1_2 Forward -15 -8 15.9687 0.0123
NP_440136.1_2 Reverse -8 -15 15.9687 0.0123
NP_440136.1_2 Reverse -66 -73 6.23397 0.171
NP_440136.1_2 Forward -73 -66 6.13563 0.193
NP_442998.1_5 Reverse -297 -307 9.41981 0.241
NP_442998.1_10 Forward -225 -218 15.5754 0.0102
NP_442998.1_10 Reverse -220 -227 15.5754 0.0102
NP_442998.1_10 Forward -72 -65 15.5754 0.0102
NP_442998.1_10 Forward -14 -7 15.5754 0.0102
NP_442998.1_10 Reverse -9 -16 15.5754 0.0102
NP_440299.1_1 Reverse -214 -227 12.605 0.0362
NP_440299.1_1 Forward -20 -7 8.77016 0.0851
NP_440299.1_1 Reverse -3 -16 6.60689 0.136
NP_440299.1_1 Forward -78 -65 3.46031 0.243
NP_440299.1_1 Forward -231 -218 2.28034 0.292
NP_441799.1_1 Reverse -214 -228 20.2551 0.00585
NP_441799.1_1 Reverse -3 -17 19.0751 0.00735
NP_441799.1_1 Forward -20 -6 13.2736 0.0337
NP_441799.1_1 Forward -231 -217 8.75042 0.106
NP_441799.1_9 Reverse -380 -399 0.884433 0.213
NP_440640.1_6 Reverse -53 -72 -1.18052 0.299
NP_441007.1_5 Reverse -8 -27 18.4857 0.0948
NP_441007.1_5 Forward -226 -207 9.83255 0.225
NP_441007.1_10 Reverse -2 -15 11.229 0.0646
NP_441007.1_10 Reverse -213 -226 8.57408 0.112
NP_441007.1_10 Forward -21 -8 1.29759 0.203
NP_442201.1_10 Forward -238 -219 -6.58872 0.184
NP_442201.1_10 Reverse -338 -357 -6.88371 0.184
NP_442333.2_5 Forward -85 -66 -2.16383 0.214
NP_440256.1_1 Reverse -215 -234 13.3725 0.0103
NP_440256.1_1 Reverse -4 -23 -1.57384 0.105
NP_440256.1_1 Reverse -176 -195 -6.49039 0.213
NP_441559.1_8 Forward -166 -152 1.96621 0.151
NP_441559.1_8 Reverse -2 -16 -1.08205 0.18
NP_441559.1_8 Forward -363 -349 -5.90027 0.271
NP_441559.1_8 Forward -21 -7 -6.09693 0.274
NP_441559.1_8 Forward -193 -179 -6.78525 0.279
NP_440915.1_6 Forward -20 -6 11.6026 0.0254
NP_440915.1_6 Reverse -61 -75 10.9143 0.0297
NP_440915.1_6 Reverse -3 -17 2.85119 0.111
NP_440915.1_6 Reverse -176 -190 -0.590395 0.202
NP_440915.1_6 Forward -393 -379 -1.67204 0.243
NP_440915.1_6 Forward -231 -217 -3.147 0.29
NP_442158.1_4 Reverse -340 -350 11.1898 0.28
NP_442866.1_1 Reverse -60 -79 -9.63698 0.296
NP_440695.1_6 Forward -118 -104 9.73265 0.276
NP_441939.1_3 Reverse -219 -238 8.55425 0.17
NP_441199.1_6 Forward -78 -59 4.22769 0.172
NP_441494.1_6 Reverse -2 -15 7.09911 0.267
NP_442993.1_1 Reverse -218 -234 19.3314 0.00378
NP_442993.1_1 Forward -324 -308 -10.1679 0.21
NP_440677.1_1 Reverse -209 -228 18.0924 0.0819
NP_440677.1_1 Reverse -235 -254 6.19431 0.278
NP_442386.1_9 Forward -228 -219 15.7322 0.0144
NP_442386.1_9 Forward -17 -8 15.7322 0.0144
NP_442386.1_9 Reverse -217 -226 13.8639 0.0289
NP_442386.1_9 Forward -75 -66 11.9957 0.0754
NP_442386.1_9 Reverse -31 -40 9.04574 0.175
NP_442386.1_9 Reverse -348 -357 7.47246 0.219
NP_442386.1_9 Reverse -6 -15 6.39082 0.219
NP_441340.1_5 Forward -226 -219 15.6737 0.0124
NP_441340.1_5 Reverse -219 -226 15.6737 0.0124
NP_441340.1_5 Forward -15 -8 15.6737 0.0124
NP_441340.1_5 Reverse -8 -15 15.6737 0.0124
NP_441340.1_5 Reverse -66 -73 13.5105 0.0314
NP_441340.1_5 Forward -73 -66 5.84064 0.208
NP_441340.1_5 Reverse -33 -40 4.07068 0.239
NP_442484.1_2 Forward -27 -8 0.884433 0.242
NP_442484.1_2 Reverse -207 -226 -1.37718 0.288
NP_440168.1_4 Reverse -208 -227 -5.50708 0.255
NP_440168.1_9 Reverse -5 -24 -5.50708 0.296
NP_440161.1_3 Reverse -5 -24 9.24257 0.251
NP_441160.1_5 Forward -331 -312 -6.1954 0.288
NP_440586.1_8 Forward -226 -219 13.2151 0.026
NP_440586.1_8 Forward -15 -8 13.2151 0.026
NP_440586.1_8 Reverse -219 -226 13.2151 0.026
NP_440586.1_8 Reverse -8 -15 13.2151 0.026
NP_440586.1_8 Forward -73 -66 9.47853 0.146
NP_440586.1_8 Reverse -33 -40 7.70858 0.227
NP_440586.1_8 Reverse -66 -73 5.74197 0.283
NP_440586.1_9 Reverse -344 -363 14.9458 0.258
NP_442251.1_6 Forward -226 -219 15.2804 0.0124
NP_442251.1_6 Reverse -219 -226 15.2804 0.0124
NP_442251.1_6 Forward -15 -8 15.2804 0.0124
NP_442251.1_6 Reverse -8 -15 15.2804 0.0124
NP_440684.1_9 Forward -233 -219 15.8309 0.0845
NP_440684.1_9 Reverse -212 -226 10.0294 0.209
NP_441262.1_3 Reverse -218 -225 14.7888 0.0223
NP_441262.1_3 Reverse -65 -72 14.7888 0.0223
NP_441262.1_3 Reverse -7 -14 14.7888 0.0223
NP_441262.1_3 Forward -227 -220 14.7888 0.0223
NP_441262.1_3 Forward -16 -9 14.7888 0.0223
NP_440027.1_3 Forward -84 -66 5.42659 0.244
NP_443051.1_1 Reverse -6 -15 19.5676 0.00335
NP_443051.1_1 Reverse -64 -73 15.1427 0.00754
NP_443051.1_1 Reverse -217 -226 10.4228 0.00754
NP_443051.1_1 Forward -228 -219 10.4228 0.00754
NP_443051.1_1 Forward -17 -8 10.4228 0.00754
NP_441232.1_10 Forward -27 -8 7.66927 0.142
NP_439984.1_3 Reverse -58 -72 12.0937 0.281
NP_439937.1_9 Forward -75 -58 1.70976 0.0894
NP_439937.1_9 Reverse -377 -394 -11.5649 0.257
NP_439937.1_9 Reverse -42 -59 -13.0398 0.279
NP_439937.1_9 Reverse -6 -23 -16.2847 0.287
NP_442294.1_3 Forward -167 -153 11.7003 0.298
NP_441657.1_5 Forward -334 -315 -1.08219 0.259
NP_440371.1_4 Reverse -321 -340 11.6017 0.189
NP_443039.1_7 Reverse -315 -329 5.99717 0.197
NP_440408.1_7 Forward -194 -175 6.78429 0.299
NP_440439.1_1 Reverse -4 -17 19.7838 0.0105
NP_440439.1_1 Forward -19 -6 9.85238 0.0418
NP_440439.1_1 Forward -230 -217 1.19926 0.159
NP_440439.1_1 Reverse -215 -228 0.314277 0.194
NP_442239.1_8 Reverse -345 -364 6.4893 0.265
NP_440372.1_2 Forward -226 -219 16.3621 0.0124
NP_440372.1_2 Reverse -219 -226 16.3621 0.0124
NP_440372.1_2 Forward -15 -8 16.3621 0.0124
NP_440372.1_2 Reverse -8 -15 16.3621 0.0124
NP_440372.1_2 Reverse -66 -73 13.8055 0.0214
NP_440372.1_2 Forward -73 -66 6.52896 0.188
NP_441789.1_7 Forward -82 -63 -4.42619 0.281
NP_440316.1_10 Reverse -64 -74 13.943 0.199
NP_440316.1_10 Reverse -360 -370 8.73149 0.239
NP_441803.1_2 Forward -363 -344 9.53756 0.0993
NP_441803.1_2 Reverse -213 -232 3.93269 0.185
NP_439977.1_5 Forward -22 -3 3.6377 0.159
NP_440589.1_3 Reverse -361 -380 2.65439 0.279
NP_440139.1_1 Forward -233 -214 15.1416 0.0474
NP_441572.1_7 Forward -200 -181 -2.65548 0.197
NP_441572.1_7 Forward -22 -3 -3.44213 0.212
NP_441572.1_7 Forward -233 -214 -6.09707 0.281
NP_442887.1_5 Forward -267 -248 -9.83364 0.264
NP_442384.1_10 Reverse -7 -20 17.6205 0.00585
NP_442384.1_10 Forward -227 -214 15.5556 0.00986
NP_442384.1_10 Forward -16 -3 9.95071 0.047
NP_442114.1_4 Reverse -7 -18 9.20345 0.17
NP_441980.1_5 Reverse -192 -211 16.4199 0.172
NP_441604.1_4 Reverse -171 -190 5.70265 0.189
NP_441877.1_5 Reverse -133 -152 0.491109 0.276
NP_441018.1_7 Reverse -214 -233 10.1275 0.217
NP_442790.1_4 Forward -25 -6 2.26107 0.0729
NP_442262.1_10 Forward -226 -219 14.1988 0.0123
NP_442262.1_10 Reverse -219 -226 14.1988 0.0123
NP_442262.1_10 Forward -15 -8 14.1988 0.0123
NP_442262.1_10 Reverse -8 -15 14.1988 0.0123
NP_442262.1_10 Forward -73 -66 13.2155 0.0213
NP_441689.1_5 Forward -229 -219 8.53436 0.132
NP_441689.1_5 Reverse -5 -15 8.43603 0.132
NP_441689.1_5 Forward -76 -66 5.97777 0.197
NP_441689.1_5 Reverse -216 -226 5.78111 0.197
NP_440163.1_10 Forward -230 -220 15.2213 0.0762
NP_440344.1_10 Forward -234 -217 12.6252 0.006
NP_440344.1_10 Forward -23 -6 -7.23765 0.116
NP_440344.1_10 Forward -365 -348 -11.4659 0.215
NP_440344.1_10 Reverse -211 -228 -12.9408 0.269
NP_441060.1_1 Reverse -153 -172 11.3045 0.294
NP_440562.1_3 Forward -226 -209 4.16874 0.201
NP_441965.1_3 Reverse -339 -358 1.17943 0.224
NP_441965.1_10 Forward -230 -214 21.593 0.0148
NP_441965.1_10 Reverse -4 -20 10.5799 0.107
NP_440297.1_9 Reverse -219 -229 9.32148 0.0917
NP_440297.1_9 Reverse -180 -190 3.91327 0.253
NP_440297.1_9 Forward -226 -216 -0.118297 0.282
NP_440297.1_9 Reverse -8 -18 -0.118297 0.282
NP_440297.1_9 Forward -73 -63 -0.314959 0.282
NP_440297.1_9 Forward -15 -5 -0.314959 0.282
NP_440298.1_6 Reverse -363 -377 17.3052 0.251
NP_441592.1_4 Forward -227 -208 10.2259 0.124
NP_441896.1_3 Reverse -360 -379 -0.0988766 0.234
NP_441896.1_3 Forward -25 -6 -1.86883 0.268
NP_441679.1_6 Reverse -213 -232 0.196116 0.268
NP_442067.1_4 Reverse -352 -371 5.99764 0.231
NP_440999.1_9 Forward -20 -6 6.48943 0.0969
NP_440999.1_9 Forward -231 -217 4.62115 0.116
NP_440999.1_9 Forward -17 -3 -3.44199 0.293
NP_440888.1_2 Forward -16 -2 18.8785 0.00178
NP_440888.1_2 Reverse -218 -232 15.4369 0.0107
NP_440888.1_2 Reverse -7 -21 13.2736 0.0307
NP_440888.1_2 Reverse -381 -395 5.40719 0.28
NP_440888.1_2 Forward -358 -344 5.21053 0.288
NP_440888.1_4 Reverse -72 -86 18.4709 0.129
NP_440792.1_5 Reverse -8 -27 10.0292 0.237
NP_440179.1_6 Forward -73 -54 8.25926 0.206
NP_440052.1_5 Forward -27 -8 -0.885524 0.193
NP_442033.1_10 Forward -86 -67 3.34271 0.0873
NP_442033.1_10 Reverse -63 -82 -8.45701 0.199
NP_442033.1_10 Reverse -378 -397 -14.4552 0.298
NP_441543.1_2 Reverse -219 -228 18.486 0.00236
NP_441543.1_2 Reverse -8 -17 18.486 0.00236
NP_441543.1_2 Forward -226 -217 16.9127 0.00359
NP_441543.1_2 Forward -15 -6 15.9293 0.00518
NP_442845.1_2 Reverse -65 -79 8.75105 0.187
NP_442845.1_2 Forward -233 -219 7.07942 0.199
NP_442845.1_2 Reverse -1 -15 6.09611 0.217
NP_442845.1_2 Reverse -212 -226 5.40779 0.233
NP_442845.1_2 Reverse -343 -357 3.24451 0.298
NP_441834.1_10 Forward -193 -174 3.6377 0.26
NP_440208.1_1 Forward -367 -348 -10.6203 0.257
NP_441551.1_5 Forward -20 -4 6.35103 0.273
NP_441178.1_6 Forward -373 -354 2.06362 0.276
NP_441319.1_8 Forward -22 -4 7.88563 0.239
NP_441918.1_7 Reverse -243 -262 -3.54046 0.297
NP_441469.1_8 Forward -228 -219 16.126 0.00797
NP_441469.1_8 Forward -17 -8 16.126 0.00797
NP_441469.1_8 Reverse -6 -15 6.5879 0.227
NP_441469.1_8 Reverse -217 -226 6.48957 0.227
NP_441469.1_8 Forward -42 -33 6.09625 0.236
NP_443064.1_6 Forward -227 -217 12.5669 0.0796
NP_443064.1_6 Forward -16 -6 10.8217 0.13
NP_443064.1_6 Forward -74 -64 8.59164 0.278
NP_442337.1_8 Reverse -326 -345 -2.0655 0.293
NP_442578.1_7 Forward -226 -219 14.5921 0.026
NP_442578.1_7 Forward -15 -8 14.5921 0.026
NP_442578.1_7 Reverse -219 -226 14.5921 0.026
NP_442578.1_7 Reverse -8 -15 14.5921 0.026
NP_442578.1_7 Reverse -66 -73 6.0373 0.18
NP_440998.1_3 Reverse -88 -107 4.916 0.16
NP_441462.1_2 Forward -16 -6 20.2362 0.000805
NP_441462.1_2 Forward -227 -217 11.5831 0.00406
NP_441462.1_2 Reverse -218 -228 11.5831 0.00406
NP_441462.1_2 Reverse -7 -17 11.5831 0.00406
NP_441462.1_2 Reverse -65 -75 7.55152 0.0543
NP_441462.1_2 Forward -74 -64 0.471689 0.148
NP_441621.1_7 Forward -18 -4 4.12949 0.0934
NP_441621.1_7 Forward -229 -215 -3.147 0.188
NP_441621.1_7 Reverse -5 -19 -3.147 0.188
NP_441621.1_7 Reverse -63 -77 -3.24533 0.188
NP_443062.1_1 Reverse -7 -25 16.249 0.0321
NP_443062.1_1 Reverse -218 -236 6.69328 0.194
NP_443062.1_1 Forward -74 -56 6.59578 0.195
NP_443062.1_1 Forward -227 -209 4.35311 0.264
NP_443062.1_6 Reverse -210 -229 7.7676 0.161
NP_440519.1_8 Forward -329 -313 3.00846 0.254
NP_442204.1_1 Reverse -3 -14 0.451995 0.281
NP_442204.1_1 Forward -198 -187 0.157002 0.283
NP_442204.1_2 Forward -72 -53 9.43923 0.225
NP_442204.1_5 Forward -237 -218 3.93269 0.18
NP_440516.1_2 Forward -22 -4 6.31233 0.122
NP_440516.1_8 Reverse -65 -74 18.9776 0.00442
NP_440516.1_8 Forward -227 -218 16.9127 0.00442
NP_440516.1_8 Reverse -218 -227 16.9127 0.00442
NP_440516.1_8 Forward -16 -7 16.9127 0.00442
NP_440516.1_8 Reverse -7 -16 16.9127 0.00442
NP_440516.1_8 Forward -74 -65 5.01461 0.118
NP_440516.1_8 Reverse -361 -370 -0.295266 0.232
NP_441785.1_1 Reverse -218 -232 12.6414 0.244
NP_442080.1_7 Reverse -174 -193 3.24438 0.167
NP_442428.1_5 Forward -226 -219 15.8704 0.0124
NP_442428.1_5 Reverse -219 -226 15.8704 0.0124
NP_442428.1_5 Forward -15 -8 15.8704 0.0124
NP_442428.1_5 Reverse -8 -15 15.8704 0.0124
NP_442428.1_5 Reverse -66 -73 6.13563 0.209
NP_442428.1_5 Forward -73 -66 6.0373 0.212
NP_442428.1_5 Forward -40 -33 4.66067 0.244
NP_441443.1_10 Forward -257 -239 6.40989 0.236
NP_442120.1_10 Forward -233 -214 -6.68705 0.217
NP_442120.1_10 Forward -194 -175 -7.96535 0.227
NP_442120.1_10 Forward -265 -246 -9.24366 0.242
NP_441867.1_2 Forward -242 -223 -13.4719 0.277
NP_440673.1_3 Forward -225 -218 12.4288 0.0426
NP_440673.1_3 Forward -72 -65 12.4288 0.0426
NP_440673.1_3 Forward -14 -7 12.4288 0.0426
NP_440673.1_3 Reverse -220 -227 12.4288 0.0426
NP_440673.1_3 Reverse -9 -16 12.4288 0.0426
NP_440865.1_9 Forward -233 -214 -5.31042 0.213
NP_441052.1_2 Forward -227 -217 19.9412 0.00106
NP_441052.1_2 Reverse -218 -228 10.5014 0.0285
NP_441052.1_2 Reverse -7 -17 10.5014 0.0285
NP_441052.1_2 Forward -16 -6 10.4031 0.0285
NP_441052.1_2 Forward -74 -64 1.16001 0.25
NP_441052.1_2 Reverse -65 -75 0.668351 0.256
NP_441052.1_2 Forward -358 -348 -0.314959 0.273
NP_442219.1_8 Forward -263 -244 9.03681 0.234
NP_442219.1_9 Forward -226 -217 17.7976 0.00718
NP_442219.1_9 Reverse -66 -75 8.65285 0.0681
NP_442219.1_9 Reverse -219 -228 8.35786 0.0681
NP_442219.1_9 Reverse -8 -17 8.35786 0.0681
NP_442219.1_9 Forward -15 -6 8.25953 0.0681
NP_442219.1_9 Forward -357 -348 2.35967 0.28
NP_440436.1_4 Reverse -219 -228 18.1905 0.00233
NP_440436.1_4 Reverse -8 -17 18.1905 0.00233
NP_440436.1_4 Forward -226 -217 17.2072 0.00233
NP_440436.1_4 Forward -15 -6 9.24241 0.0871
NP_440436.1_4 Forward -73 -64 6.29249 0.164
NP_441884.1_8 Reverse -64 -83 -11.9969 0.271
NP_441884.1_9 Forward -230 -211 -6.39206 0.0594
NP_441884.1_9 Reverse -62 -81 -22.6167 0.281
NP_442864.1_7 Forward -370 -352 8.86894 0.274
NP_440314.1_9 Reverse -8 -27 -3.3438 0.181
NP_440314.1_9 Forward -226 -207 -9.93197 0.281
NP_440577.1_8 Reverse -317 -336 16.2232 0.257
NP_441086.1_6 Forward -345 -335 15.9091 0.279
NP_441719.1_4 Forward -226 -219 16.3621 0.0124
NP_441719.1_4 Reverse -219 -226 16.3621 0.0124
NP_441719.1_4 Forward -15 -8 16.3621 0.0124
NP_441719.1_4 Reverse -8 -15 16.3621 0.0124
NP_441719.1_4 Reverse -66 -73 6.82395 0.0855
NP_441719.1_4 Forward -73 -66 6.52896 0.188
NP_441733.1_10 Reverse -4 -17 9.06573 0.127
NP_441733.1_10 Reverse -62 -75 8.27909 0.14
NP_441733.1_10 Reverse -215 -228 7.39411 0.153
NP_441004.1_1 Reverse -238 -257 -12.0953 0.244
NP_441004.1_1 Forward -239 -220 -15.3402 0.275
NP_441004.1_1 Reverse -65 -84 -17.8968 0.295
NP_441004.1_2 Reverse -169 -188 3.44104 0.204
NP_441004.1_4 Forward -354 -344 9.7148 0.259
NP_441004.1_4 Reverse -241 -251 8.82982 0.263
NP_441004.1_4 Reverse -177 -187 8.63316 0.269
NP_441004.1_5 Reverse -176 -190 11.0127 0.241
NP_441004.1_5 Reverse -71 -85 9.04604 0.263
NP_442366.1_3 Reverse -217 -235 14.7688 0.0216
NP_442366.1_3 Forward -228 -210 3.95239 0.102
NP_442366.1_5 Reverse -215 -225 14.0409 0.0497
NP_442873.1_5 Reverse -313 -332 10.3234 0.248
NP_442206.1_10 Forward -227 -212 15.6145 0.0799
NP_442206.1_10 Reverse -7 -22 3.32315 0.186
NP_442206.1_10 Reverse -65 -80 0.766545 0.245
NP_442854.1_6 Forward -364 -345 2.26107 0.275
NP_443054.1_2 Reverse -216 -230 3.24451 0.24
NP_443054.1_2 Forward -229 -215 1.86788 0.245
NP_443054.1_2 Forward -18 -4 0.982901 0.251
NP_443054.1_2 Forward -190 -176 0.491246 0.262
NP_441851.1_10 Forward -228 -218 16.008 0.00552
NP_441851.1_10 Forward -17 -7 16.008 0.00552
NP_441851.1_10 Reverse -217 -227 15.8113 0.00552
NP_441851.1_10 Reverse -6 -16 8.53483 0.114
NP_441542.1_4 Reverse -150 -164 4.71948 0.264
NP_441668.1_4 Reverse -133 -152 -2.36049 0.288
NP_442515.1_1 Reverse -6 -20 5.01447 0.107
NP_442515.1_1 Reverse -217 -231 2.75286 0.13
NP_442515.1_1 Forward -17 -3 -4.22864 0.298
NP_442515.1_1 Forward -228 -214 -4.62196 0.298
NP_441396.1_5 Forward -395 -386 7.37455 0.279
NP_440593.1_3 Reverse -356 -375 -0.787193 0.209
NP_440165.1_5 Forward -228 -209 -8.06369 0.288
NP_441349.1_4 Forward -67 -48 -0.39387 0.239
NP_441349.1_10 Forward -237 -218 6.4893 0.0358
NP_441349.1_10 Reverse -208 -227 -8.35868 0.274
NP_441349.1_10 Reverse -106 -125 -9.14533 0.284
NP_441409.1_6 Forward -80 -61 -6.78538 0.136
NP_441409.1_6 Reverse -212 -231 -7.4737 0.151
NP_442314.1_5 Forward -197 -178 8.35759 0.288
NP_440432.1_9 Reverse -8 -23 -3.95334 0.194
NP_442843.1_1 Reverse -362 -381 8.94757 0.116
NP_442843.1_1 Reverse -66 -85 -4.81876 0.239
NP_442843.1_1 Reverse -8 -27 -10.6203 0.279
NP_440474.1_8 Reverse -219 -233 18.7801 0.0423
NP_440474.1_8 Forward -15 -1 13.8636 0.0685
NP_440474.1_8 Reverse -8 -22 5.40719 0.25
NP_442450.1_5 Forward -229 -219 9.32148 0.115
NP_442450.1_5 Reverse -216 -226 7.55152 0.13
NP_440588.1_2 Reverse -209 -228 7.27595 0.0502
NP_440588.1_2 Forward -236 -217 1.0811 0.139
NP_440588.1_2 Forward -25 -6 -3.83545 0.197
NP_440588.1_2 Reverse -170 -189 -6.58872 0.285
NP_442006.1_2 Forward -182 -165 -17.4641 0.276
NP_440483.1_1 Reverse -356 -375 -6.98204 0.256
NP_441570.1_1 Reverse -65 -83 3.26407 0.0221
NP_441570.1_1 Forward -227 -209 -8.24065 0.107
NP_441570.1_1 Reverse -162 -180 -15.6155 0.231
NP_441570.1_1 Reverse -180 -198 -17.0904 0.264
NP_441570.1_1 Reverse -179 -197 -17.4838 0.278
NP_441570.1_1 Reverse -218 -236 -17.7788 0.291
NP_440078.1_10 Forward -227 -208 5.60432 0.224
NP_441078.1_4 Forward -227 -218 19.6659 0.0007
NP_441078.1_4 Reverse -218 -227 19.6659 0.0007
NP_441078.1_4 Forward -16 -7 19.6659 0.0007
NP_441078.1_4 Reverse -7 -16 19.6659 0.0007
NP_441078.1_4 Reverse -65 -74 0.196389 0.205
NP_441078.1_4 Forward -74 -65 -0.000272808 0.205
NP_441078.1_4 Forward -188 -179 -1.37691 0.254
NP_442729.1_8 Forward -20 -7 10.344 0.125
NP_442388.1_3 Reverse -4 -23 9.73422 0.216
NP_441663.1_8 Forward -233 -214 -3.54046 0.291
NP_442348.1_2 Forward -189 -180 9.14451 0.28
NP_441091.1_5 Forward -84 -65 17.109 0.0818
NP_441094.1_6 Forward -234 -217 8.69123 0.261
NP_440526.1_3 Forward -73 -62 8.80962 0.115
NP_440526.1_3 Forward -226 -215 8.02298 0.126
NP_440526.1_3 Forward -15 -4 2.31981 0.267
NP_440526.1_3 Reverse -219 -230 1.92649 0.267
NP_441432.1_8 Reverse -217 -226 16.8143 0.00595
NP_441432.1_8 Reverse -6 -15 16.8143 0.00595
NP_441432.1_8 Forward -228 -219 8.25953 0.0755
NP_441432.1_8 Forward -17 -8 8.25953 0.0755
NP_441432.1_8 Reverse -64 -73 5.60459 0.147
NP_441432.1_8 Forward -189 -180 3.7363 0.243
NP_442320.1_8 Forward -233 -219 15.2409 0.011
NP_442320.1_8 Forward -22 -8 5.89945 0.0309
NP_442320.1_8 Forward -47 -33 -4.13031 0.148
NP_442344.1_7 Forward -226 -207 9.63589 0.0407
NP_442344.1_7 Reverse -8 -27 -7.67036 0.191
NP_441732.1_2 Forward -20 -4 -15.2811 0.145
NP_441732.1_2 Reverse -3 -19 -16.0677 0.164
NP_441732.1_2 Forward -231 -215 -16.4611 0.167
NP_441732.1_2 Forward -362 -346 -16.6577 0.186
NP_441732.1_2 Reverse -214 -230 -17.4444 0.258
NP_441732.1_2 Forward -78 -62 -17.4444 0.258
NP_440497.1_2 Reverse -181 -200 7.66927 0.227
NP_440629.1_5 Reverse -97 -116 7.57094 0.29
NP_442003.1_9 Reverse -355 -374 4.42435 0.263
NP_440760.1_1 Reverse -7 -26 -9.63698 0.084
NP_440760.1_1 Reverse -218 -237 -20.8467 0.225
NP_440760.1_1 Forward -227 -208 -21.83 0.245
NP_440760.1_1 Reverse -361 -380 -22.715 0.267
NP_440199.1_10 Forward -230 -220 14.533 0.0861
NP_441057.1_4 Forward -330 -312 -3.91409 0.299
NP_440913.1_1 Reverse -242 -260 7.00065 0.218
NP_440913.1_3 Forward -370 -357 15.3589 0.215
NP_442400.1_10 Reverse -100 -113 7.51014 0.284
NP_440713.1_4 Reverse -55 -74 11.1109 0.119
NP_440713.1_4 Forward -84 -65 6.88262 0.184
NP_440713.1_4 Reverse -345 -364 4.52268 0.226
NP_442489.1_2 Forward -238 -219 3.04771 0.25
NP_442489.1_7 Forward -227 -218 20.1576 0.000695
NP_442489.1_7 Reverse -218 -227 20.1576 0.000695
NP_442489.1_7 Forward -16 -7 20.1576 0.000695
NP_442489.1_7 Reverse -7 -16 20.1576 0.000695
NP_442489.1_7 Forward -74 -65 0.688044 0.152
NP_442489.1_7 Reverse -65 -74 0.688044 0.152
NP_442489.1_7 Forward -188 -179 -1.37691 0.195
NP_442489.1_7 Reverse -179 -188 -1.6719 0.235
NP_441452.1_1 Forward -85 -66 12.2908 0.292
NP_442079.1_7 Reverse -8 -27 2.3594 0.229
NP_442079.1_7 Forward -73 -54 1.86774 0.24
NP_442079.1_7 Reverse -66 -85 0.58944 0.277
NP_440559.1_1 Forward -226 -217 17.4043 0.00658
NP_440559.1_1 Reverse -219 -228 8.75118 0.0586
NP_440559.1_1 Reverse -8 -17 8.75118 0.0586
NP_440559.1_1 Forward -15 -6 8.65285 0.0586
NP_440559.1_1 Forward -73 -64 7.66954 0.0999
NP_440559.1_1 Reverse -66 -75 6.48957 0.134
NP_441659.2_8 Forward -16 -6 20.9245 0.000805
NP_441659.2_8 Forward -227 -217 18.1713 0.00133
NP_441659.2_8 Reverse -218 -228 11.9764 0.0147
NP_441659.2_8 Reverse -7 -17 11.9764 0.0147
NP_441659.2_8 Forward -74 -64 6.66654 0.0694
NP_442749.1_5 Reverse -99 -116 9.28417 0.216
NP_441040.1_2 Reverse -216 -235 -15.7335 0.286
NP_441040.1_5 Reverse -60 -79 5.40766 0.236
NP_441185.1_6 Reverse -338 -357 3.73603 0.208
NP_442346.1_5 Reverse -217 -227 16.6963 0.00248
NP_442346.1_5 Reverse -6 -16 16.303 0.00248
NP_442346.1_5 Forward -228 -218 9.02648 0.118
NP_442346.1_5 Forward -17 -7 9.02648 0.118
NP_442346.1_10 Forward -167 -148 -0.0988766 0.263
NP_440545.1_3 Reverse -3 -20 15.5751 0.013
NP_440545.1_3 Reverse -61 -78 -0.649475 0.157
NP_440545.1_3 Forward -78 -61 -4.68105 0.23
NP_440545.1_3 Reverse -214 -231 -6.451 0.28
NP_441856.1_3 Forward -230 -211 -2.45882 0.261
NP_441786.1_10 Forward -180 -161 7.37428 0.268
NP_441126.1_5 Forward -390 -371 1.27776 0.299
NP_441126.1_6 Reverse -82 -96 14.231 0.267
NP_440459.1_2 Forward -197 -180 8.7903 0.249
NP_440459.1_2 Forward -242 -225 8.00365 0.272
NP_441653.1_2 Reverse -54 -73 2.27338 0.295
NP_440010.1_10 Reverse -206 -225 10.4225 0.209
NP_442603.1_7 Reverse -65 -79 20.5501 0.00738
NP_442603.1_7 Forward -227 -213 6.19383 0.253
NP_442603.1_7 Reverse -7 -21 5.50552 0.29
NP_441585.1_2 Reverse -369 -388 16.7157 0.201
NP_441888.1_7 Forward -21 -7 12.586 0.0743
NP_440449.1_6 Reverse -372 -390 10.4929 0.154
NP_440449.1_6 Reverse -172 -190 8.3531 0.201
NP_441833.1_4 Forward -226 -219 15.9687 0.0124
NP_441833.1_4 Reverse -219 -226 15.9687 0.0124
NP_441833.1_4 Forward -15 -8 15.9687 0.0124
NP_441833.1_4 Reverse -8 -15 15.9687 0.0124
NP_441833.1_4 Forward -73 -66 6.52896 0.0924
NP_441833.1_4 Reverse -66 -73 6.23397 0.163
NP_442162.1_9 Forward -226 -219 16.2637 0.0124
NP_442162.1_9 Reverse -219 -226 16.2637 0.0124
NP_442162.1_9 Forward -15 -8 16.2637 0.0124
NP_442162.1_9 Reverse -8 -15 16.2637 0.0124
NP_442162.1_9 Forward -73 -66 12.9205 0.0282
NP_442162.1_9 Reverse -66 -73 12.9205 0.0282
NP_442055.1_8 Reverse -216 -235 11.3067 0.254
NP_440671.1_2 Forward -286 -272 17.0108 0.136
NP_440671.1_4 Forward -233 -219 18.2892 0.014
NP_440671.1_4 Forward -80 -66 14.3559 0.0632
NP_440671.1_4 Reverse -59 -73 5.50613 0.281
NP_441973.1_1 Forward -158 -143 0.373221 0.235
NP_442073.1_6 Forward -236 -217 -2.26216 0.286
NP_442199.1_5 Forward -235 -216 5.11266 0.0977
NP_442199.1_5 Forward -24 -5 -3.44213 0.206
NP_442140.1_3 Reverse -8 -18 14.238 0.0486
NP_442140.1_3 Forward -73 -63 12.7631 0.0632
NP_442140.1_3 Forward -226 -216 12.2714 0.0632
NP_442140.1_3 Reverse -219 -229 8.33817 0.119
NP_442140.1_3 Forward -15 -5 7.94484 0.124
NP_442140.1_3 Reverse -33 -43 5.19158 0.221
NP_441609.1_1 Forward -115 -96 8.06259 0.152
NP_440875.1_9 Forward -14 -4 14.5042 0.0411
NP_440875.1_9 Forward -72 -62 9.24806 0.233
NP_440875.1_9 Reverse -9 -19 8.46937 0.233
NP_440875.1_9 Reverse -220 -230 8.37203 0.233
NP_442547.1_7 Forward -192 -173 11.0983 0.261
NP_441813.1_5 Forward -18 -8 19.4496 0.00647
NP_441813.1_5 Forward -229 -219 17.188 0.00979
NP_441813.1_5 Forward -76 -66 12.7631 0.0192
NP_441813.1_5 Reverse -5 -15 8.73149 0.0367
NP_441813.1_5 Reverse -216 -226 8.63316 0.0367
NP_441813.1_5 Reverse -63 -73 -0.806614 0.285
NP_440594.1_8 Forward -15 -2 9.45847 0.186
NP_440590.1_4 Reverse -8 -21 3.36254 0.0746
NP_440590.1_4 Reverse -219 -232 3.26421 0.0749
NP_440590.1_4 Forward -15 -2 3.16588 0.0756
NP_440590.1_4 Forward -357 -344 -1.16069 0.212
NP_440590.1_4 Reverse -66 -79 -4.01229 0.257
NP_440590.1_4 Forward -226 -213 -5.88057 0.293
NP_440567.1_1 Forward -15 -1 20.6491 0.012
NP_440567.1_1 Forward -226 -212 11.0127 0.0305
NP_440567.1_1 Reverse -219 -233 7.66941 0.067
NP_440567.1_1 Reverse -8 -22 6.48943 0.0831
NP_442497.1_10 Forward -15 -6 17.601 0.00813
NP_442497.1_10 Forward -226 -217 10.4228 0.0087
NP_442497.1_10 Reverse -219 -228 10.4228 0.0087
NP_442497.1_10 Reverse -8 -17 10.4228 0.0087
NP_442497.1_10 Forward -73 -64 10.0295 0.0222
NP_440821.1_4 Forward -229 -219 19.0562 0.00399
NP_440821.1_4 Reverse -5 -15 10.7964 0.0146
NP_440821.1_4 Forward -18 -8 10.2065 0.0163
NP_440821.1_4 Reverse -63 -73 9.81313 0.0246
NP_440821.1_4 Reverse -216 -226 9.41981 0.0286
NP_440821.1_4 Forward -76 -66 6.07655 0.1
NP_441239.1_9 Reverse -5 -17 17.4436 0.0146
NP_441239.1_9 Forward -18 -6 14.1986 0.0288
NP_441239.1_9 Forward -229 -217 13.3137 0.037
NP_441239.1_9 Forward -76 -64 6.33216 0.193
NP_441239.1_9 Reverse -216 -228 5.93884 0.202
NP_441239.1_9 Forward -190 -178 5.44718 0.221
NP_440156.1_4 Forward -308 -298 8.53436 0.298
NP_442897.1_5 Reverse -349 -368 25.4143 0.00345
NP_440706.1_1 Reverse -214 -233 -5.9004 0.296
NP_440624.1_5 Reverse -90 -108 13.3554 0.178
NP_441892.1_1 Forward -83 -66 -0.944468 0.193
NP_441892.1_2 Reverse -188 -207 0.0977854 0.16
NP_442193.1_8 Forward -361 -342 11.0117 0.269
NP_441017.1_6 Forward -231 -217 12.487 0.217
NP_440833.1_6 Reverse -319 -333 12.5853 0.187
NP_442216.1_4 Forward -160 -152 8.27883 0.255
NP_440354.1_7 Reverse -1 -19 15.0638 0.167
NP_441617.1_8 Reverse -231 -250 11.3067 0.252
NP_442052.1_8 Reverse -177 -187 12.4681 0.268
NP_440546.1_4 Forward -16 -6 13.5365 0.0459
NP_440546.1_4 Reverse -65 -75 12.1791 0.0679
NP_440546.1_4 Reverse -218 -228 11.8882 0.0679
NP_440546.1_4 Reverse -7 -17 11.8882 0.0679
NP_440546.1_4 Reverse -361 -371 10.3369 0.109
NP_440546.1_4 Forward -227 -217 10.046 0.109
NP_440546.1_4 Forward -74 -64 7.52511 0.235
NP_440546.1_6 Reverse -362 -381 7.86593 0.266
NP_441230.1_5 Forward -85 -66 3.34271 0.202
NP_441230.1_5 Forward -232 -213 2.3594 0.215
NP_441230.1_6 Forward -228 -209 13.5691 0.212
NP_440675.1_3 Forward -74 -55 9.3409 0.186
NP_440462.1_4 Reverse -64 -78 8.35772 0.265
NP_440462.1_6 Reverse -5 -15 19.4496 0.00371
NP_440462.1_6 Forward -18 -8 17.2863 0.00752
NP_440462.1_6 Forward -229 -219 15.418 0.0142
NP_440462.1_6 Forward -76 -66 3.81494 0.228
NP_440462.1_6 Reverse -216 -226 1.35667 0.294
NP_442465.1_2 Forward -107 -88 1.17865 0.259
NP_440868.1_4 Reverse -3 -15 17.0502 0.0124
NP_440868.1_4 Reverse -214 -226 15.1819 0.0164
NP_440868.1_4 Forward -20 -8 12.527 0.0235
NP_440868.1_4 Forward -231 -219 8.49544 0.0602
NP_440868.1_4 Reverse -61 -73 5.25052 0.102
NP_441497.1_3 Forward -352 -333 -12.0953 0.296
NP_442479.1_5 Reverse -136 -155 5.65501 0.276
NP_442479.1_9 Reverse -98 -117 -13.6686 0.29
NP_440270.1_6 Reverse -168 -187 17.0107 0.125
NP_442402.1_1 Forward -384 -365 7.66927 0.289
NP_442402.1_2 Forward -379 -365 10.5204 0.292
NP_442402.1_4 Forward -366 -347 5.01354 0.144
NP_442402.1_10 Reverse -117 -127 13.4509 0.202
NP_440036.1_6 Forward -83 -64 18.0924 0.0675
NP_441848.1_7 Reverse -108 -127 19.4681 0.0531
NP_441848.1_7 Reverse -109 -128 4.71854 0.215
NP_441084.1_6 Reverse -5 -19 11.3802 0.205
NP_440696.1_3 Reverse -351 -369 2.47742 0.216
NP_442039.1_4 Forward -226 -219 15.1821 0.0124
NP_442039.1_4 Reverse -219 -226 15.1821 0.0124
NP_442039.1_4 Forward -15 -8 15.1821 0.0124
NP_442039.1_4 Reverse -8 -15 15.1821 0.0124
NP_442039.1_4 Reverse -66 -73 11.6422 0.0747
NP_442039.1_7 Reverse -345 -355 11.6814 0.257
NP_442039.1_7 Forward -250 -240 7.25653 0.277
NP_441811.1_1 Forward -379 -360 11.6025 0.257
NP_441811.1_8 Forward -212 -198 6.29277 0.28
NP_441926.1_3 Reverse -218 -234 6.74504 0.17
NP_440825.1_6 Forward -220 -201 7.96426 0.285
NP_440825.1_7 Forward -226 -216 12.9096 0.152
NP_442837.1_3 Forward -226 -219 15.7721 0.0124
NP_442837.1_3 Reverse -219 -226 15.7721 0.0124
NP_442837.1_3 Forward -15 -8 15.7721 0.0124
NP_442837.1_3 Reverse -8 -15 15.7721 0.0124
NP_442837.1_3 Forward -73 -66 6.0373 0.25
NP_442837.1_3 Reverse -66 -73 6.0373 0.25
NP_442053.1_1 Forward -227 -218 18.3876 0.0007
NP_442053.1_1 Reverse -218 -227 18.3876 0.0007
NP_442053.1_1 Forward -16 -7 18.3876 0.0007
NP_442053.1_1 Reverse -7 -16 18.3876 0.0007
NP_442053.1_1 Forward -74 -65 14.4544 0.0114
NP_442053.1_1 Reverse -65 -74 7.86621 0.0863
NP_440505.1_3 Forward -18 -8 15.9097 0.00857
NP_440505.1_3 Reverse -5 -15 15.418 0.0114
NP_440505.1_3 Forward -229 -219 13.8447 0.0247
NP_440505.1_3 Reverse -216 -226 9.22315 0.122
NP_440505.1_3 Reverse -63 -73 6.27322 0.187
NP_441959.1_7 Reverse -98 -112 17.4042 0.205
NP_440520.1_6 Reverse -91 -110 11.7008 0.0526
NP_441252.1_6 Reverse -366 -373 11.9372 0.25
NP_441252.1_6 Reverse -347 -354 11.6422 0.288
NP_441203.1_1 Reverse -356 -375 -19.5684 0.297
NP_442255.1_2 Forward -363 -344 13.2741 0.125
NP_442532.1_4 Forward -117 -99 8.93451 0.278
NP_442532.1_7 Reverse -7 -21 4.62115 0.171
NP_442532.1_7 Reverse -32 -46 2.5562 0.235
NP_440914.1_1 Forward -227 -217 17.5935 0.000537
NP_440914.1_1 Forward -16 -6 16.3248 0.00196
NP_440914.1_1 Reverse -65 -75 12.1284 0.0654
NP_440914.1_1 Reverse -180 -190 9.39583 0.186
NP_440914.1_1 Reverse -218 -228 8.6151 0.186
NP_440914.1_1 Reverse -7 -17 8.6151 0.186
NP_440914.1_1 Reverse -349 -359 7.15123 0.249
NP_441011.1_8 Reverse -219 -228 16.9127 0.00602
NP_441011.1_8 Reverse -8 -17 16.9127 0.00602
NP_441011.1_8 Forward -15 -6 16.6177 0.00602
NP_441011.1_8 Reverse -169 -178 9.14451 0.135
NP_441011.1_8 Forward -226 -217 8.25953 0.144
NP_442533.1_6 Forward -227 -218 17.2076 0.00137
NP_442533.1_6 Reverse -218 -227 17.2076 0.00137
NP_442533.1_6 Forward -16 -7 17.2076 0.00137
NP_442533.1_6 Reverse -7 -16 17.2076 0.00137
NP_442533.1_6 Reverse -380 -389 11.2095 0.046
NP_442533.1_6 Forward -74 -65 4.42462 0.179
NP_442533.1_6 Forward -370 -361 2.06468 0.275
NP_442533.1_6 Forward -386 -377 1.67135 0.293
NP_442541.1_10 Reverse -179 -193 4.12889 0.252
NP_440263.1_1 Forward -146 -133 17.7012 0.239
NP_440263.1_5 Forward -114 -100 21.3374 0.0613
NP_440263.1_6 Forward -341 -322 20.059 0.0552
NP_442232.1_3 Reverse -57 -76 -13.6686 0.282
NP_442229.1_1 Reverse -216 -230 8.25877 0.184
NP_442535.1_2 Forward -114 -95 21.2389 0.0217
NP_441482.1_7 Forward -80 -66 -1.27871 0.0666
NP_441482.1_7 Forward -22 -8 -4.81863 0.159
NP_441482.1_7 Forward -233 -219 -8.94853 0.193
NP_441482.1_7 Reverse -59 -73 -8.94853 0.193
NP_441482.1_7 Reverse -212 -226 -10.8168 0.216
NP_439944.1_9 Forward -15 -5 17.7779 0.00341
NP_439944.1_9 Forward -226 -216 10.5014 0.0887
NP_439944.1_9 Reverse -219 -229 10.3048 0.0887
NP_439944.1_9 Forward -73 -63 7.64985 0.134
NP_441028.1_6 Forward -159 -149 5.19112 0.265
NP_441028.1_6 Reverse -382 -392 3.71617 0.281
NP_440116.1_8 Forward -73 -54 1.57275 0.0919
NP_440116.1_8 Forward -226 -207 -1.18052 0.117
NP_440116.1_8 Reverse -66 -85 -3.73712 0.158
NP_440115.1_6 Reverse -62 -72 19.2529 0.0106
NP_440115.1_6 Reverse -4 -14 16.008 0.0325
NP_440115.1_6 Reverse -215 -225 9.32148 0.115
NP_440007.1_4 Forward -238 -219 12.0942 0.232
NP_440007.1_9 Reverse -253 -267 7.66941 0.201
NP_440007.1_9 Reverse -61 -75 5.80112 0.245
NP_441059.1_2 Reverse -350 -369 -6.78538 0.268
NP_441602.1_3 Forward -21 -2 8.25926 0.117
NP_441972.1_5 Reverse -362 -381 -9.24366 0.282
NP_441972.1_5 Reverse -157 -176 -9.73531 0.293
NP_441106.1_1 Reverse -6 -15 18.486 0.0028
NP_441106.1_1 Forward -228 -219 18.191 0.0028
NP_441106.1_1 Forward -17 -8 18.191 0.0028
NP_441106.1_1 Reverse -217 -226 9.63616 0.0311
NP_439903.1_6 Forward -230 -211 3.04693 0.213
NP_442306.1_10 Reverse -2 -21 -11.1119 0.119
NP_442306.1_10 Reverse -213 -232 -20.1584 0.202
NP_441286.1_1 Reverse -217 -229 14.4936 0.00418
NP_441286.1_1 Forward -75 -63 5.15219 0.0259
NP_441286.1_1 Forward -17 -5 5.15219 0.0259
NP_441286.1_1 Forward -228 -216 3.38223 0.0467
NP_441286.1_1 Reverse -64 -76 1.51394 0.0829
NP_441286.1_1 Reverse -6 -18 -3.40261 0.145
NP_440670.1_8 Forward -227 -218 18.3876 0.000699
NP_440670.1_8 Reverse -218 -227 18.3876 0.000699
NP_440670.1_8 Forward -16 -7 18.3876 0.000699
NP_440670.1_8 Reverse -7 -16 18.3876 0.000699
NP_440670.1_8 Reverse -65 -74 8.75118 0.0606
NP_440670.1_8 Forward -74 -65 6.19458 0.124
NP_441705.1_3 Forward -301 -282 -2.26216 0.281
NP_441930.1_2 Forward -189 -179 11.9764 0.271
NP_440886.1_7 Forward -228 -218 17.7774 0.0011
NP_440886.1_7 Forward -17 -7 17.7774 0.0011
NP_440886.1_7 Reverse -6 -16 8.04271 0.0805
NP_440886.1_7 Reverse -217 -227 7.94438 0.0805
NP_440886.1_7 Forward -75 -65 6.66608 0.115
NP_440886.1_7 Forward -88 -78 3.22451 0.291
NP_442614.1_2 Forward -390 -376 13.0776 0.133
NP_442614.1_2 Forward -389 -375 10.7177 0.234
NP_442614.1_2 Reverse -65 -79 10.226 0.234
NP_442614.1_2 Forward -227 -213 8.94771 0.242
NP_442614.1_2 Forward -16 -2 5.70279 0.298
NP_442382.1_7 Forward -87 -68 10.8159 0.185
NP_439995.1_7 Forward -78 -64 16.9119 0.285
NP_442072.1_9 Forward -390 -372 -22.302 0.229
NP_442072.1_9 Reverse -217 -235 -22.302 0.229
NP_441808.1_8 Reverse -349 -368 8.06259 0.272
NP_440907.2_8 Forward -15 -5 19.1541 0.00362
NP_440907.2_8 Forward -73 -63 17.6791 0.00685
NP_440907.2_8 Reverse -8 -18 7.94438 0.117
NP_440907.2_8 Reverse -219 -229 7.84605 0.117
NP_440907.2_8 Forward -226 -216 7.64939 0.117
NP_442459.1_7 Forward -107 -88 11.4058 0.187
NP_442459.1_8 Forward -232 -213 12.7825 0.125
NP_441463.1_3 Forward -26 -7 1.96607 0.123
NP_441463.1_3 Reverse -208 -227 -0.000545616 0.132
NP_441463.1_3 Forward -237 -218 -8.16202 0.266
NP_442893.1_4 Forward -119 -100 -0.00131823 0.251
NP_441626.1_2 Forward -226 -219 15.7721 0.0124
NP_441626.1_2 Reverse -219 -226 15.7721 0.0124
NP_441626.1_2 Forward -15 -8 15.7721 0.0124
NP_441626.1_2 Reverse -8 -15 15.7721 0.0124
NP_441626.1_2 Reverse -66 -73 12.2322 0.0511
NP_441626.1_2 Forward -73 -66 5.93897 0.231
NP_442365.1_5 Forward -226 -207 9.14423 0.209
NP_442365.1_7 Forward -20 -1 1.67108 0.168
NP_442365.1_7 Forward -78 -59 -2.16383 0.199
NP_442365.1_7 Reverse -214 -233 -6.49039 0.295
NP_440107.1_5 Reverse -348 -367 -6.98204 0.272
NP_442794.1_1 Forward -78 -66 18.7219 0.009
NP_442794.1_1 Reverse -214 -226 12.1337 0.0721
NP_442615.1_1 Forward -236 -218 13.0972 0.0119
NP_442615.1_1 Reverse -209 -227 7.29564 0.0322
NP_442615.1_1 Reverse -56 -74 3.16574 0.0575
NP_441962.1_4 Reverse -2 -21 2.3594 0.103
NP_441962.1_4 Forward -258 -239 -3.44213 0.148
NP_441962.1_4 Forward -232 -213 -10.7186 0.232
NP_441962.1_4 Reverse -151 -170 -11.2103 0.238
NP_440387.1_1 Forward -227 -211 20.413 0.00303
NP_440387.1_1 Reverse -218 -234 -1.12144 0.142
NP_440387.1_1 Reverse -7 -23 -1.21977 0.142
NP_440387.1_5 Forward -50 -31 11.1342 0.278
NP_440855.1_3 Forward -93 -74 7.17681 0.247
NP_441431.1_2 Forward -230 -216 9.24208 0.19
NP_441431.1_2 Forward -19 -5 7.86545 0.231
NP_441431.1_2 Reverse -4 -18 7.57046 0.238
NP_441836.1_2 Reverse -1 -20 2.45773 0.172
NP_441993.1_1 Reverse -179 -198 2.33652 0.26
NP_441174.1_2 Reverse -4 -18 11.6026 0.293
NP_440814.1_4 Reverse -56 -75 -11.7019 0.228
NP_440114.1_10 Reverse -218 -232 17.8958 0.00824
NP_440114.1_10 Forward -16 -2 15.5359 0.0249
NP_440114.1_10 Reverse -7 -21 11.406 0.115
NP_442323.1_7 Forward -199 -180 6.48849 0.194
NP_441206.1_2 Reverse -355 -374 12.7825 0.225
NP_441500.1_8 Reverse -88 -102 15.886 0.261
NP_442087.1_2 Reverse -7 -26 15.1481 0.2
NP_440293.1_1 Reverse -353 -372 13.3725 0.163
NP_440766.1_4 Reverse -3 -17 6.6861 0.0991
NP_440766.1_4 Forward -78 -64 5.30946 0.112
NP_440766.1_4 Reverse -61 -75 2.5562 0.179
NP_439988.1_3 Reverse -186 -200 10.0294 0.233
NP_441237.1_9 Forward -226 -216 14.828 0.0242
NP_441237.1_9 Forward -188 -178 10.6981 0.22
NP_442743.1_4 Reverse -337 -356 -7.76869 0.28
NP_442743.1_5 Forward -363 -344 7.86593 0.162
NP_441311.1_2 Reverse -1 -15 12.2903 0.236
NP_440643.1_2 Forward -52 -33 3.44104 0.278
NP_439910.1_2 Forward -235 -218 -11.7609 0.0788
NP_440457.1_1 Reverse -61 -73 21.2785 0.0344
NP_440457.1_1 Reverse -3 -15 9.87208 0.092
NP_440457.1_1 Forward -231 -219 0.0389777 0.25
NP_440457.1_1 Forward -328 -316 -0.551008 0.268
NP_440457.1_1 Forward -20 -8 -0.74767 0.273
NP_440213.1_5 Forward -264 -245 7.17762 0.297
NP_440798.1_2 Forward -354 -340 15.4369 0.235
NP_440798.1_6 Forward -15 -2 20.2755 0.0203
NP_440798.1_6 Forward -73 -60 8.57408 0.118
NP_440801.1_8 Forward -228 -209 1.17943 0.246
NP_441984.1_6 Forward -307 -295 14.1003 0.258
NP_442509.1_9 Reverse -218 -228 16.2041 0.00739
NP_442509.1_9 Reverse -7 -17 16.2041 0.00739
NP_442509.1_9 Forward -74 -64 10.8943 0.152
NP_442509.1_9 Forward -227 -217 8.14104 0.192
NP_442509.1_9 Forward -16 -6 8.04271 0.192
NP_441489.1_3 Reverse -102 -116 10.6112 0.232
NP_441496.1_1 Reverse -95 -109 15.0039 0.265
NP_442514.1_5 Reverse -354 -373 3.24359 0.159
NP_442514.1_5 Forward -360 -341 -1.47628 0.201
NP_442514.1_5 Forward -378 -359 -6.49113 0.267
NP_442514.1_5 Forward -379 -360 -7.17944 0.275
NP_442514.1_5 Reverse -236 -255 -8.55607 0.285
NP_440554.1_4 Reverse -8 -18 16.4996 0.0189
NP_440554.1_4 Forward -15 -5 15.418 0.0199
NP_440554.1_4 Reverse -219 -229 14.6313 0.02
NP_440554.1_4 Forward -73 -63 3.32329 0.234
NP_440554.1_4 Reverse -33 -43 2.83163 0.251
NP_442862.1_3 Forward -161 -144 4.26707 0.29
NP_441845.1_6 Forward -28 -10 -1.35749 0.285
NP_441885.1_5 Forward -227 -217 20.9245 0.000538
NP_441885.1_5 Reverse -218 -228 11.4848 0.00668
NP_441885.1_5 Reverse -7 -17 11.4848 0.00668
NP_441885.1_5 Forward -16 -6 11.3864 0.00668
NP_441885.1_5 Reverse -65 -75 9.51814 0.0206
NP_442341.1_5 Reverse -24 -43 14.2574 0.201
NP_442341.1_7 Forward -228 -214 12.3893 0.0454
NP_442341.1_7 Reverse -217 -231 10.0294 0.0682
NP_442341.1_7 Forward -254 -240 4.12949 0.2
NP_442341.1_7 Reverse -52 -66 3.24451 0.23
NP_442341.1_7 Forward -17 -3 2.65453 0.249
NP_442341.1_9 Forward -229 -215 16.3219 0.0371
NP_442341.1_9 Forward -18 -4 5.70218 0.258
NP_440423.1_6 Forward -235 -216 -15.4385 0.229
NP_443000.1_7 Forward -18 -8 11.5831 0.0344
NP_443000.1_7 Reverse -5 -15 10.7964 0.0345
NP_443000.1_7 Reverse -216 -226 10.3048 0.0345
NP_443000.1_7 Forward -229 -219 8.73149 0.0437
NP_440507.2_3 Reverse -62 -81 9.93006 0.213
NP_440507.2_3 Forward -236 -217 7.57013 0.274
NP_443059.1_10 Forward -82 -63 4.03023 0.211
NP_441842.1_1 Forward -14 -1 17.3249 0.033
NP_441842.1_7 Forward -383 -364 11.7 0.259
NP_441842.1_10 Forward -234 -220 7.17775 0.264
NP_440275.1_3 Reverse -5 -15 18.6629 0.0082
NP_440275.1_3 Reverse -63 -73 16.9913 0.0133
NP_440275.1_3 Forward -18 -8 15.418 0.0178
NP_440275.1_3 Forward -229 -219 8.4365 0.0602
NP_440275.1_3 Reverse -216 -226 8.04317 0.0602
NP_440091.1_1 Forward -231 -219 18.3285 0.0114
NP_440091.1_1 Reverse -3 -15 10.2654 0.0498
NP_442354.1_8 Reverse -341 -360 7.86593 0.266
NP_441902.1_3 Reverse -150 -160 13.4676 0.23
NP_440679.1_10 Reverse -9 -28 -17.8968 0.275
NP_443010.1_10 Reverse -4 -21 3.44723 0.253
NP_443010.1_10 Forward -230 -213 3.3506 0.255
NP_442451.1_2 Reverse -313 -332 -10.9153 0.28
NP_441122.1_1 Reverse -338 -353 5.58476 0.28
NP_440149.1_8 Reverse -65 -84 -0.983855 0.154
NP_440149.1_8 Reverse -244 -263 -5.11376 0.219
NP_440149.1_8 Reverse -179 -198 -5.70374 0.231
NP_441105.1_3 Forward -238 -219 1.86774 0.109
NP_441105.1_3 Reverse -157 -176 -9.63698 0.292
NP_441105.1_3 Forward -377 -358 -10.0303 0.3
NP_440216.1_1 Forward -16 -2 17.4042 0.00188
NP_440216.1_1 Reverse -7 -21 7.27608 0.00942
NP_440216.1_1 Reverse -218 -232 6.29277 0.0156
NP_440216.1_1 Forward -74 -60 -5.11362 0.121
NP_440216.1_1 Forward -227 -213 -10.3252 0.145
NP_440216.1_9 Forward -300 -291 8.65285 0.286
NP_440172.1_1 Forward -16 -6 17.5813 0.00421
NP_440172.1_1 Forward -227 -217 15.0247 0.00945
NP_440172.1_1 Reverse -218 -228 8.73149 0.0586
NP_440172.1_1 Reverse -7 -17 8.73149 0.0586
NP_440172.1_1 Reverse -65 -75 6.27322 0.107
NP_440172.1_1 Forward -74 -64 3.51995 0.224
NP_441008.1_4 Forward -370 -351 14.7658 0.295
NP_440249.1_2 Reverse -107 -117 15.9091 0.241
NP_442015.1_10 Reverse -214 -227 10.049 0.0415
NP_442015.1_10 Forward -78 -65 9.2624 0.0515
NP_442015.1_10 Forward -20 -7 2.96921 0.187
NP_442015.1_10 Forward -231 -218 0.904263 0.216
NP_441226.1_7 Forward -226 -219 14.4934 0.0123
NP_441226.1_7 Reverse -219 -226 14.4934 0.0123
NP_441226.1_7 Forward -15 -8 14.4934 0.0123
NP_441226.1_7 Reverse -8 -15 14.4934 0.0123
NP_441226.1_7 Reverse -66 -73 12.7234 0.0312
NP_441226.1_7 Forward -73 -66 11.5435 0.0757
NP_441226.1_7 Reverse -33 -40 11.2485 0.0971
NP_441226.1_7 Forward -363 -356 9.47853 0.147
NP_441226.1_7 Forward -351 -344 6.52862 0.253
NP_441226.1_7 Reverse -381 -388 5.64364 0.286
NP_442834.1_9 Reverse -359 -378 5.40766 0.268
NP_441111.1_7 Forward -226 -218 18.7023 0.00294
NP_441111.1_7 Forward -15 -7 18.7023 0.00294
NP_441111.1_7 Reverse -219 -227 18.7023 0.00294
NP_441111.1_7 Reverse -8 -16 18.7023 0.00294
NP_441111.1_7 Forward -73 -65 8.86921 0.0589
NP_441766.1_2 Forward -227 -218 17.5026 0.00297
NP_441766.1_2 Reverse -218 -227 17.5026 0.00297
NP_441766.1_2 Forward -16 -7 17.5026 0.00297
NP_441766.1_2 Reverse -7 -16 17.5026 0.00297
NP_441766.1_2 Forward -74 -65 14.7494 0.00772
NP_442417.1_5 Reverse -7 -21 10.0294 0.124
NP_440416.1_1 Reverse -7 -26 -12.1936 0.272
NP_440416.1_1 Forward -324 -305 -14.1602 0.284
NP_440416.1_9 Reverse -161 -180 -8.16202 0.111
NP_440416.1_9 Forward -234 -215 -14.2585 0.174
NP_440416.1_9 Reverse -211 -230 -16.7168 0.22
NP_443052.1_8 Reverse -249 -268 -7.17871 0.154
NP_443052.1_8 Forward -237 -218 -10.3253 0.207
NP_442116.1_6 Forward -116 -99 8.8374 0.238
NP_440591.1_9 Reverse -64 -82 20.0787 0.0291
NP_440591.1_9 Reverse -178 -196 7.39397 0.206
NP_442154.1_1 Reverse -210 -228 -19.1554 0.291
NP_440261.1_5 Forward -15 -2 6.60746 0.0318
NP_440261.1_5 Forward -73 -60 6.31247 0.038
NP_440261.1_5 Forward -226 -213 -0.964025 0.0655
NP_440261.1_5 Reverse -8 -21 -2.53732 0.0924
NP_440261.1_5 Forward -388 -375 -4.60227 0.158
NP_440261.1_5 Forward -187 -174 -12.0754 0.27
NP_440988.1_10 Forward -76 -62 7.60958 0.216
NP_440988.1_10 Reverse -242 -256 6.35102 0.232
NP_440988.1_10 Forward -229 -215 6.15739 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CGCAGTTTACGGGGGACGGGCCCCAGTTTGCCCCAGCGCCAACGGGTTCCCCAACGGCAAACCTATACAGGGGAAGTGCTACCGGTGGTTATCCGATTTAGCCAGGGAAATTTAGATCATCTCCAGCAGATGTACGACAACAGCCTTGTCCATTGGCACAATGATTTGGAAACGGCGATCGCCAAGATGCTGAGTTTGATGCCCCAAGAGACGGCATTGGCCCAGGGATAACTGTGGCCATTATTCCCCTAGATTGGCAATGTTTATCTAAGTTGGGGGAGAGCAAATTTTGAGCAAATTCTTGAGCTTTTTCAGCCACCATCCATCCCGATCGCCCCGCATATGGACGGACATACTGCTGCGTTGGCAAGGTTCCGTTATTCCGGCGATCGCCTCCCGG

CDS

GTGCTAGTGTGTATGGCCTTTTCCCTGGGGGTGACCCTGGTGGATGGTTGGGGATATAAATTTTCCATTCCCATCCAGGAGAGCATTGTGCCCAGCATTGTGTTGGGATTGCTGTTAGTGTTTCGCACCAACACCGCCTATGAACGTTTTTGGGAAGGACGCAAAGCTTGGGGCACCATGGTCAACACCATTCGTAACCTCTCTCGGATCATTTGGGTTTCGGTGGCAGAACCCAGTCCCCAAGCCCACCAAGACAAAATTAAAATTCTGCATCTTCTGGTGGCCTTTGCCGTGGCCACAAAGTTACACCTGCGCTCTCAACCCCTAAATGAAGAAATTTGGGCTCTGTTGCCGGAATCCGGTTACCGGAAGCTTGAGGACCTAAATAATCCACCCTTAGAAATCGCCTTTTGGATCAGTAATTATCTGCAACGGGAATACGACCAAAACAATATTAATGCCTATCAGCTCACCGCCATGTTGCGCTTGGTAGACACCATGGTGGATGTGTTGGGCAGTTGCGAACGAATTTTAAAAACCCCCATTCCCCTGGCCTACGCCATCCATTTGCGCCAGCTAATCTTTCTCTATTGCTTCATTACCCCTTTCCAGATTGTGAATACCCTCCATTGGGCCACGGCTTTTGTGGTGGGAATTATCGCTTTCACTGTCTTCGGCATTGAAGAAATTGGAGTGGAGATTGAAAACCCCTTCGGCCACGATGCCAACGATCTGCCCTTAGACCAAATTTGCCAGACTATGCAGGCCAACCTGGAAGATTTAATCCAGTTACCCCCCTGGCACCAGATCTCCCATGGGGACTAG

Protein

MLVCMAFSLGVTLVDGWGYKFSIPIQESIVPSIVLGLLLVFRTNTAYERFWEGRKAWGTMVNTIRNLSRIIWVSVAEPSPQAHQDKIKILHLLVAFAVATKLHLRSQPLNEEIWALLPESGYRKLEDLNNPPLEIAFWISNYLQREYDQNNINAYQLTAMLRLVDTMVDVLGSCERILKTPIPLAYAIHLRQLIFLYCFITPFQIVNTLHWATAFVVGIIAFTVFGIEEIGVEIENPFGHDANDLPLDQICQTMQANLEDLIQLPPWHQISHGD