Your browser is old and dusty. Try Google Chrome!

Details for sll1022

ORF sll1022
Accession NP_440265.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -127 -141 1.86788 0.181
NP_441061.1_2 Reverse -369 -383 0.392915 0.211
NP_441061.1_2 Forward -205 -191 0.196253 0.215
NP_440795.1_7 Forward -134 -127 14.6904 0.0123
NP_440795.1_7 Reverse -127 -134 14.6904 0.0123
NP_441418.1_6 Reverse -92 -111 -28.9099 0.213
NP_441418.1_6 Reverse -126 -145 -29.9915 0.249
NP_442291.1_5 Forward -136 -120 -5.05468 0.296
NP_441453.1_4 Reverse -126 -134 16.6374 0.00633
NP_441453.1_4 Forward -135 -127 16.539 0.00633
NP_441453.1_7 Forward -400 -393 14.1988 0.175
NP_441623.1_1 Reverse -275 -293 -1.84914 0.241
NP_442151.1_6 Forward -135 -121 11.0127 0.109
NP_440561.1_8 Reverse -90 -109 5.60432 0.289
NP_441818.1_1 Forward -134 -123 13.5295 0.0731
NP_441818.1_1 Reverse -127 -138 9.69459 0.232
NP_440226.1_1 Forward -135 -116 8.35759 0.0885
NP_442623.1_3 Forward -134 -115 -10.227 0.176
NP_440996.1_3 Forward -316 -298 9.55725 0.279
NP_442287.1_5 Reverse -97 -107 15.2213 0.218
NP_442173.1_1 Forward -134 -126 17.3257 0.00633
NP_442173.1_1 Reverse -127 -135 15.4574 0.00633
NP_442173.1_1 Reverse -375 -383 4.93597 0.241
NP_442752.1_4 Forward -135 -128 13.8055 0.0199
NP_442752.1_4 Reverse -182 -189 12.4288 0.0388
NP_442752.1_4 Reverse -242 -249 12.1338 0.0546
NP_442752.1_4 Reverse -98 -105 10.5605 0.1
NP_442752.1_4 Forward -145 -138 5.54565 0.194
NP_442752.1_4 Reverse -318 -325 4.95566 0.26
NP_443027.1_4 Forward -137 -127 14.828 0.0437
NP_443027.1_4 Reverse -124 -134 14.6313 0.0452
NP_443027.1_4 Forward -147 -137 7.25653 0.24
NP_442975.1_10 Forward -139 -125 12.9786 0.0459
NP_442975.1_10 Reverse -122 -136 3.14559 0.263
NP_440784.1_7 Forward -134 -127 15.9687 0.0123
NP_440784.1_7 Reverse -127 -134 15.9687 0.0123
NP_440061.1_9 Reverse -372 -386 9.04542 0.154
NP_440061.1_9 Forward -137 -123 7.17714 0.216
NP_441145.1_1 Reverse -125 -144 8.55425 0.254
NP_441476.1_5 Reverse -202 -221 -2.75381 0.231
NP_442062.1_8 Forward -135 -125 17.0896 0.0025
NP_442062.1_8 Reverse -126 -136 16.9913 0.00317
NP_442062.1_8 Forward -145 -135 3.91327 0.243
NP_442062.1_8 Reverse -374 -384 2.83163 0.293
NP_440761.1_4 Reverse -121 -140 -12.3902 0.251
NP_440761.1_4 Forward -388 -369 -20.7484 0.295
NP_441900.1_2 Forward -330 -312 -1.9482 0.273
NP_441900.1_2 Forward -241 -223 -6.66806 0.295
NP_441859.1_3 Forward -136 -117 9.7334 0.125
NP_440304.1_4 Forward -137 -127 10.8948 0.051
NP_440304.1_4 Forward -295 -285 6.07655 0.18
NP_440304.1_4 Forward -385 -375 4.3066 0.271
NP_442242.1_4 Forward -134 -127 14.3954 0.0124
NP_442242.1_4 Reverse -127 -134 14.3954 0.0124
NP_440044.1_8 Forward -134 -115 5.80098 0.0991
NP_440044.1_8 Forward -298 -279 2.45773 0.15
NP_440044.1_8 Reverse -127 -146 -0.39387 0.22
NP_440044.1_8 Forward -382 -363 -1.67217 0.248
NP_441581.1_6 Reverse -127 -146 20.8304 0.186
NP_440916.1_1 Forward -171 -157 11.0127 0.206
NP_441935.1_1 Forward -40 -21 10.9142 0.211
NP_441594.1_6 Reverse -353 -372 0.294447 0.289
NP_442110.1_7 Reverse -126 -140 4.32615 0.203
NP_442110.1_7 Forward -135 -121 0.392915 0.261
NP_442475.1_4 Reverse -337 -356 23.1072 0.0161
NP_441925.1_4 Forward -20 -1 -15.3409 0.263
NP_441925.1_4 Forward -197 -178 -15.5375 0.266
NP_441925.1_4 Forward -199 -180 -16.7175 0.285
NP_441083.1_5 Forward -135 -125 10.5014 0.0197
NP_441083.1_5 Forward -107 -97 5.38824 0.12
NP_441083.1_5 Reverse -126 -136 2.14332 0.195
NP_441434.1_3 Reverse -1 -20 6.4893 0.194
NP_441738.1_2 Reverse -128 -135 15.28 0.0102
NP_441738.1_2 Forward -133 -126 11.5435 0.084
NP_441738.1_4 Reverse -116 -135 15.2408 0.0804
NP_440209.1_1 Forward -135 -127 18.1123 0.00295
NP_440209.1_1 Reverse -126 -134 8.57422 0.0425
NP_442889.1_8 Forward -138 -124 10.9137 0.077
NP_441713.1_1 Reverse -191 -210 -16.1268 0.277
NP_440178.1_7 Forward -136 -117 -14.3569 0.153
NP_441989.1_5 Forward -141 -122 16.9542 0.243
NP_441716.1_1 Forward -135 -121 3.63784 0.259
NP_442111.1_4 Reverse -125 -139 9.43936 0.0609
NP_440343.1_3 Forward -197 -179 6.90155 0.225
NP_440343.1_9 Reverse -88 -107 6.98095 0.292
NP_440906.1_5 Forward -134 -127 15.8704 0.0124
NP_440906.1_5 Reverse -127 -134 15.8704 0.0124
NP_441209.1_8 Reverse -331 -349 9.99242 0.217
NP_440747.1_10 Reverse -123 -135 -2.22263 0.026
NP_440747.1_10 Forward -138 -126 -11.8591 0.161
NP_440322.1_4 Reverse -93 -112 12.1925 0.202
NP_441130.1_10 Forward -137 -123 11.7993 0.106
NP_441486.1_1 Forward -138 -124 14.1593 0.00654
NP_441486.1_1 Reverse -123 -137 10.1277 0.0226
NP_441880.2_10 Reverse -127 -145 11.1305 0.171
NP_441014.1_10 Reverse -125 -144 6.1935 0.175
NP_441014.1_10 Reverse -367 -386 -3.24622 0.297
NP_442848.1_1 Reverse -120 -134 14.2576 0.0211
NP_442848.1_1 Forward -141 -127 6.98109 0.0791
NP_442848.1_1 Forward -383 -369 -4.52363 0.294
NP_441012.1_4 Forward -381 -368 8.9674 0.272
NP_441012.1_4 Forward -139 -126 6.4108 0.279
NP_443018.1_3 Forward -134 -127 14.8871 0.0123
NP_443018.1_3 Reverse -127 -134 14.8871 0.0123
NP_443018.1_3 Reverse -375 -382 10.7572 0.0907
NP_443018.1_3 Forward -382 -375 4.56234 0.241
NP_441634.1_8 Reverse -102 -116 -3.44199 0.295
NP_441634.1_8 Reverse -124 -138 -4.03198 0.295
NP_440376.1_1 Reverse -126 -135 9.73449 0.0365
NP_440376.1_1 Forward -135 -126 9.63616 0.0385
NP_440376.1_1 Forward -206 -197 2.55633 0.218
NP_440376.1_1 Reverse -105 -114 -0.393597 0.289
NP_441857.1_5 Reverse -119 -137 25.1919 0.0163
NP_441588.1_4 Forward -133 -123 9.32148 0.14
NP_441588.1_4 Reverse -128 -138 6.96153 0.178
NP_440266.1_6 Reverse -363 -382 8.75009 0.27
NP_442687.1_7 Forward -136 -126 14.828 0.0247
NP_442687.1_7 Reverse -196 -206 7.25653 0.136
NP_442191.1_4 Reverse -127 -141 15.9379 0.0454
NP_442485.1_3 Forward -338 -319 2.45773 0.209
NP_442485.1_3 Forward -146 -127 -4.81876 0.285
NP_441846.1_10 Reverse -211 -230 -14.9469 0.241
NP_441846.1_10 Reverse -172 -191 -21.1417 0.256
NP_442958.1_3 Forward -394 -375 -0.688862 0.268
NP_441422.1_7 Forward -242 -225 -4.09106 0.238
NP_441422.1_7 Forward -334 -317 -5.76269 0.247
NP_441422.1_7 Forward -137 -120 -8.0243 0.265
NP_440181.1_3 Reverse -312 -331 6.19431 0.29
NP_441950.1_7 Reverse -86 -105 -1.47551 0.194
NP_441763.1_5 Forward -105 -86 -3.54046 0.234
NP_440360.1_10 Reverse -376 -390 2.35953 0.267
NP_442658.1_1 Forward -137 -127 15.9091 0.00966
NP_442658.1_1 Forward -385 -375 14.3359 0.0237
NP_442658.1_1 Reverse -124 -134 8.73102 0.181
NP_442782.1_2 Reverse -2 -16 3.04785 0.269
NP_442205.1_9 Reverse -2 -18 -3.57971 0.287
NP_440656.1_8 Forward -146 -127 -2.75381 0.19
NP_441487.1_6 Reverse -156 -175 -0.295539 0.264
NP_442300.1_5 Reverse -268 -287 20.5506 0.068
NP_442937.1_5 Reverse -93 -112 15.0441 0.0638
NP_441958.1_5 Forward -136 -126 10.9931 0.00875
NP_441958.1_5 Reverse -125 -135 2.53664 0.0409
NP_441958.1_5 Forward -207 -197 -0.609952 0.215
NP_441127.1_1 Forward -377 -363 13.6676 0.175
NP_442836.1_5 Reverse -120 -139 14.2574 0.0588
NP_439905.1_1 Reverse -375 -388 9.55739 0.216
NP_439905.1_1 Forward -22 -9 7.19745 0.264
NP_439990.1_5 Reverse -121 -134 19.3905 0.00775
NP_439990.1_5 Forward -140 -127 10.049 0.128
NP_439990.1_5 Reverse -369 -382 5.42749 0.295
NP_442911.1_2 Reverse -274 -293 4.12936 0.0397
NP_442911.1_2 Reverse -116 -135 -7.57203 0.214
NP_442911.1_2 Reverse -187 -206 -9.24366 0.252
NP_441580.1_6 Reverse -115 -134 2.45773 0.117
NP_441580.1_6 Forward -146 -127 -1.18052 0.186
NP_440153.1_5 Reverse -127 -141 0.786239 0.289
NP_441591.1_10 Forward -147 -128 5.60432 0.295
NP_442064.1_4 Reverse -364 -383 10.4217 0.196
NP_440827.1_3 Forward -146 -127 11.9958 0.262
NP_441099.1_5 Reverse -116 -135 0.196116 0.0825
NP_442002.1_1 Reverse -89 -107 -6.76569 0.249
NP_442002.1_9 Forward -136 -129 10.7572 0.185
NP_441294.1_7 Forward -111 -97 9.25063 0.256
NP_440411.1_10 Reverse -90 -109 9.18818 0.293
NP_442438.1_10 Reverse -121 -135 6.58777 0.113
NP_442431.1_10 Reverse -92 -110 2.87075 0.228
NP_441000.1_6 Forward -136 -122 -5.21195 0.266
NP_440147.1_4 Forward -137 -124 10.7374 0.0355
NP_440147.1_4 Forward -32 -19 2.18257 0.209
NP_441550.1_8 Reverse -124 -134 11.9759 0.0397
NP_441550.1_8 Forward -137 -127 6.0761 0.214
NP_441916.1_7 Reverse -126 -136 19.1546 0.00144
NP_441916.1_7 Forward -135 -125 8.23984 0.0476
NP_441041.1_4 Reverse -126 -145 0.196116 0.0899
NP_441041.1_4 Reverse -2 -21 -4.03212 0.128
NP_441041.1_4 Forward -135 -116 -8.752 0.207
NP_441041.1_4 Forward -383 -364 -12.1936 0.26
NP_441041.1_7 Reverse -123 -135 11.5962 0.0757
NP_441041.1_7 Forward -138 -126 7.61196 0.162
NP_441725.1_5 Reverse -127 -137 11.2881 0.0247
NP_441725.1_5 Reverse -375 -385 5.5849 0.115
NP_441725.1_5 Forward -205 -195 -0.0199663 0.223
NP_441725.1_5 Forward -134 -124 -0.0199663 0.223
NP_439966.1_7 Forward -137 -127 18.4657 0.00473
NP_439966.1_7 Forward -193 -183 10.8943 0.0794
NP_439966.1_7 Reverse -124 -134 6.56775 0.177
NP_439966.1_7 Forward -109 -99 4.99446 0.248
NP_439966.1_9 Forward -137 -128 0.983037 0.253
NP_439966.1_9 Reverse -124 -133 0.884706 0.253
NP_442941.1_3 Reverse -127 -137 11.4848 0.0116
NP_442941.1_3 Forward -134 -124 8.4365 0.0356
NP_440289.1_2 Forward -138 -125 12.0157 0.0171
NP_440289.1_2 Reverse -123 -136 -4.01229 0.276
NP_440983.1_5 Forward -107 -88 5.89931 0.178
NP_440260.1_8 Reverse -89 -107 6.41066 0.154
NP_441514.1_1 Forward -175 -165 13.8676 0.284
NP_441514.1_6 Reverse -1 -8 14.2971 0.248
NP_442281.1_1 Forward -140 -126 7.76712 0.0927
NP_442281.1_1 Reverse -121 -135 7.3738 0.102
NP_442281.1_1 Reverse -192 -206 4.12889 0.206
NP_442575.1_8 Reverse -306 -325 -1.86883 0.232
NP_440437.1_1 Forward -141 -122 4.62101 0.099
NP_440437.1_1 Reverse -130 -149 -4.03212 0.248
NP_443030.1_4 Forward -142 -123 -7.27704 0.294
NP_441644.1_6 Forward -107 -97 9.41933 0.0767
NP_441644.1_6 Forward -135 -125 7.94438 0.113
NP_441644.1_6 Reverse -126 -136 7.74772 0.117
NP_441644.1_6 Reverse -197 -207 5.09279 0.21
NP_441071.1_2 Forward -174 -155 15.708 0.279
NP_442215.1_2 Reverse -124 -140 -4.85801 0.24
NP_440253.1_2 Forward -135 -117 3.06741 0.123
NP_440253.1_2 Reverse -126 -144 2.37909 0.139
NP_440929.1_8 Reverse -126 -135 9.93116 0.0249
NP_440929.1_8 Forward -135 -126 9.83282 0.0254
NP_442933.1_10 Forward -135 -126 17.601 0.00325
NP_442933.1_10 Reverse -126 -135 17.601 0.00325
NP_440430.1_3 Reverse -160 -178 13.7855 0.263
NP_441751.2_8 Reverse -127 -141 -4.13031 0.163
NP_441751.2_8 Forward -205 -191 -6.29359 0.259
NP_442554.1_4 Reverse -221 -240 9.43923 0.277
NP_442554.1_8 Reverse -127 -137 13.8447 0.0145
NP_442554.1_8 Forward -134 -124 8.4365 0.0744
NP_442554.1_8 Forward -382 -372 2.33998 0.274
NP_441586.1_5 Forward -261 -242 4.03102 0.291
NP_441762.1_7 Reverse -125 -137 4.66053 0.0458
NP_441762.1_7 Forward -136 -124 4.36554 0.0504
NP_442142.1_4 Forward -138 -125 14.2767 0.0311
NP_442142.1_4 Reverse -123 -136 7.88518 0.127
NP_442292.1_1 Reverse -127 -136 9.63616 0.0183
NP_442292.1_1 Forward -134 -125 9.53783 0.0183
NP_442292.1_5 Reverse -122 -141 -1.86883 0.272
NP_442476.1_6 Reverse -375 -389 -0.295402 0.294
NP_443009.1_2 Reverse -128 -147 0.786102 0.216
NP_443009.1_5 Reverse -125 -136 14.3161 0.022
NP_441715.1_4 Reverse -127 -137 16.303 0.0117
NP_441715.1_4 Forward -134 -124 6.56821 0.138
NP_440881.1_4 Reverse -148 -167 -0.787193 0.265
NP_440015.1_9 Forward -135 -117 1.29745 0.239
NP_441448.1_1 Forward -394 -375 5.70265 0.261
NP_441198.1_5 Forward -133 -120 12.2117 0.228
NP_441198.1_8 Forward -385 -375 12.783 0.116
NP_441468.1_1 Forward -134 -127 15.8704 0.0124
NP_441468.1_1 Reverse -127 -134 15.8704 0.0124
NP_441468.1_1 Forward -382 -375 4.07068 0.263
NP_441020.2_6 Reverse -124 -141 7.02034 0.245
NP_441673.1_1 Reverse -126 -135 11.1111 0.0121
NP_441673.1_1 Forward -135 -126 11.0128 0.018
NP_440265.1_1 Forward -239 -220 17.7965 0.253
NP_441426.1_3 Forward -108 -89 7.57013 0.281
NP_441826.1_2 Forward -141 -127 11.6026 0.0356
NP_441826.1_2 Reverse -120 -134 4.52282 0.102
NP_441826.1_2 Reverse -197 -211 2.35953 0.129
NP_441826.1_2 Reverse -368 -382 -0.000409212 0.201
NP_442811.1_2 Forward -379 -360 -0.983855 0.252
NP_442868.1_6 Reverse -124 -134 8.63316 0.0555
NP_442868.1_6 Forward -137 -127 0.963343 0.205
NP_442808.1_1 Forward -252 -242 12.4676 0.0481
NP_442808.1_1 Forward -136 -126 8.63269 0.0481
NP_442808.1_1 Forward -108 -98 7.35439 0.0814
NP_442808.1_1 Forward -192 -182 5.48612 0.151
NP_442808.1_1 Reverse -135 -145 4.99446 0.178
NP_442808.1_1 Forward -12 -2 2.92952 0.252
NP_442808.1_1 Forward -102 -92 2.33954 0.27
NP_441101.1_10 Forward -331 -312 7.66927 0.173
NP_442775.1_6 Reverse -121 -140 10.2259 0.277
NP_440145.1_3 Forward -387 -368 1.17943 0.129
NP_440145.1_3 Reverse -116 -135 -4.72043 0.245
NP_442050.1_5 Reverse -124 -134 14.7292 0.0195
NP_442050.1_5 Forward -137 -127 9.12434 0.193
NP_442050.1_8 Reverse -2 -21 14.3768 0.272
NP_441114.1_3 Reverse -376 -385 6.29291 0.285
NP_440558.1_2 Reverse -365 -384 1.86774 0.175
NP_440558.1_2 Forward -387 -368 -0.983855 0.206
NP_441878.1_6 Reverse -125 -135 0.668351 0.139
NP_441878.1_6 Forward -136 -126 0.57002 0.14
NP_441878.1_6 Forward -384 -374 -7.39479 0.222
NP_441036.1_3 Reverse -160 -179 1.76941 0.168
NP_441036.1_8 Forward -136 -126 13.8447 0.0353
NP_441036.1_8 Reverse -125 -135 8.04317 0.177
NP_441036.1_8 Forward -146 -136 6.17489 0.242
NP_441557.1_5 Forward -135 -126 18.6826 0.0015
NP_441557.1_5 Reverse -126 -135 10.5211 0.00695
NP_441557.1_8 Forward -259 -249 13.3526 0.22
NP_441557.1_8 Forward -192 -182 10.3043 0.289
NP_441445.1_1 Forward -144 -125 1.47442 0.255
NP_441445.1_8 Forward -399 -380 -12.7836 0.293
NP_442777.1_3 Reverse -62 -80 1.39504 0.292
NP_441308.1_8 Forward -137 -127 10.1081 0.22
NP_440101.1_3 Forward -217 -198 6.4893 0.181
NP_442183.1_1 Reverse -126 -140 10.4227 0.0845
NP_442397.1_9 Forward -206 -187 4.32602 0.254
NP_441116.1_9 Forward -157 -143 13.0776 0.241
NP_441574.1_1 Reverse -86 -105 8.16093 0.11
NP_441549.1_9 Reverse -100 -118 4.83737 0.0925
NP_441549.1_9 Forward -21 -3 -7.25734 0.206
NP_442347.1_2 Reverse -137 -146 16.421 0.056
NP_442347.1_2 Reverse -127 -136 11.1111 0.056
NP_442347.1_2 Forward -134 -125 2.94966 0.292
NP_441037.1_4 Forward -137 -127 7.02532 0.237
NP_442594.1_8 Reverse -89 -108 18.4857 0.14
NP_442594.1_8 Reverse -90 -109 3.83436 0.279
NP_441633.1_3 Reverse -134 -147 1.19926 0.109
NP_441633.1_3 Forward -137 -124 -3.81562 0.177
NP_441633.1_3 Reverse -124 -137 -6.07724 0.236
NP_442764.1_3 Reverse -317 -327 17.6796 0.295
NP_440136.1_2 Forward -134 -127 15.9687 0.0123
NP_440136.1_2 Reverse -127 -134 15.9687 0.0123
NP_442590.1_10 Reverse -235 -254 4.52268 0.274
NP_442998.1_5 Reverse -160 -170 12.8614 0.158
NP_442998.1_5 Reverse -161 -171 12.7631 0.159
NP_442998.1_5 Forward -81 -71 7.74818 0.284
NP_442998.1_10 Reverse -128 -135 15.5754 0.0102
NP_442998.1_10 Forward -133 -126 5.74231 0.255
NP_440299.1_1 Forward -139 -126 12.0151 0.0427
NP_440299.1_1 Reverse -122 -135 10.1468 0.0597
NP_440299.1_1 Reverse -370 -383 10.0485 0.0615
NP_441799.1_1 Reverse -122 -136 5.40719 0.21
NP_441007.1_10 Forward -388 -375 1.49425 0.203
NP_442334.1_2 Forward -145 -128 -13.5308 0.297
NP_440256.1_1 Reverse -123 -142 -0.688862 0.0954
NP_441229.1_10 Reverse -365 -384 -3.3438 0.288
NP_440456.1_8 Reverse -310 -324 14.7492 0.257
NP_441559.1_8 Reverse -131 -145 12.291 0.0574
NP_441559.1_8 Forward -140 -126 -6.58858 0.279
NP_440915.1_6 Reverse -122 -136 12.1926 0.0218
NP_440915.1_6 Forward -139 -125 -3.04867 0.29
NP_441179.1_9 Reverse -62 -72 10.6976 0.28
NP_440717.1_2 Forward -221 -202 -10.6203 0.251
NP_442866.1_4 Forward -205 -186 11.4058 0.153
NP_442866.1_4 Forward -332 -313 8.16093 0.194
NP_441464.1_10 Reverse -88 -102 12.586 0.201
NP_441464.1_10 Reverse -96 -110 9.63603 0.262
NP_440306.1_8 Forward -349 -330 -1.77127 0.24
NP_440306.1_8 Forward -177 -158 -3.34455 0.281
NP_441199.1_6 Forward -255 -236 2.0644 0.201
NP_441494.1_6 Forward -388 -375 11.7207 0.225
NP_442993.1_1 Reverse -126 -142 1.73016 0.0502
NP_442993.1_1 Reverse -98 -114 0.0585348 0.0668
NP_442993.1_1 Reverse -251 -267 -12.3312 0.27
NP_442386.1_9 Forward -136 -127 15.7322 0.0144
NP_442386.1_9 Reverse -125 -134 14.8472 0.0287
NP_441750.1_1 Reverse -92 -111 -6.49039 0.239
NP_441340.1_5 Forward -134 -127 15.6737 0.0124
NP_441340.1_5 Reverse -127 -134 15.6737 0.0124
NP_441340.1_5 Reverse -375 -382 3.97235 0.274
NP_441271.1_1 Reverse -120 -138 22.1428 0.113
NP_442484.1_2 Reverse -109 -128 -1.96717 0.3
NP_440168.1_4 Forward -111 -92 -6.58872 0.26
NP_440168.1_10 Reverse -224 -243 19.2723 0.224
NP_440059.1_3 Reverse -358 -377 13.7649 0.17
NP_442240.1_1 Forward -247 -228 9.63507 0.216
NP_442240.1_1 Forward -246 -227 3.34192 0.29
NP_442240.1_1 Reverse -366 -385 3.24359 0.293
NP_440586.1_8 Forward -134 -127 13.2151 0.026
NP_440586.1_8 Reverse -127 -134 13.2151 0.026
NP_442251.1_6 Forward -134 -127 15.2804 0.0124
NP_442251.1_6 Reverse -127 -134 15.2804 0.0124
NP_441262.1_3 Forward -135 -128 14.7888 0.0223
NP_441262.1_3 Reverse -126 -133 13.9038 0.0336
NP_440027.1_3 Forward -145 -127 9.75313 0.184
NP_440027.1_3 Forward -107 -89 7.3932 0.211
NP_443051.1_1 Forward -136 -127 10.4228 0.00754
NP_443051.1_1 Reverse -125 -134 1.08137 0.123
NP_439937.1_9 Forward -136 -119 -8.71327 0.177
NP_439937.1_9 Forward -118 -101 -16.1864 0.287
NP_441595.1_5 Reverse -99 -117 6.90232 0.222
NP_440439.1_1 Forward -138 -125 1.88757 0.139
NP_440439.1_1 Forward -209 -196 -1.06236 0.249
NP_439943.1_1 Reverse -92 -111 -6.1954 0.237
NP_440372.1_2 Forward -134 -127 16.3621 0.0124
NP_440372.1_2 Reverse -127 -134 16.3621 0.0124
NP_441789.1_7 Forward -108 -89 8.84842 0.193
NP_441789.1_7 Forward -109 -90 5.01354 0.193
NP_440819.1_5 Reverse -30 -38 15.8507 0.185
NP_440819.1_5 Reverse -159 -167 7.98423 0.228
NP_440819.1_5 Reverse -160 -168 7.68924 0.266
NP_441803.1_2 Forward -140 -121 8.16093 0.12
NP_439977.1_5 Reverse -120 -139 8.55425 0.105
NP_439977.1_5 Forward -141 -122 1.0811 0.196
NP_439977.1_5 Reverse -362 -381 -2.26216 0.273
NP_442384.1_10 Reverse -126 -139 7.88576 0.0727
NP_442384.1_10 Reverse -8 -21 3.95252 0.172
NP_440693.1_8 Reverse -312 -331 19.764 0.193
NP_442114.1_4 Reverse -126 -137 10.3834 0.17
NP_442262.1_10 Forward -134 -127 14.1988 0.0123
NP_442262.1_10 Reverse -127 -134 14.1988 0.0123
NP_442262.1_10 Reverse -375 -382 9.87221 0.164
NP_441689.1_5 Forward -137 -127 8.53436 0.132
NP_441689.1_5 Reverse -124 -134 8.14104 0.151
NP_442244.1_3 Reverse -129 -148 8.75091 0.148
NP_440163.1_10 Forward -138 -128 15.2213 0.0762
NP_440344.1_10 Forward -142 -125 3.0871 0.0274
NP_440344.1_10 Reverse -119 -136 0.92382 0.033
NP_440344.1_10 Forward -152 -135 -12.1542 0.243
NP_440531.1_8 Forward -159 -140 3.44104 0.269
NP_441640.1_8 Forward -134 -115 -3.83545 0.259
NP_440297.1_9 Reverse -127 -137 9.32148 0.0917
NP_440297.1_9 Forward -382 -372 0.865012 0.282
NP_440894.1_2 Reverse -375 -394 -3.24547 0.296
NP_440894.1_10 Forward -140 -121 3.04771 0.279
NP_440894.1_10 Reverse -131 -150 2.85105 0.281
NP_440937.1_5 Reverse -362 -381 11.5042 0.275
NP_440999.1_9 Reverse -122 -136 5.1128 0.113
NP_440999.1_9 Forward -139 -125 4.32615 0.116
NP_440999.1_9 Forward -333 -319 -1.67204 0.246
NP_440888.1_2 Reverse -126 -140 16.3219 0.00724
NP_440888.1_2 Forward -135 -121 15.7319 0.0092
NP_440600.1_4 Reverse -118 -136 -7.65067 0.293
NP_440052.1_5 Forward -233 -214 -5.99873 0.299
NP_442033.1_10 Forward -147 -128 -3.63879 0.171
NP_442033.1_10 Forward -137 -118 -4.52377 0.179
NP_442033.1_10 Reverse -114 -133 -7.27704 0.186
NP_442033.1_10 Reverse -124 -143 -11.8003 0.258
NP_441543.1_2 Reverse -127 -136 18.486 0.00236
NP_441543.1_2 Forward -134 -125 13.8644 0.021
NP_442845.1_2 Reverse -92 -106 8.65272 0.19
NP_442845.1_2 Reverse -120 -134 4.12949 0.267
NP_441319.1_5 Reverse -127 -146 15.6341 0.236
NP_440982.1_1 Forward -107 -88 13.2733 0.141
NP_441469.1_8 Forward -136 -127 16.126 0.00797
NP_442315.1_7 Forward -290 -271 4.22769 0.284
NP_443064.1_6 Forward -251 -241 11.0156 0.13
NP_443064.1_6 Forward -191 -181 10.046 0.181
NP_443064.1_6 Forward -135 -125 8.97947 0.254
NP_442578.1_5 Reverse -113 -132 1.17943 0.262
NP_442578.1_7 Forward -134 -127 14.5921 0.026
NP_442578.1_7 Reverse -127 -134 14.5921 0.026
NP_441462.1_2 Forward -135 -125 10.5998 0.0068
NP_441462.1_2 Reverse -126 -136 1.84832 0.081
NP_441462.1_2 Forward -206 -196 -1.19994 0.291
NP_443062.1_1 Forward -135 -117 12.8362 0.0725
NP_443062.1_1 Reverse -126 -144 11.3736 0.1
NP_441601.1_2 Forward -348 -329 0.884433 0.219
NP_440349.1_3 Reverse -127 -146 18.3865 0.0961
NP_440349.1_3 Forward -134 -115 13.9616 0.222
NP_440349.1_3 Reverse -369 -388 12.29 0.278
NP_440519.1_8 Forward -383 -367 2.8118 0.256
NP_440519.1_8 Reverse -86 -102 1.5335 0.282
NP_442204.1_1 Forward -139 -128 0.353664 0.281
NP_442204.1_5 Forward -145 -126 -0.787193 0.298
NP_441560.1_8 Reverse -121 -140 13.7526 0.205
NP_441560.1_10 Forward -143 -124 10.0292 0.215
NP_441351.1_8 Forward -109 -90 4.42435 0.225
NP_442487.1_5 Reverse -125 -144 12.88 0.18
NP_442872.1_1 Forward -109 -90 -9.34199 0.241
NP_440516.1_8 Forward -135 -126 9.4395 0.0183
NP_440516.1_8 Reverse -126 -135 7.17789 0.0754
NP_440516.1_8 Reverse -197 -206 3.83464 0.124
NP_440516.1_8 Reverse -98 -107 -0.590259 0.283
NP_441785.1_1 Reverse -126 -140 17.6832 0.0724
NP_441785.1_1 Forward -135 -121 12.7383 0.244
NP_442080.1_7 Reverse -265 -284 -2.45882 0.287
NP_442428.1_5 Forward -134 -127 15.8704 0.0124
NP_442428.1_5 Reverse -127 -134 15.8704 0.0124
NP_442428.1_5 Forward -382 -375 4.46401 0.267
NP_440783.1_5 Reverse -232 -251 -5.40875 0.277
NP_442859.1_6 Forward -105 -86 0.686995 0.297
NP_442120.1_10 Forward -135 -116 -11.3086 0.262
NP_442120.1_10 Forward -177 -158 -13.0786 0.28
NP_440673.1_3 Forward -133 -126 14.0021 0.0426
NP_440673.1_3 Reverse -128 -135 12.4288 0.0426
NP_440673.1_3 Reverse -376 -383 10.5605 0.123
NP_440673.1_3 Reverse -370 -377 8.98723 0.203
NP_440673.1_7 Reverse -115 -134 6.39097 0.155
NP_441052.1_2 Forward -135 -125 10.1081 0.0295
NP_441052.1_2 Forward -107 -97 4.60159 0.154
NP_441052.1_2 Reverse -126 -136 2.04498 0.22
NP_442219.1_8 Reverse -88 -107 10.1964 0.21
NP_442219.1_8 Reverse -364 -383 6.91087 0.282
NP_442219.1_8 Forward -111 -92 6.91087 0.282
NP_442219.1_9 Forward -134 -125 18.486 0.00718
NP_442219.1_9 Reverse -127 -136 8.35786 0.0681
NP_440592.1_8 Forward -389 -370 11.0125 0.281
NP_440436.1_4 Reverse -127 -136 18.1905 0.00233
NP_440436.1_4 Forward -134 -125 15.9289 0.00508
NP_440436.1_4 Reverse -375 -384 8.45576 0.105
NP_440436.1_4 Reverse -369 -378 7.76745 0.124
NP_441884.1_8 Forward -136 -117 3.24438 0.0952
NP_441884.1_9 Reverse -226 -245 -21.1417 0.229
NP_441884.1_9 Forward -138 -119 -21.3384 0.242
NP_440314.1_9 Reverse -127 -146 -6.78538 0.231
NP_442907.1_2 Forward -134 -116 8.18062 0.272
NP_441719.1_4 Forward -134 -127 16.3621 0.0124
NP_441719.1_4 Reverse -127 -134 16.3621 0.0124
NP_441733.1_10 Reverse -123 -136 17.8172 0.034
NP_441733.1_10 Forward -148 -135 7.29578 0.156
NP_441733.1_10 Reverse -179 -192 5.62415 0.21
NP_441004.1_1 Reverse -92 -111 -5.99873 0.18
NP_441004.1_1 Reverse -225 -244 -10.1286 0.218
NP_441004.1_1 Forward -389 -370 -15.8318 0.279
NP_441004.1_1 Reverse -226 -245 -17.2085 0.29
NP_441004.1_2 Forward -388 -369 -2.36049 0.264
NP_441004.1_5 Reverse -94 -108 12.7826 0.24
NP_442366.1_3 Reverse -125 -143 -2.3408 0.226
NP_442366.1_3 Forward -136 -118 -4.79907 0.276
NP_440296.1_10 Forward -81 -62 -7.4737 0.238
NP_441115.1_4 Forward -136 -118 17.9146 0.0158
NP_442694.1_4 Reverse -91 -100 12.2911 0.253
NP_442206.1_10 Forward -383 -368 0.864876 0.243
NP_442206.1_10 Forward -135 -120 0.176559 0.269
NP_443054.1_2 Forward -137 -123 2.75286 0.241
NP_442430.1_2 Forward -111 -92 0.786102 0.297
NP_440864.1_9 Forward -229 -210 -3.3438 0.187
NP_441851.1_10 Forward -136 -126 17.188 0.00552
NP_441851.1_10 Reverse -125 -135 6.56821 0.161
NP_441851.1_10 Reverse -373 -383 3.91327 0.296
NP_442856.1_7 Forward -144 -125 -2.85214 0.239
NP_441396.1_5 Reverse -99 -108 8.75118 0.21
NP_441396.1_5 Reverse -175 -184 8.1612 0.224
NP_441683.1_7 Reverse -220 -239 -11.6036 0.284
NP_440165.1_5 Forward -136 -117 -0.4922 0.173
NP_440940.1_7 Forward -145 -127 7.98318 0.193
NP_441349.1_10 Forward -199 -180 -7.57203 0.254
NP_441409.1_8 Forward -103 -84 7.88415 0.277
NP_439960.1_10 Forward -231 -213 -4.30741 0.293
NP_440474.1_8 Forward -376 -362 3.93223 0.296
NP_441596.1_10 Reverse -366 -385 12.3892 0.212
NP_441477.1_6 Reverse -320 -334 19.4691 0.0972
NP_442450.1_5 Forward -137 -127 9.32148 0.115
NP_440195.1_4 Forward -147 -128 21.7306 0.0182
NP_440195.1_4 Reverse -114 -133 5.99764 0.283
NP_440195.1_4 Reverse -9 -28 4.916 0.292
NP_441003.1_3 Forward -103 -84 19.8623 0.169
NP_440483.1_1 Reverse -78 -97 -6.09707 0.24
NP_441570.1_1 Forward -135 -117 -5.97904 0.0767
NP_440078.1_10 Reverse -2 -21 6.78429 0.218
NP_441078.1_4 Reverse -126 -135 9.93116 0.0203
NP_441078.1_4 Forward -135 -126 9.83282 0.0226
NP_442729.1_8 Reverse -122 -135 5.72248 0.233
NP_440526.1_3 Forward -134 -123 10.6779 0.0646
NP_440526.1_3 Reverse -70 -81 7.23633 0.156
NP_440526.1_3 Reverse -127 -138 1.92649 0.267
NP_441432.1_8 Forward -136 -127 8.25953 0.0755
NP_441432.1_8 Reverse -125 -134 7.07956 0.105
NP_441432.1_8 Forward -378 -369 5.40793 0.158
NP_442320.1_8 Forward -141 -127 6.29277 0.029
NP_442320.1_8 Reverse -120 -134 5.99778 0.0309
NP_442344.1_7 Reverse -127 -146 -4.81876 0.168
NP_441732.1_2 Forward -139 -123 -6.92296 0.0558
NP_442003.1_4 Forward -134 -115 14.2574 0.223
NP_440760.1_1 Forward -206 -187 -20.1584 0.221
NP_440760.1_6 Forward -79 -60 14.6508 0.263
NP_442797.1_7 Forward -108 -90 8.08229 0.194
NP_442797.1_7 Forward -334 -316 3.85406 0.234
NP_440199.1_10 Forward -138 -128 14.533 0.0861
NP_440199.1_10 Forward -380 -370 7.25653 0.231
NP_440578.1_8 Reverse -82 -101 12.8808 0.238
NP_441945.1_10 Reverse -85 -104 9.0459 0.273
NP_442751.1_2 Reverse -125 -144 8.55343 0.206
NP_442751.1_2 Reverse -367 -386 7.27514 0.206
NP_440713.1_4 Reverse -116 -135 11.4058 0.115
NP_442489.1_7 Reverse -126 -135 10.4228 0.0151
NP_442489.1_7 Forward -135 -126 10.3245 0.0193
NP_442489.1_7 Forward -206 -197 -1.6719 0.235
NP_442079.1_7 Forward -134 -115 9.14423 0.113
NP_442079.1_7 Reverse -127 -146 0.0977854 0.287
NP_440559.1_1 Forward -134 -125 17.5026 0.00658
NP_440559.1_1 Reverse -127 -136 8.75118 0.0586
NP_441659.2_8 Reverse -126 -136 9.7148 0.0271
NP_441659.2_8 Forward -135 -125 8.53483 0.0412
NP_441659.2_8 Reverse -197 -207 4.99491 0.12
NP_441040.1_2 Reverse -124 -143 -14.7502 0.286
NP_440442.1_10 Forward -259 -242 13.7068 0.273
NP_441800.1_7 Forward -19 -1 -1.94747 0.256
NP_441800.1_7 Forward -106 -88 -2.3408 0.263
NP_442346.1_2 Reverse -312 -331 3.6377 0.293
NP_442346.1_5 Reverse -125 -135 14.533 0.0127
NP_442346.1_5 Forward -384 -374 10.9931 0.078
NP_442346.1_5 Forward -378 -368 10.5014 0.0934
NP_442346.1_5 Forward -136 -126 8.53483 0.133
NP_440545.1_3 Reverse -122 -139 -4.58271 0.229
NP_440545.1_3 Reverse -227 -244 -5.56602 0.253
NP_441856.1_3 Reverse -133 -152 -3.73712 0.299
NP_440831.1_3 Reverse -89 -108 10.3673 0.179
NP_441629.1_1 Forward -143 -124 5.40766 0.299
NP_440010.1_4 Forward -111 -92 1.86696 0.227
NP_440010.1_10 Reverse -86 -105 5.89931 0.226
NP_440847.1_8 Forward -171 -152 12.3892 0.277
NP_442603.1_7 Forward -135 -121 9.93039 0.137
NP_441585.1_5 Forward -181 -162 8.16011 0.211
NP_441888.1_7 Forward -140 -126 3.73617 0.225
NP_441888.1_7 Reverse -369 -383 1.37622 0.253
NP_441050.1_5 Reverse -179 -197 -1.45582 0.264
NP_440449.1_6 Forward -200 -182 6.31057 0.255
NP_441948.1_4 Forward -258 -240 -3.81576 0.207
NP_441948.1_4 Reverse -235 -253 -3.91409 0.21
NP_441833.1_3 Forward -367 -353 16.5192 0.213
NP_441833.1_4 Forward -134 -127 15.9687 0.0124
NP_441833.1_4 Reverse -127 -134 15.9687 0.0124
NP_441895.1_10 Forward -390 -371 -18.1918 0.282
NP_441895.1_10 Reverse -85 -104 -27.5332 0.282
NP_442162.1_9 Forward -134 -127 16.2637 0.0124
NP_442162.1_9 Reverse -127 -134 16.2637 0.0124
NP_440788.1_8 Forward -393 -374 11.1109 0.286
NP_440671.1_4 Forward -141 -127 17.2075 0.0227
NP_440671.1_4 Reverse -368 -382 7.9644 0.205
NP_440671.1_4 Reverse -120 -134 5.01447 0.297
NP_440224.1_1 Reverse -363 -382 -3.44213 0.265
NP_440017.1_3 Reverse -13 -32 6.58763 0.139
NP_442199.1_7 Reverse -297 -316 3.73524 0.245
NP_442140.1_3 Forward -134 -124 13.2547 0.0609
NP_442140.1_3 Reverse -127 -137 8.33817 0.119
NP_440875.1_9 Reverse -138 -148 9.73475 0.233
NP_440875.1_9 Reverse -128 -138 8.37203 0.233
NP_441813.1_3 Reverse -217 -236 14.2373 0.248
NP_441813.1_5 Forward -137 -127 17.188 0.00979
NP_441813.1_5 Reverse -124 -134 7.94484 0.0517
NP_441259.1_8 Forward -104 -85 10.6184 0.271
NP_440590.1_4 Reverse -127 -140 15.0639 0.0106
NP_440590.1_4 Forward -134 -121 13.1956 0.013
NP_440590.1_4 Forward -144 -131 4.05085 0.0642
NP_440567.1_1 Forward -134 -120 0.88457 0.228
NP_440035.1_6 Forward -209 -190 8.65258 0.283
NP_442497.1_10 Reverse -127 -136 10.4228 0.0087
NP_442497.1_10 Forward -134 -125 8.55452 0.0294
NP_440821.1_4 Forward -137 -127 19.0562 0.00399
NP_440821.1_4 Reverse -124 -134 9.22315 0.0334
NP_441239.1_9 Forward -137 -125 9.18376 0.113
NP_441239.1_9 Forward -197 -185 9.08543 0.115
NP_441239.1_9 Reverse -124 -136 8.10212 0.142
NP_441239.1_9 Forward -385 -373 6.43049 0.189
NP_441951.1_9 Forward -246 -227 1.0811 0.254
NP_440706.1_1 Reverse -122 -141 13.3725 0.063
NP_441892.1_1 Reverse -117 -134 7.02034 0.0929
NP_441017.1_6 Forward -381 -367 16.5185 0.0651
NP_441017.1_6 Forward -139 -125 13.8636 0.17
NP_441874.1_1 Reverse -308 -322 17.8958 0.165
NP_442083.1_9 Reverse -241 -260 8.65258 0.283
NP_440354.1_7 Reverse -317 -335 6.60732 0.278
NP_442052.1_8 Forward -385 -375 14.1397 0.253
NP_440546.1_4 Reverse -126 -136 12.6639 0.0641
NP_440546.1_4 Forward -135 -125 11.6943 0.0748
NP_440675.1_3 Forward -318 -299 13.2741 0.161
NP_440462.1_6 Forward -137 -127 15.418 0.0142
NP_440462.1_6 Reverse -124 -134 9.61647 0.0429
NP_440462.1_6 Forward -147 -137 3.22496 0.255
NP_442340.1_3 Reverse -376 -395 -4.52377 0.217
NP_440868.1_4 Forward -139 -127 1.7106 0.174
NP_440868.1_4 Forward -195 -183 0.628964 0.206
NP_442787.1_1 Reverse -141 -160 8.45592 0.248
NP_442402.1_1 Forward -177 -158 10.4225 0.254
NP_442402.1_2 Forward -172 -158 14.4536 0.263
NP_442402.1_4 Forward -246 -227 2.35861 0.165
NP_442402.1_4 Forward -177 -158 -9.73604 0.292
NP_442402.1_10 Forward -339 -329 14.8275 0.18
NP_442402.1_10 Forward -169 -159 12.5659 0.206
NP_441848.1_9 Forward -108 -97 18.741 0.109
NP_440696.1_3 Forward -145 -127 0.609134 0.229
NP_442023.1_1 Forward -104 -85 13.3716 0.285
NP_442039.1_4 Forward -134 -127 15.1821 0.0124
NP_442039.1_4 Reverse -127 -134 15.1821 0.0124
NP_441811.1_8 Forward -389 -375 8.25939 0.238
NP_440825.1_6 Reverse -90 -109 13.7658 0.244
NP_440825.1_7 Forward -134 -124 12.5193 0.155
NP_442837.1_3 Forward -134 -127 15.7721 0.0124
NP_442837.1_3 Reverse -127 -134 15.7721 0.0124
NP_442837.1_3 Reverse -137 -144 6.52896 0.2
NP_442837.1_3 Forward -190 -183 5.74231 0.275
NP_442053.1_1 Forward -135 -126 9.24284 0.068
NP_442053.1_1 Reverse -126 -135 8.94785 0.07
NP_440505.1_3 Forward -137 -127 13.8447 0.0247
NP_440505.1_3 Reverse -124 -134 6.8632 0.169
NP_440505.1_3 Forward -379 -369 4.3066 0.3
NP_441203.1_1 Reverse -127 -146 -12.3902 0.143
NP_441203.1_6 Forward -137 -118 9.14423 0.203
NP_440914.1_1 Forward -383 -373 10.9573 0.116
NP_440914.1_1 Forward -135 -125 8.51751 0.186
NP_440914.1_1 Reverse -126 -136 7.34642 0.241
NP_441011.1_8 Reverse -127 -136 16.9127 0.00602
NP_441011.1_8 Forward -134 -125 9.53783 0.123
NP_441011.1_8 Reverse -99 -108 5.50626 0.256
NP_442533.1_1 Reverse -223 -242 -9.73531 0.229
NP_442533.1_1 Reverse -315 -334 -14.2585 0.241
NP_442533.1_1 Reverse -179 -198 -15.7335 0.257
NP_442533.1_6 Forward -135 -126 15.1427 0.00675
NP_442533.1_6 Reverse -126 -135 7.47288 0.0898
NP_442533.1_6 Forward -107 -98 2.16301 0.27
NP_442541.1_10 Reverse -374 -388 1.27731 0.287
NP_442232.1_3 Reverse -178 -197 3.44104 0.0917
NP_442232.1_3 Reverse -118 -137 -13.5702 0.282
NP_442322.1_4 Forward -107 -90 -9.30325 0.29
NP_441482.1_7 Forward -141 -127 0.786239 0.0554
NP_441482.1_7 Reverse -191 -205 -11.4068 0.262
NP_439944.1_9 Forward -134 -124 17.4829 0.00423
NP_439944.1_9 Reverse -127 -137 10.3048 0.0887
NP_439944.1_9 Forward -382 -372 4.79825 0.296
NP_441028.1_6 Forward -168 -158 12.6642 0.183
NP_441028.1_6 Forward -235 -225 8.23937 0.216
NP_441028.1_6 Forward -338 -328 5.78111 0.243
NP_441028.1_6 Forward -112 -102 5.78111 0.243
NP_441028.1_6 Reverse -151 -161 3.51951 0.292
NP_440116.1_8 Forward -134 -115 19.2723 0.00742
NP_440116.1_8 Reverse -127 -146 17.2074 0.0112
NP_441527.1_7 Forward -233 -214 8.35677 0.284
NP_440115.1_6 Reverse -123 -133 8.53483 0.13
NP_440115.1_6 Forward -386 -376 5.19158 0.265
NP_440007.1_9 Forward -139 -125 4.03116 0.267
NP_440007.1_9 Reverse -314 -328 1.37622 0.285
NP_442492.1_2 Forward -135 -116 0.196116 0.241
NP_441972.1_5 Forward -134 -115 -5.01543 0.213
NP_441106.1_1 Forward -136 -127 18.191 0.0028
NP_441106.1_1 Reverse -125 -134 8.75118 0.0469
NP_440429.1_2 Forward -140 -121 13.6675 0.177
NP_440429.1_2 Reverse -127 -146 7.7676 0.28
NP_439903.1_6 Forward -209 -190 4.03023 0.203
NP_439903.1_6 Reverse -365 -384 -0.689632 0.284
NP_442306.1_10 Forward -298 -279 -21.1417 0.247
NP_441286.1_1 Reverse -125 -137 5.34885 0.0259
NP_441286.1_1 Forward -136 -124 2.89058 0.0512
NP_441286.1_1 Reverse -373 -385 -5.95921 0.235
NP_440670.1_8 Forward -206 -197 12.9794 0.021
NP_440670.1_8 Forward -135 -126 8.94785 0.0606
NP_440670.1_8 Reverse -126 -135 8.84951 0.0606
NP_440886.1_7 Forward -108 -98 15.6142 0.0243
NP_440886.1_7 Forward -136 -126 8.43603 0.0805
NP_442382.1_9 Forward -244 -225 7.66846 0.29
NP_442072.1_9 Forward -136 -118 -23.3836 0.292
NP_442401.1_3 Reverse -242 -261 17.0107 0.175
NP_442022.1_4 Reverse -89 -108 8.35759 0.268
NP_440907.2_8 Forward -134 -124 8.04271 0.117
NP_440907.2_8 Reverse -127 -137 7.84605 0.117
NP_442264.1_2 Forward -387 -370 22.36 0.0261
NP_442264.1_2 Reverse -364 -381 7.512 0.237
NP_441021.1_1 Reverse -375 -394 -6.78538 0.18
NP_441463.1_3 Reverse -364 -383 -6.49039 0.246
NP_441463.1_3 Reverse -116 -135 -10.1286 0.289
NP_441626.1_2 Forward -134 -127 15.7721 0.0124
NP_441626.1_2 Reverse -127 -134 15.7721 0.0124
NP_442794.1_1 Reverse -94 -106 4.5622 0.256
NP_442615.1_1 Forward -144 -126 -6.56903 0.252
NP_441962.1_4 Forward -388 -369 -0.197208 0.117
NP_441962.1_4 Reverse -121 -140 -1.7705 0.125
NP_441962.1_4 Forward -382 -363 -9.44032 0.218
NP_440387.1_1 Reverse -126 -142 -3.48138 0.16
NP_441431.1_2 Forward -138 -124 5.60385 0.294
NP_441431.1_3 Reverse -92 -111 13.9625 0.162
NP_441993.1_1 Reverse -317 -336 0.972113 0.288
NP_440814.1_4 Forward -144 -125 -13.3736 0.285
NP_442698.1_10 Reverse -23 -42 -0.39387 0.297
NP_442733.1_10 Forward -384 -365 19.3707 0.147
NP_440287.1_6 Forward -144 -125 1.47442 0.27
NP_441552.1_3 Reverse -119 -138 14.3549 0.235
NP_441272.1_7 Reverse -92 -102 12.9597 0.287
NP_440766.1_4 Reverse -122 -136 10.7177 0.0853
NP_440766.1_4 Forward -139 -125 9.83269 0.0871
NP_442930.1_1 Forward -171 -161 10.4026 0.276
NP_442930.1_1 Forward -173 -163 9.51767 0.286
NP_439910.1_2 Forward -143 -126 -13.6292 0.162
NP_439910.1_2 Reverse -118 -135 -13.8258 0.163
NP_439910.1_2 Forward -153 -136 -22.5773 0.267
NP_440457.1_1 Forward -139 -127 7.02048 0.105
NP_440457.1_1 Reverse -178 -190 5.44718 0.141
NP_440457.1_1 Reverse -238 -250 -0.74767 0.273
NP_440801.1_8 Forward -108 -89 5.70265 0.192
NP_441984.1_1 Reverse -92 -110 6.60732 0.283
NP_441984.1_3 Reverse -313 -331 9.45892 0.21
NP_441332.1_6 Forward -108 -98 15.3256 0.121
NP_441436.1_8 Reverse -10 -29 10.6192 0.262
NP_442509.1_9 Forward -251 -241 11.2876 0.138
NP_442509.1_9 Reverse -136 -146 6.76441 0.254
NP_442509.1_9 Reverse -126 -136 6.66608 0.259
NP_440554.1_4 Reverse -127 -137 14.6313 0.02
NP_440554.1_4 Forward -134 -124 8.4365 0.0749
NP_441845.1_6 Forward -147 -129 1.78911 0.27
NP_441885.1_5 Forward -135 -125 19.6462 0.00179
NP_441885.1_5 Reverse -126 -136 1.74999 0.0991
NP_442341.1_7 Forward -136 -122 10.521 0.0625
NP_442341.1_7 Reverse -125 -139 10.0294 0.0682
NP_442341.1_7 Forward -31 -17 6.48943 0.126
NP_442341.1_7 Forward -108 -94 6.3911 0.127
NP_442341.1_7 Reverse -135 -149 1.67122 0.282
NP_441756.1_5 Reverse -236 -255 2.26107 0.212
NP_441173.1_9 Forward -167 -159 9.75379 0.284
NP_443000.1_7 Reverse -124 -134 9.7148 0.0437
NP_443000.1_7 Forward -137 -127 8.73149 0.0437
NP_440507.2_3 Forward -144 -125 12.7816 0.145
NP_443059.1_5 Forward -159 -140 12.6841 0.257
NP_440275.1_3 Reverse -124 -134 9.12481 0.055
NP_440275.1_3 Forward -137 -127 8.4365 0.0602
NP_440091.1_1 Reverse -122 -134 13.0187 0.0346
NP_440091.1_1 Forward -139 -127 10.7571 0.0429
NP_443010.1_10 Forward -138 -121 13.8837 0.0663
NP_442451.1_2 Forward -143 -124 -1.47551 0.172
NP_440149.1_8 Forward -377 -358 -6.68705 0.258
NP_441105.1_3 Reverse -115 -134 -1.86883 0.153
NP_440216.1_1 Reverse -126 -140 -11.2101 0.169
NP_440216.1_1 Forward -251 -237 -11.6035 0.203
NP_440172.1_1 Forward -135 -125 17.2863 0.00544
NP_442290.1_9 Reverse -314 -333 11.7992 0.287
NP_442015.1_10 Forward -139 -126 0.805932 0.218
NP_442015.1_10 Reverse -132 -145 0.0192843 0.245
NP_441226.1_7 Forward -134 -127 14.4934 0.0123
NP_441226.1_7 Reverse -127 -134 14.4934 0.0123
NP_441226.1_7 Forward -243 -236 6.82361 0.246
NP_441111.1_7 Reverse -127 -135 18.7023 0.00294
NP_441111.1_7 Forward -134 -126 8.86921 0.0589
NP_440244.1_1 Reverse -227 -246 -4.72043 0.244
NP_441766.1_2 Forward -135 -126 17.896 0.00297
NP_441766.1_2 Reverse -126 -135 9.4395 0.0285
NP_442417.1_5 Reverse -126 -140 4.91614 0.283
NP_440416.1_9 Reverse -367 -386 -17.2085 0.234
NP_443052.1_8 Forward -145 -126 -13.1769 0.276
NP_443052.1_9 Forward -232 -213 -2.85214 0.242
NP_443052.1_9 Reverse -202 -221 -4.42544 0.258
NP_443052.1_9 Reverse -109 -128 -6.88371 0.289
NP_442154.1_1 Reverse -90 -108 -14.6322 0.218
NP_442154.1_1 Reverse -316 -334 -15.4188 0.218
NP_440261.1_5 Reverse -22 -35 -4.7006 0.165
NP_440261.1_5 Reverse -127 -140 -12.3704 0.284
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TCCCTGGGTTAAGTGGGAGCAATGGCAATGGTAGTAACAGCGGAGACATCAATAAATTACTGCTTTCCACCAGTGGCCTCACCCTGCTCAATGGTTTGTTGAATGAAGGCAAACTCAGCACCGTAGTTGACCAGGTTAAATCCCTACTCCAGGATCCCCCGTCGGTTTCCCCCCCTTCTGCTGCTGTCAGTGAAGACGATTGGCCTGACCTCGCTCCCCCCACTGAGACAAATTTTTCCCCGGAGGAAATTTAGCGGGGATCAACGGCGATCGCTACTGATAGGGGGGTAGACCCCCATCACCAAAGCCCCCAATAATGAGGGAAGATGGTATGACTGGAACTAAACCTTGCTGAGTCCTGGTTTTTCCGGTCTATCTCTGCAGGCCTCCACCTTCCCCT

CDS

GTGTCCATGTTTGACTTCGATCTACTATTCAACTCGTCCTTTGCTGTTGTCCTCAAAATCCCATTGACGTTGCTAGTGTTAATTGCCCTTGAGGCAGTGCTATCGGCGGATAATGCCATTGCCCTAGCCGCCATCGCCCAGGGTTTACCCAATCCGGACCAGCAACGACGAGCTTTGAACGCAGGGTTAGTCATTGCCTATGTGCTTAGGGTTCTGTTGATTATCAGTGCTTCCTTTGTGTTGCAATATTGGCAGTTTGAGTTGGCGGGGGCATTGTACCTGCTCTGGCTGGTGGGGAGTTATTTTTTGTCTCCCGATGAAGGGGAAAATCATCATAAGGCTTTTGAGTTTAGTTCCTTTTGGCAAGCGATCCCCCTGATTGCCTTCACCGATTTAGCCTTTTCCCTCGATAGTGTCACTACGGCGATCGCCGTGGCGGATCAGTTATGGCTGATTATTGTGGGGGGCACCATTGGGGTGATTGCCCTCAGGTTTTTAGCGGGTTTATTTATTCGTTGGTTAGAGATTTTTACCCGCCTCAAAGATGCTGGTTTTATCACAGTGGGGTTAGTGGGTCTGCGCCTACTGCTCAGAGTCATTAACCCTGAGTTAGTGCCGCCACAATTGTTGATGATCGTCATAATTGGGCTACTGTTTGCTTGGGGCTTTTCGGAGCGACGTCCATCGGAGCTAGTGGAAGAAATTGTCCATAGCGGCGAACAGAAGTAA

Protein

MSMFDFDLLFNSSFAVVLKIPLTLLVLIALEAVLSADNAIALAAIAQGLPNPDQQRRALNAGLVIAYVLRVLLIISASFVLQYWQFELAGALYLLWLVGSYFLSPDEGENHHKAFEFSSFWQAIPLIAFTDLAFSLDSVTTAIAVADQLWLIIVGGTIGVIALRFLAGLFIRWLEIFTRLKDAGFITVGLVGLRLLLRVINPELVPPQLLMIVIIGLLFAWGFSERRPSELVEEIVHSGEQK