Your browser is old and dusty. Try Google Chrome!

Details for sll1020

ORF sll1020
Accession NP_440267.1
Symbol
Category Other
Definition probable glycosyltransferase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -152 -138 -0.983719 0.246
NP_441061.1_3 Forward -210 -191 15.4366 0.202
NP_440557.1_1 Reverse -254 -273 -1.18052 0.27
NP_440795.1_7 Reverse -145 -152 11.3472 0.0978
NP_440795.1_7 Reverse -217 -224 6.92228 0.26
NP_440694.1_6 Forward -321 -302 5.60432 0.241
NP_441418.1_6 Reverse -204 -223 -11.0136 0.043
NP_441418.1_6 Forward -153 -134 -13.0786 0.073
NP_441418.1_6 Reverse -116 -135 -28.1232 0.203
NP_441418.1_6 Reverse -135 -154 -29.4015 0.224
NP_441694.1_8 Forward -270 -251 0.491109 0.192
NP_442291.1_5 Reverse -143 -159 -4.75968 0.283
NP_441453.1_4 Reverse -144 -152 7.19758 0.0757
NP_441453.1_4 Forward -153 -145 4.93597 0.224
NP_441623.1_1 Forward -220 -202 -0.472507 0.23
NP_442151.1_6 Forward -345 -331 9.2427 0.155
NP_442838.1_7 Reverse -111 -130 -11.4069 0.277
NP_441818.1_6 Reverse -137 -151 12.9793 0.212
NP_441818.1_9 Reverse -204 -223 -10.3253 0.292
NP_440226.1_1 Reverse -144 -163 10.9142 0.0579
NP_440226.1_1 Forward -153 -134 5.211 0.163
NP_441098.1_3 Reverse -84 -103 -3.43933 0.28
NP_441098.1_3 Forward -114 -95 -5.83193 0.28
NP_440996.1_3 Reverse -214 -232 9.65558 0.279
NP_442655.1_10 Reverse -344 -363 -11.5053 0.249
NP_442173.1_1 Forward -152 -144 5.62429 0.206
NP_442173.1_1 Forward -329 -321 5.0343 0.24
NP_442173.1_1 Reverse -145 -153 4.73931 0.258
NP_442752.1_4 Reverse -144 -151 10.8555 0.0846
NP_442752.1_4 Reverse -116 -123 6.23397 0.161
NP_443027.1_4 Forward -155 -145 10.5014 0.128
NP_443027.1_4 Reverse -142 -152 10.2065 0.138
NP_443027.1_4 Forward -127 -117 5.97822 0.294
NP_442975.1_10 Reverse -140 -154 7.86545 0.116
NP_441225.1_4 Forward -157 -138 -12.0953 0.284
NP_440784.1_7 Forward -152 -145 12.4288 0.0475
NP_440784.1_7 Reverse -145 -152 6.23397 0.241
NP_441967.1_4 Reverse -231 -250 19.469 0.222
NP_440061.1_9 Forward -155 -141 7.3738 0.209
NP_440061.1_9 Forward -346 -332 5.1122 0.294
NP_442074.1_5 Forward -323 -304 14.0608 0.29
NP_439979.1_9 Reverse -193 -211 12.0155 0.227
NP_442062.1_8 Forward -262 -252 7.94484 0.0848
NP_442062.1_8 Reverse -116 -126 6.66654 0.119
NP_442062.1_8 Forward -153 -143 6.56821 0.123
NP_442062.1_8 Reverse -321 -331 3.22496 0.279
NP_441859.1_2 Forward -215 -196 11.2084 0.219
NP_440304.1_4 Reverse -142 -152 8.23984 0.0845
NP_440304.1_4 Reverse -202 -212 4.3066 0.271
NP_440304.1_4 Reverse -334 -344 4.20827 0.272
NP_440304.1_4 Forward -332 -322 4.0116 0.281
NP_440304.1_4 Forward -369 -359 2.14332 0.299
NP_440304.1_10 Forward -152 -134 17.9154 0.138
NP_440044.1_8 Forward -152 -133 7.37428 0.0842
NP_440011.1_3 Reverse -247 -265 9.16393 0.257
NP_439918.1_2 Reverse -205 -224 -2.26216 0.242
NP_439918.1_2 Reverse -341 -360 -2.85214 0.249
NP_441200.1_3 Reverse -341 -360 12.2908 0.174
NP_441200.1_4 Reverse -126 -145 8.25926 0.257
NP_440307.1_10 Reverse -56 -75 12.3892 0.266
NP_441594.1_6 Reverse -210 -229 3.34271 0.231
NP_440370.1_10 Reverse -135 -154 16.4207 0.0713
NP_442276.1_2 Reverse -323 -342 3.6377 0.299
NP_442110.1_7 Reverse -321 -335 0.982901 0.241
NP_442110.1_7 Reverse -315 -329 0.982901 0.241
NP_441925.1_4 Forward -220 -201 3.14526 0.155
NP_441925.1_4 Forward -229 -210 -5.80282 0.181
NP_441925.1_4 Forward -366 -347 -16.6192 0.284
NP_440769.1_8 Reverse -45 -64 9.3409 0.214
NP_440856.1_7 Reverse -204 -223 -5.80207 0.233
NP_441083.1_5 Forward -255 -245 3.81494 0.164
NP_441434.1_1 Forward -61 -47 10.0383 0.233
NP_441558.1_5 Reverse -202 -221 5.40766 0.251
NP_441942.1_7 Reverse -332 -351 9.93088 0.299
NP_440209.1_1 Reverse -144 -152 8.37755 0.0576
NP_442889.1_1 Forward -350 -331 -15.7335 0.298
NP_442889.1_8 Reverse -312 -326 4.91554 0.247
NP_441713.1_1 Reverse -197 -216 -12.3902 0.244
NP_441163.1_1 Reverse -127 -144 6.42963 0.257
NP_441163.1_8 Reverse -300 -314 17.6985 0.246
NP_440343.1_9 Forward -339 -320 7.37428 0.279
NP_440906.1_5 Reverse -145 -152 6.23397 0.234
NP_440906.1_5 Forward -152 -145 6.0373 0.262
NP_440747.1_10 Forward -156 -144 -2.51763 0.0509
NP_441130.1_10 Reverse -142 -156 8.55439 0.134
NP_442634.1_4 Reverse -142 -156 4.71948 0.0751
NP_441265.1_3 Forward -336 -322 5.21113 0.181
NP_440403.1_8 Forward -137 -118 22.6156 0.0151
NP_440403.1_10 Forward -216 -197 7.27595 0.208
NP_442848.1_1 Reverse -138 -152 -2.55701 0.263
NP_442848.1_5 Reverse -314 -332 -3.32411 0.291
NP_441012.1_4 Forward -151 -138 10.2457 0.263
NP_443018.1_3 Reverse -145 -152 13.8055 0.024
NP_443018.1_3 Forward -152 -145 13.6088 0.0352
NP_443018.1_3 Forward -212 -205 7.6106 0.156
NP_441316.1_7 Reverse -142 -157 2.8315 0.153
NP_441634.1_8 Forward -155 -141 12.9793 0.0465
NP_440376.1_1 Reverse -144 -153 6.48957 0.0963
NP_440376.1_1 Forward -153 -144 -0.196935 0.285
NP_442485.1_3 Reverse -133 -152 0.0977854 0.247
NP_442485.1_3 Forward -155 -136 -4.13045 0.278
NP_442485.1_3 Forward -227 -208 -4.42544 0.28
NP_441846.1_10 Reverse -204 -223 -12.8819 0.197
NP_441846.1_10 Reverse -202 -221 -20.1584 0.256
NP_441846.1_10 Reverse -203 -222 -20.8467 0.256
NP_440781.1_1 Reverse -178 -192 11.111 0.293
NP_440642.1_10 Reverse -363 -377 5.21053 0.241
NP_440667.1_2 Reverse -219 -238 -1.18052 0.23
NP_441763.1_4 Forward -206 -187 16.6174 0.0999
NP_442658.1_1 Reverse -142 -152 17.8758 0.00565
NP_442658.1_1 Reverse -133 -143 13.1559 0.04
NP_442658.1_1 Reverse -334 -344 5.58445 0.262
NP_442658.1_1 Reverse -202 -212 5.48612 0.265
NP_442658.1_1 Reverse -251 -261 5.09279 0.284
NP_442658.1_1 Forward -332 -322 4.99446 0.288
NP_440446.1_8 Reverse -231 -250 10.3242 0.226
NP_440141.1_8 Reverse -195 -214 8.25926 0.23
NP_440141.1_8 Reverse -327 -346 6.98095 0.251
NP_440141.1_8 Reverse -135 -154 6.68596 0.254
NP_442782.1_2 Reverse -144 -158 7.66941 0.202
NP_442782.1_2 Reverse -342 -356 3.8345 0.261
NP_441487.1_9 Reverse -143 -162 -2.16383 0.293
NP_441478.1_10 Forward -147 -129 9.85146 0.197
NP_441958.1_5 Forward -154 -144 1.55333 0.095
NP_441958.1_5 Reverse -143 -153 -6.60814 0.283
NP_441127.1_1 Reverse -327 -341 8.25939 0.3
NP_441127.1_1 Reverse -204 -218 8.25939 0.3
NP_440203.1_5 Forward -210 -200 12.7626 0.138
NP_439905.1_1 Forward -212 -199 8.18076 0.236
NP_441162.1_3 Reverse -323 -342 10.8159 0.211
NP_441338.2_5 Reverse -218 -237 1.86774 0.299
NP_442690.1_1 Forward -76 -57 -8.94866 0.19
NP_441580.1_6 Reverse -133 -152 -5.50708 0.235
NP_440153.1_5 Forward -152 -138 9.04604 0.127
NP_440153.1_5 Reverse -145 -159 0.687908 0.291
NP_440153.1_8 Forward -225 -212 -2.24233 0.235
NP_440153.1_8 Forward -153 -140 -3.61896 0.296
NP_441591.1_10 Reverse -114 -133 5.211 0.297
NP_443055.1_3 Reverse -135 -154 10.6451 0.284
NP_443055.1_6 Reverse -321 -339 3.45998 0.196
NP_440993.1_2 Forward -158 -142 4.0901 0.256
NP_441129.1_8 Forward -208 -189 9.93088 0.296
NP_442438.1_10 Forward -281 -267 0.589577 0.221
NP_442431.1_10 Reverse -138 -156 4.34571 0.206
NP_442431.1_10 Reverse -347 -365 3.65739 0.213
NP_441000.1_6 Forward -154 -140 -4.7203 0.251
NP_441000.1_6 Forward -126 -112 -5.11362 0.261
NP_441000.1_6 Reverse -143 -157 -5.60527 0.285
NP_440147.1_4 Forward -155 -142 6.70579 0.0856
NP_441550.1_8 Forward -155 -145 9.41933 0.0964
NP_441916.1_7 Reverse -144 -154 6.8632 0.0816
NP_440206.1_4 Forward -355 -336 8.16011 0.209
NP_440206.1_4 Reverse -182 -201 3.73524 0.273
NP_441041.1_4 Reverse -330 -349 -6.29373 0.166
NP_441041.1_4 Reverse -138 -157 -12.9802 0.278
NP_441041.1_7 Forward -333 -321 7.61196 0.162
NP_441041.1_9 Reverse -49 -63 19.2718 0.164
NP_441725.1_5 Forward -152 -142 6.46988 0.114
NP_441725.1_5 Reverse -322 -332 6.37155 0.115
NP_441725.1_5 Forward -344 -334 4.89658 0.115
NP_441725.1_5 Forward -212 -202 4.79825 0.115
NP_439966.1_7 Forward -155 -145 8.14104 0.14
NP_439966.1_7 Reverse -142 -152 7.74772 0.15
NP_439966.1_7 Forward -127 -117 4.01116 0.295
NP_439966.1_9 Reverse -142 -151 1.1797 0.253
NP_439966.1_9 Reverse -114 -123 1.1797 0.253
NP_442941.1_3 Reverse -145 -155 0.0783647 0.231
NP_440260.1_8 Reverse -189 -207 -7.15901 0.295
NP_442281.1_1 Forward -158 -144 5.89884 0.142
NP_442281.1_1 Reverse -139 -153 5.50552 0.155
NP_442281.1_1 Reverse -111 -125 2.26061 0.272
NP_441079.1_1 Reverse -203 -222 16.5191 0.211
NP_440437.1_1 Forward -131 -112 12.3892 0.0354
NP_440437.1_1 Forward -159 -140 3.34271 0.123
NP_442500.1_9 Reverse -301 -320 15.9291 0.212
NP_442012.1_1 Forward -219 -200 -1.67217 0.294
NP_442012.1_5 Reverse -128 -147 -1.18052 0.288
NP_441087.1_6 Forward -221 -203 -0.276578 0.258
NP_441457.1_7 Reverse -202 -221 4.71934 0.206
NP_441457.1_7 Forward -155 -136 -1.08219 0.293
NP_440498.1_1 Forward -162 -144 -3.32411 0.261
NP_442982.1_5 Forward -163 -144 7.57094 0.123
NP_443030.1_4 Reverse -329 -348 -0.590531 0.222
NP_441644.1_6 Reverse -144 -154 14.9258 0.00847
NP_441644.1_6 Forward -213 -203 7.0594 0.137
NP_441644.1_6 Reverse -336 -346 3.61784 0.272
NP_440867.1_10 Forward -222 -203 8.94757 0.25
NP_442029.1_6 Reverse -316 -335 3.34271 0.282
NP_442029.1_10 Forward -186 -167 8.16093 0.25
NP_440929.1_8 Reverse -144 -153 7.66954 0.0624
NP_440929.1_8 Forward -153 -144 7.57121 0.0706
NP_442933.1_10 Reverse -144 -153 5.70292 0.165
NP_440382.1_2 Forward -61 -42 8.4551 0.214
NP_442554.1_8 Forward -152 -142 14.9263 0.0101
NP_442554.1_8 Reverse -145 -155 12.8614 0.0216
NP_442554.1_8 Forward -344 -334 4.3066 0.189
NP_441762.1_7 Forward -226 -214 -4.38592 0.171
NP_441762.1_7 Forward -154 -142 -4.77924 0.182
NP_441762.1_7 Reverse -134 -146 -5.27089 0.195
NP_441762.1_7 Forward -126 -114 -5.56589 0.217
NP_441762.1_7 Reverse -203 -215 -6.15587 0.276
NP_442313.1_5 Forward -329 -310 11.4058 0.185
NP_442142.1_4 Forward -156 -143 8.2785 0.118
NP_442142.1_4 Forward -147 -134 7.09854 0.148
NP_442142.1_9 Forward -151 -132 5.30933 0.282
NP_442292.1_1 Reverse -145 -154 7.17789 0.0777
NP_442292.1_1 Forward -152 -143 6.68623 0.0953
NP_442292.1_5 Reverse -355 -374 0.982764 0.257
NP_440919.1_1 Reverse -215 -234 2.45773 0.221
NP_441899.1_6 Reverse -141 -160 22.8122 0.0529
NP_442476.1_6 Forward -152 -138 1.47456 0.214
NP_443009.1_5 Forward -154 -143 7.92465 0.118
NP_443009.1_5 Reverse -320 -331 5.66304 0.193
NP_441865.1_3 Reverse -272 -290 14.0805 0.242
NP_440881.1_4 Reverse -122 -141 -0.787193 0.265
NP_440183.1_9 Forward -151 -132 -11.0136 0.247
NP_441198.1_8 Forward -332 -322 11.0251 0.228
NP_440379.1_5 Forward -153 -134 -8.55534 0.253
NP_440379.1_5 Reverse -332 -351 -10.4236 0.28
NP_441468.1_1 Reverse -145 -152 13.8055 0.0242
NP_441468.1_1 Forward -152 -145 6.0373 0.223
NP_441020.2_6 Reverse -133 -150 8.98696 0.182
NP_441020.2_6 Reverse -237 -254 6.23369 0.27
NP_441020.2_6 Reverse -142 -159 6.23369 0.27
NP_441015.1_10 Reverse -199 -218 0.491109 0.165
NP_441015.1_10 Reverse -208 -227 -9.73531 0.282
NP_441015.1_10 Reverse -123 -142 -10.1286 0.283
NP_441673.1_1 Reverse -144 -153 1.37636 0.114
NP_441673.1_1 Forward -153 -144 1.1797 0.163
NP_441731.1_3 Forward -353 -334 0.884433 0.24
NP_441876.1_9 Forward -340 -330 11.091 0.28
NP_441826.1_2 Reverse -138 -152 -2.06536 0.264
NP_441826.1_2 Forward -219 -205 -2.16369 0.267
NP_441826.1_5 Forward -212 -193 1.27776 0.294
NP_443004.2_2 Forward -78 -59 19.453 0.132
NP_441330.1_1 Forward -158 -139 -13.1769 0.183
NP_442227.1_2 Forward -151 -132 1.17943 0.25
NP_442227.1_2 Forward -223 -204 0.491109 0.252
NP_442227.1_2 Forward -220 -201 -2.75381 0.28
NP_442427.1_8 Reverse -230 -249 4.916 0.288
NP_442808.1_1 Forward -214 -204 7.55106 0.0756
NP_441101.1_10 Forward -220 -201 1.76941 0.173
NP_441315.1_2 Reverse -134 -152 18.7566 0.137
NP_440145.1_3 Forward -163 -144 -6.09707 0.288
NP_442542.1_2 Forward -332 -319 5.03416 0.288
NP_442542.1_2 Reverse -334 -347 4.93583 0.29
NP_442542.1_9 Reverse -137 -151 4.42388 0.297
NP_442113.1_10 Forward -148 -129 -7.4737 0.269
NP_442050.1_1 Reverse -209 -228 13.6675 0.187
NP_442050.1_1 Reverse -200 -219 11.5042 0.233
NP_440342.1_1 Reverse -207 -226 14.3558 0.192
NP_442747.1_1 Reverse -199 -218 -15.9302 0.236
NP_441114.1_3 Forward -211 -202 7.57121 0.231
NP_440558.1_2 Forward -216 -197 4.916 0.147
NP_440558.1_2 Reverse -332 -351 1.57275 0.178
NP_440558.1_2 Forward -333 -314 -1.96717 0.22
NP_440558.1_2 Forward -348 -329 -3.24547 0.234
NP_440558.1_2 Forward -162 -143 -6.98204 0.284
NP_441518.1_3 Reverse -134 -153 -6.49039 0.138
NP_441878.1_6 Reverse -143 -153 1.65166 0.0795
NP_441878.1_6 Forward -154 -144 -0.314959 0.174
NP_441878.1_6 Reverse -203 -213 -7.39479 0.222
NP_441878.1_6 Reverse -335 -345 -7.49312 0.231
NP_441036.1_8 Reverse -115 -125 5.5849 0.271
NP_441557.1_5 Forward -153 -144 7.57121 0.049
NP_441557.1_5 Reverse -144 -153 1.08137 0.0794
NP_441590.1_4 Forward -220 -201 7.17681 0.25
NP_442777.1_1 Forward -220 -201 6.09517 0.27
NP_442419.1_2 Forward -158 -139 -2.95047 0.247
NP_441308.1_8 Reverse -238 -248 12.1731 0.22
NP_441574.1_1 Reverse -132 -151 0.196116 0.196
NP_441574.1_1 Reverse -309 -328 -7.96535 0.3
NP_441238.1_10 Reverse -158 -172 12.291 0.292
NP_442347.1_2 Forward -124 -115 4.42462 0.284
NP_441037.1_4 Reverse -142 -152 15.0168 0.028
NP_442594.1_8 Reverse -202 -221 11.4058 0.167
NP_441633.1_3 Forward -155 -142 6.01747 0.0481
NP_441633.1_3 Forward -127 -114 -4.20895 0.185
NP_441633.1_3 Forward -347 -334 -4.30728 0.191
NP_441633.1_3 Reverse -319 -332 -5.19226 0.229
NP_440136.1_2 Reverse -145 -152 6.52896 0.116
NP_440136.1_2 Forward -152 -145 6.13563 0.193
NP_442590.1_10 Forward -219 -200 8.94757 0.203
NP_442998.1_10 Forward -151 -144 6.13563 0.181
NP_442998.1_10 Forward -123 -116 5.74231 0.255
NP_440899.1_8 Forward -84 -65 -10.1286 0.277
NP_441799.1_1 Forward -157 -143 8.06211 0.125
NP_441007.1_10 Reverse -139 -152 1.00259 0.209
NP_442333.2_7 Forward -127 -108 4.32602 0.152
NP_440256.1_1 Forward -156 -137 7.7676 0.0248
NP_440256.1_1 Forward -348 -329 -3.14714 0.127
NP_441957.1_10 Reverse -292 -311 18.6823 0.14
NP_442007.1_1 Reverse -152 -171 13.0775 0.217
NP_441559.1_8 Forward -148 -134 -4.4253 0.223
NP_441559.1_8 Forward -349 -335 -7.08024 0.283
NP_441559.1_8 Forward -217 -203 -7.37523 0.291
NP_440915.1_6 Reverse -140 -154 -3.04867 0.29
NP_441296.1_7 Reverse -132 -151 14.1591 0.267
NP_440717.1_1 Forward -212 -193 11.9958 0.199
NP_440319.1_5 Reverse -321 -340 16.4199 0.265
NP_442866.1_1 Forward -218 -199 -8.26035 0.279
NP_440748.1_1 Forward -334 -315 11.9958 0.285
NP_440026.1_7 Forward -158 -143 18.4661 0.133
NP_441494.1_6 Forward -335 -322 10.344 0.227
NP_442386.1_9 Reverse -143 -152 13.6673 0.034
NP_442386.1_9 Reverse -134 -143 7.86578 0.215
NP_442386.1_9 Reverse -252 -261 5.89917 0.233
NP_442386.1_9 Reverse -215 -224 4.62087 0.294
NP_442386.1_10 Reverse -211 -224 4.14919 0.265
NP_440570.1_5 Forward -354 -335 2.16274 0.234
NP_441750.1_4 Forward -156 -137 7.86593 0.159
NP_441340.1_5 Forward -152 -145 13.5105 0.0314
NP_441340.1_5 Reverse -145 -152 6.23397 0.132
NP_442327.1_3 Forward -64 -45 4.53544 0.283
NP_442791.1_5 Reverse -199 -218 -5.60541 0.279
NP_440168.1_4 Reverse -325 -344 -6.68705 0.26
NP_440168.1_8 Forward -150 -131 4.62101 0.22
NP_440168.1_9 Reverse -133 -152 -2.0655 0.28
NP_440168.1_9 Forward -346 -327 -4.22878 0.296
NP_440327.1_6 Forward -356 -337 2.16274 0.299
NP_442240.1_1 Forward -221 -202 6.98015 0.256
NP_440586.1_8 Forward -152 -145 11.3468 0.0736
NP_440586.1_8 Reverse -145 -152 9.47853 0.146
NP_440192.1_5 Reverse -352 -371 3.73603 0.271
NP_441262.1_3 Reverse -144 -151 5.25066 0.215
NP_440027.1_3 Forward -229 -211 9.55647 0.184
NP_440027.1_3 Reverse -134 -152 7.29487 0.211
NP_443051.1_1 Forward -154 -145 7.66954 0.0571
NP_443051.1_1 Reverse -143 -152 0.688044 0.134
NP_439937.1_8 Reverse -130 -149 1.0811 0.231
NP_439937.1_8 Reverse -133 -152 -5.60541 0.299
NP_439937.1_9 Forward -214 -197 14.3944 0.0317
NP_439937.1_9 Forward -145 -128 -3.69841 0.157
NP_442294.1_3 Forward -317 -303 12.5853 0.282
NP_440439.1_1 Reverse -141 -154 0.904263 0.168
NP_440439.1_1 Forward -156 -143 -1.55401 0.273
NP_440372.1_2 Reverse -145 -152 6.62729 0.151
NP_440372.1_2 Forward -152 -145 6.52896 0.188
NP_440171.1_3 Reverse -200 -219 9.73422 0.237
NP_441789.1_7 Forward -221 -202 1.6703 0.245
NP_441789.1_7 Forward -211 -192 -0.0996487 0.251
NP_440819.1_5 Reverse -168 -176 7.98423 0.228
NP_440819.1_5 Reverse -302 -310 7.59091 0.272
NP_440316.1_10 Reverse -203 -213 16.9913 0.153
NP_441803.1_2 Forward -152 -133 8.16093 0.12
NP_441572.1_7 Reverse -110 -129 -4.32711 0.232
NP_440267.1_1 Forward -54 -38 22.4474 0.0334
NP_440267.1_2 Forward -158 -144 18.9768 0.0237
NP_442339.1_3 Forward -64 -46 22.4386 0.0594
NP_442114.1_4 Forward -153 -142 8.61347 0.197
NP_442790.1_3 Forward -152 -133 9.63589 0.203
NP_442262.1_10 Reverse -145 -152 13.0188 0.0314
NP_442262.1_10 Forward -152 -145 11.6422 0.092
NP_442262.1_10 Reverse -117 -124 9.38056 0.202
NP_442262.1_10 Forward -212 -205 8.8889 0.219
NP_440344.1_10 Forward -132 -115 -11.7609 0.227
NP_440531.1_8 Reverse -202 -221 3.93269 0.269
NP_442910.1_6 Forward -143 -129 17.9942 0.0692
NP_442102.1_3 Reverse -325 -344 12.2908 0.252
NP_442556.1_10 Forward -309 -290 10.7406 0.256
NP_440297.1_9 Forward -152 -142 0.0783647 0.282
NP_440297.1_9 Reverse -145 -155 -0.216628 0.282
NP_440894.1_7 Forward -263 -244 8.16011 0.287
YP_680420.1_10 Reverse -139 -158 13.9625 0.274
NP_442067.1_4 Forward -155 -136 11.2092 0.132
NP_440999.1_9 Forward -217 -203 -2.45868 0.27
NP_440888.1_2 Forward -144 -130 11.307 0.0705
NP_440888.1_2 Forward -213 -199 6.0955 0.249
NP_440888.1_2 Forward -153 -139 5.70218 0.267
NP_439969.1_3 Reverse -139 -158 0.196116 0.268
NP_441748.1_3 Forward -81 -62 11.8401 0.273
NP_442033.1_10 Forward -215 -196 1.47442 0.0882
NP_442033.1_10 Reverse -142 -161 -10.1286 0.228
NP_441538.1_2 Reverse -111 -130 14.7221 0.275
NP_441917.1_2 Reverse -339 -357 7.19731 0.288
NP_441543.1_2 Forward -152 -143 16.2243 0.00518
NP_441543.1_2 Forward -323 -314 4.42462 0.246
NP_442845.1_2 Forward -255 -241 3.8345 0.275
NP_441551.1_5 Reverse -140 -156 10.2842 0.193
NP_441469.1_8 Reverse -143 -152 14.946 0.0277
NP_441469.1_8 Forward -154 -145 5.70292 0.257
NP_443064.1_8 Forward -191 -181 17.1874 0.189
NP_441306.1_10 Reverse -205 -219 16.2235 0.247
NP_442578.1_5 Forward -145 -126 9.83255 0.227
NP_442286.1_1 Forward -153 -134 7.96426 0.285
NP_441462.1_2 Reverse -144 -154 1.65166 0.0831
NP_441621.1_7 Reverse -133 -147 -0.492064 0.16
NP_441621.1_7 Reverse -142 -156 -3.04867 0.188
NP_441621.1_7 Forward -155 -141 -4.22864 0.214
NP_441621.1_7 Forward -146 -132 -4.7203 0.242
NP_443062.1_6 Forward -352 -333 3.93269 0.225
NP_441601.1_4 Forward -205 -186 -2.45882 0.293
NP_440519.1_8 Reverse -189 -205 4.87675 0.212
NP_442204.1_1 Reverse -122 -133 2.02529 0.266
NP_441560.1_3 Reverse -135 -153 4.83737 0.298
NP_441560.1_8 Reverse -234 -253 11.7075 0.287
NP_441351.1_8 Reverse -142 -161 4.03102 0.225
NP_441351.1_8 Reverse -313 -332 1.76941 0.267
NP_440516.1_6 Forward -344 -330 12.6836 0.196
NP_440516.1_6 Forward -222 -208 9.6354 0.236
NP_440516.1_6 Forward -213 -199 7.47213 0.273
NP_440516.1_8 Reverse -144 -153 -0.196935 0.185
NP_440516.1_8 Reverse -204 -213 -0.491928 0.262
NP_442846.1_2 Reverse -349 -368 3.53937 0.264
NP_442428.1_5 Reverse -145 -152 14.1988 0.0242
NP_442428.1_5 Forward -152 -145 6.0373 0.212
NP_442428.1_8 Reverse -196 -215 -1.47551 0.284
NP_440818.1_1 Forward -341 -322 -3.24547 0.276
NP_441443.1_7 Reverse -201 -220 2.45773 0.218
NP_441443.1_10 Forward -343 -325 -0.0799167 0.293
NP_442120.1_10 Reverse -315 -334 -9.53865 0.243
NP_440673.1_2 Reverse -134 -153 14.4868 0.0986
NP_440673.1_2 Reverse -203 -222 12.5357 0.145
NP_440673.1_3 Forward -151 -144 11.6422 0.0724
NP_440673.1_3 Forward -211 -204 8.98723 0.203
NP_440673.1_7 Reverse -209 -228 4.03102 0.189
NP_440436.1_4 Forward -152 -143 15.2406 0.00746
NP_441884.1_9 Reverse -201 -220 -12.8819 0.138
NP_441884.1_9 Reverse -132 -151 -23.895 0.284
NP_441884.1_9 Reverse -185 -204 -27.6315 0.291
NP_442414.1_9 Forward -219 -200 14.7491 0.227
NP_440041.1_2 Reverse -378 -397 -5.9004 0.296
NP_442907.1_2 Forward -152 -134 8.67227 0.268
NP_441719.1_4 Reverse -145 -152 6.62729 0.151
NP_441719.1_4 Forward -152 -145 6.52896 0.188
NP_441719.1_4 Reverse -117 -124 3.77569 0.285
NP_441004.1_1 Reverse -198 -217 -4.32711 0.169
NP_441004.1_2 Reverse -193 -212 -2.0655 0.263
NP_441004.1_2 Reverse -325 -344 -2.75381 0.265
NP_441004.1_4 Reverse -201 -211 10.3048 0.254
NP_441004.1_4 Reverse -333 -343 9.02648 0.259
NP_441004.1_5 Reverse -200 -214 11.996 0.24
NP_440296.1_10 Reverse -201 -220 -5.80207 0.225
NP_440296.1_10 Reverse -200 -219 -13.4719 0.269
NP_441115.1_9 Forward -217 -199 7.4923 0.288
NP_442694.1_3 Forward -334 -316 -4.70074 0.276
NP_442206.1_10 Reverse -336 -351 9.22301 0.167
NP_442206.1_10 Reverse -144 -159 0.766545 0.245
NP_442854.1_6 Reverse -181 -200 0.491109 0.296
NP_443054.1_2 Forward -202 -188 3.14618 0.24
NP_442430.1_4 Forward -215 -196 13.4708 0.24
NP_441851.1_9 Reverse -332 -351 9.53756 0.239
NP_441851.1_10 Reverse -143 -153 14.3364 0.0179
NP_441851.1_10 Forward -331 -321 5.68323 0.203
NP_442208.1_5 Reverse -189 -208 -8.752 0.281
NP_442622.1_1 Forward -154 -135 -3.04881 0.177
NP_441501.1_9 Forward -152 -133 19.0748 0.122
NP_442856.1_6 Forward -347 -329 15.358 0.199
NP_440593.1_3 Forward -218 -199 -4.13045 0.245
NP_440463.1_8 Forward -145 -126 18.827 0.0813
NP_440432.1_9 Forward -152 -137 6.07642 0.0481
NP_440432.1_9 Forward -124 -109 -4.445 0.209
NP_442843.1_1 Forward -152 -133 0.294447 0.17
NP_439960.1_10 Reverse -191 -209 -4.50408 0.293
NP_440474.1_8 Forward -124 -110 4.22722 0.287
NP_440933.1_2 Forward -344 -325 14.2574 0.279
NP_440726.1_2 Forward -399 -380 1.86774 0.275
NP_440195.1_2 Reverse -234 -253 13.0775 0.292
NP_442006.1_2 Reverse -135 -152 12.3302 0.0547
NP_442006.1_2 Reverse -204 -221 -15.5958 0.228
NP_442006.1_2 Reverse -107 -124 -16.7758 0.264
NP_442006.1_2 Reverse -327 -344 -17.2674 0.271
NP_442006.1_2 Reverse -126 -143 -17.7591 0.282
NP_442006.1_2 Reverse -195 -212 -18.8407 0.296
NP_441570.1_1 Reverse -116 -134 -8.53565 0.115
NP_441078.1_4 Reverse -144 -153 7.66954 0.052
NP_441078.1_4 Forward -153 -144 0.491382 0.188
NP_442729.1_5 Reverse -373 -383 7.55152 0.29
NP_441539.1_10 Reverse -195 -214 -1.7705 0.187
NP_442443.1_1 Forward -208 -189 2.75272 0.178
NP_442443.1_1 Reverse -196 -215 1.96607 0.194
NP_442443.1_2 Forward -179 -160 12.9791 0.192
NP_440526.1_3 Reverse -322 -333 5.17139 0.253
NP_440526.1_3 Forward -152 -141 2.41814 0.267
NP_441432.1_8 Reverse -143 -152 5.50626 0.151
NP_441432.1_8 Forward -249 -240 5.50626 0.151
NP_441432.1_8 Reverse -203 -212 3.83464 0.243
NP_441432.1_9 Reverse -50 -63 8.40445 0.289
NP_443024.1_3 Forward -332 -322 16.7946 0.251
NP_442320.1_8 Reverse -110 -124 4.52282 0.0482
NP_442320.1_8 Reverse -138 -152 -3.93365 0.136
NP_442320.1_8 Forward -268 -254 -6.39192 0.283
NP_442320.1_9 Forward -342 -328 12.6843 0.249
NP_441732.1_2 Forward -157 -141 -16.3627 0.165
NP_442343.1_1 Forward -222 -203 15.8307 0.271
NP_440313.1_5 Forward -221 -203 12.4081 0.235
NP_440497.1_6 Reverse -199 -218 -4.32711 0.264
NP_440629.1_6 Forward -159 -140 12.2126 0.289
NP_440760.1_1 Forward -330 -311 -9.14533 0.0825
NP_440760.1_1 Forward -100 -81 -18.8801 0.217
NP_442797.1_7 Forward -214 -196 3.75572 0.234
NP_442274.1_8 Forward -220 -202 14.4287 0.286
NP_440578.1_7 Forward -204 -185 13.0766 0.198
NP_440913.1_3 Reverse -329 -342 15.8506 0.215
NP_442400.1_10 Reverse -68 -81 14.3856 0.173
NP_442489.1_7 Reverse -144 -153 8.1612 0.0294
NP_442489.1_7 Forward -153 -144 0.491382 0.178
NP_440565.1_3 Forward -347 -328 18.3851 0.192
NP_442079.1_7 Forward -152 -133 0.982764 0.266
NP_440559.1_1 Forward -329 -320 4.42462 0.277
NP_441659.2_8 Reverse -144 -154 7.84651 0.054
NP_441659.2_8 Forward -153 -143 0.373358 0.268
NP_440860.1_8 Forward -314 -295 12.7825 0.298
NP_441040.1_2 Forward -208 -189 -16.0285 0.292
NP_441040.1_2 Reverse -196 -215 -16.1268 0.294
NP_441040.1_2 Reverse -177 -196 -16.1268 0.294
NP_442346.1_1 Reverse -205 -224 12.1925 0.27
NP_442346.1_5 Reverse -143 -153 6.96153 0.187
NP_442346.1_5 Forward -154 -144 5.68323 0.234
NP_442346.1_10 Reverse -133 -152 -2.95047 0.294
NP_442346.1_10 Forward -155 -136 -3.54046 0.294
NP_440545.1_3 Reverse -140 -157 4.07041 0.0751
NP_440545.1_3 Forward -157 -140 1.31714 0.121
NP_440545.1_3 Reverse -200 -217 -3.10775 0.199
NP_440545.1_3 Reverse -332 -349 -5.86102 0.262
NP_442929.1_3 Forward -190 -171 24.4839 0.00421
NP_442929.1_7 Forward -226 -207 12.7825 0.155
NP_441923.1_6 Reverse -136 -150 8.94771 0.278
NP_441923.1_6 Reverse -205 -219 8.35772 0.278
NP_440459.1_2 Forward -215 -198 8.29864 0.266
NP_440459.1_7 Reverse -142 -156 18.4367 0.0994
NP_441653.1_2 Reverse -133 -152 12.5166 0.0959
NP_441653.1_2 Reverse -310 -329 6.23536 0.235
NP_440010.1_3 Reverse -123 -142 -7.86702 0.29
NP_441233.1_2 Reverse -208 -227 17.0107 0.124
NP_441233.1_2 Reverse -345 -364 15.3391 0.162
NP_440946.1_6 Reverse -133 -152 2.0644 0.294
NP_441948.1_4 Forward -132 -114 9.16393 0.0572
NP_441948.1_4 Forward -160 -142 -5.19239 0.256
NP_441833.1_4 Reverse -145 -152 6.23397 0.163
NP_441833.1_4 Forward -152 -145 6.13563 0.198
NP_442162.1_9 Reverse -145 -152 6.62729 0.142
NP_442162.1_9 Forward -152 -145 6.43063 0.208
NP_442821.1_2 Forward -160 -141 0.294447 0.283
NP_440772.1_6 Forward -152 -133 15.9291 0.146
NP_442045.1_5 Forward -348 -329 -2.36049 0.294
NP_442073.1_6 Forward -210 -191 -1.37718 0.271
NP_442199.1_5 Reverse -105 -124 -0.39387 0.177
NP_442140.1_3 Forward -152 -142 13.648 0.0542
NP_442140.1_3 Reverse -145 -155 4.69992 0.238
NP_440875.1_9 Reverse -146 -156 14.7963 0.0363
NP_440875.1_9 Forward -151 -141 11.5841 0.162
NP_440875.1_9 Forward -156 -146 8.27469 0.233
NP_440875.1_9 Forward -123 -113 7.88535 0.255
NP_442547.1_7 Forward -204 -185 10.3196 0.279
NP_441813.1_5 Forward -155 -145 7.55152 0.0735
NP_441813.1_5 Reverse -142 -152 0.275027 0.206
NP_440590.1_4 Forward -152 -139 -4.7006 0.265
NP_442497.1_10 Reverse -145 -154 5.99792 0.095
NP_442497.1_10 Forward -152 -143 0.589713 0.153
NP_440821.1_4 Reverse -142 -152 9.02648 0.0364
NP_440821.1_4 Reverse -114 -124 -0.511621 0.269
NP_440821.1_4 Forward -332 -322 -0.609952 0.279
NP_441239.1_9 Forward -155 -143 16.1653 0.0175
NP_441239.1_9 Reverse -142 -154 11.4454 0.0607
NP_441239.1_9 Forward -215 -203 9.57708 0.102
NP_441239.1_9 Reverse -334 -346 6.72548 0.178
NP_440400.1_1 Forward -354 -335 -1.96793 0.285
NP_441892.1_1 Reverse -135 -152 0.432165 0.168
NP_441892.1_4 Forward -154 -135 -0.0988766 0.28
NP_442044.1_1 Reverse -144 -163 -8.85033 0.262
NP_442193.1_1 Reverse -341 -359 10.1472 0.233
NP_442643.1_3 Reverse -330 -349 -6.58872 0.261
NP_440573.1_3 Reverse -100 -113 17.2503 0.143
NP_441769.1_1 Forward -221 -202 7.57094 0.279
NP_440354.1_5 Forward -216 -197 2.85105 0.251
NP_441617.1_6 Forward -51 -32 -5.11376 0.274
NP_440546.1_6 Reverse -197 -216 8.94757 0.253
NP_441230.1_5 Forward -218 -199 3.14605 0.205
NP_441656.1_6 Forward -351 -332 13.9625 0.151
NP_440462.1_6 Reverse -142 -152 8.23984 0.0687
NP_440462.1_6 Reverse -114 -124 5.38824 0.156
NP_442611.1_1 Reverse -144 -163 -3.24547 0.3
NP_442592.1_3 Reverse -208 -227 11.6025 0.219
NP_440868.1_4 Reverse -140 -152 9.57708 0.0464
NP_440868.1_8 Reverse -332 -351 -5.01543 0.272
NP_442402.1_2 Forward -180 -166 11.2087 0.284
NP_441848.1_7 Forward -182 -163 -1.8696 0.257
NP_441084.1_6 Forward -155 -141 10.4106 0.241
NP_439942.1_7 Reverse -190 -209 3.04771 0.19
NP_439942.1_7 Reverse -189 -208 -4.22878 0.248
NP_440696.1_3 Forward -153 -135 -1.55415 0.26
NP_442023.1_2 Reverse -328 -347 9.53756 0.255
NP_442039.1_4 Reverse -145 -152 6.3323 0.289
NP_442039.1_7 Reverse -206 -216 10.2065 0.257
NP_442696.1_6 Forward -225 -206 -3.63879 0.154
NP_442837.1_3 Reverse -145 -152 6.0373 0.25
NP_442837.1_3 Forward -152 -145 5.93897 0.265
NP_440160.1_2 Reverse -191 -210 -7.67036 0.286
NP_440505.1_3 Reverse -142 -152 5.09324 0.246
NP_441252.1_6 Reverse -355 -362 11.6422 0.288
NP_441408.2_7 Forward -332 -313 -5.01543 0.29
NP_440914.1_1 Reverse -144 -154 12.9091 0.0435
NP_440914.1_1 Reverse -336 -346 10.2742 0.147
NP_440914.1_1 Reverse -240 -250 7.44401 0.237
NP_440914.1_1 Reverse -246 -256 7.05364 0.254
NP_440914.1_4 Forward -215 -199 10.8742 0.271
NP_441011.1_8 Forward -152 -143 7.27622 0.179
NP_441011.1_8 Reverse -145 -154 5.40793 0.263
NP_442533.1_1 Reverse -201 -220 -13.6686 0.237
NP_442533.1_1 Reverse -207 -226 -15.1435 0.252
NP_442533.1_1 Reverse -174 -193 -16.3235 0.265
NP_442533.1_6 Forward -153 -144 7.66954 0.0897
NP_442533.1_6 Reverse -144 -153 6.8829 0.101
NP_442541.1_10 Forward -153 -139 0.982316 0.292
NP_442322.1_4 Forward -229 -212 -7.5333 0.284
NP_442322.1_4 Forward -228 -211 -8.31994 0.286
NP_441219.1_6 Reverse -134 -152 10.5406 0.252
NP_439944.1_10 Reverse -192 -211 13.8641 0.223
NP_441028.1_5 Forward -85 -73 19.3118 0.216
NP_442202.1_6 Reverse -297 -316 3.34271 0.265
NP_442202.1_10 Forward -154 -140 4.42448 0.264
NP_441527.1_4 Reverse -65 -84 -9.02441 0.254
NP_440115.1_6 Reverse -201 -211 6.46988 0.181
NP_440007.1_9 Forward -285 -271 1.47456 0.285
NP_440007.1_9 Reverse -236 -250 0.88457 0.29
NP_443045.1_2 Reverse -330 -349 14.5524 0.282
NP_441602.1_3 Forward -350 -331 3.34271 0.175
NP_441602.1_3 Reverse -316 -335 -0.39387 0.224
NP_441972.1_5 Reverse -205 -224 -3.04881 0.196
NP_441972.1_5 Forward -212 -193 -3.93378 0.201
NP_441106.1_1 Reverse -143 -152 15.0444 0.015
NP_440429.1_2 Forward -152 -133 8.84924 0.272
NP_001035870.1_3 Forward -356 -337 3.04771 0.163
NP_441286.1_1 Forward -154 -142 -5.76255 0.223
NP_441286.1_1 Forward -346 -334 -6.15587 0.251
NP_440092.1_4 Forward -263 -244 18.289 0.0799
NP_440670.1_8 Reverse -144 -153 6.78456 0.099
NP_440670.1_8 Forward -153 -144 5.3096 0.167
NP_441930.1_2 Reverse -203 -213 14.828 0.19
NP_440886.1_4 Reverse -202 -221 18.1907 0.112
NP_440886.1_7 Forward -214 -204 6.37109 0.13
NP_440886.1_7 Forward -220 -210 3.42118 0.282
NP_440268.1_8 Reverse -22 -41 18.289 0.179
NP_440828.1_1 Forward -211 -192 19.6648 0.0328
NP_440828.1_1 Forward -151 -132 5.50519 0.206
NP_440828.1_4 Forward -154 -135 13.6666 0.0743
NP_440828.1_4 Forward -232 -213 2.16195 0.152
NP_440828.1_5 Forward -271 -252 34.022 0.0000314
NP_442614.1_2 Forward -168 -154 10.3243 0.234
NP_442382.1_9 Forward -349 -330 10.6184 0.281
NP_442072.1_9 Reverse -203 -221 -23.3836 0.292
NP_441753.1_10 Reverse -195 -214 11.3075 0.123
NP_441753.1_10 Reverse -184 -203 2.85105 0.226
NP_440028.1_6 Reverse -336 -354 11.7205 0.254
NP_442022.1_4 Reverse -201 -220 11.0125 0.217
NP_442022.1_4 Reverse -132 -151 7.86593 0.268
NP_440907.2_8 Forward -152 -142 7.84605 0.117
NP_440907.2_8 Forward -228 -218 4.01116 0.283
NP_441626.1_2 Reverse -145 -152 6.52896 0.137
NP_441626.1_2 Forward -152 -145 5.93897 0.231
NP_442912.1_10 Reverse -141 -160 17.0107 0.294
NP_442794.1_1 Forward -348 -336 5.34885 0.225
NP_441962.1_4 Reverse -331 -350 -6.09707 0.175
NP_441962.1_4 Reverse -316 -335 -7.67036 0.192
NP_441962.1_4 Reverse -130 -149 -10.227 0.224
NP_440855.1_1 Reverse -132 -151 1.47442 0.225
NP_441431.1_2 Reverse -332 -346 11.012 0.149
NP_441431.1_2 Forward -216 -202 10.717 0.155
NP_441431.1_2 Forward -171 -157 7.3738 0.244
NP_441431.1_2 Reverse -141 -155 6.68548 0.263
NP_441431.1_3 Reverse -204 -223 8.25926 0.236
NP_441431.1_3 Reverse -347 -366 2.85105 0.281
NP_441836.1_2 Reverse -201 -220 0.58944 0.202
NP_441993.1_1 Reverse -186 -205 8.47633 0.146
NP_441993.1_1 Reverse -205 -224 4.38312 0.221
NP_441993.1_1 Reverse -185 -204 0.777198 0.292
NP_440467.1_3 Forward -212 -193 19.2644 0.0418
NP_440114.1_10 Reverse -144 -158 7.57108 0.231
NP_442437.1_8 Reverse -205 -224 3.14605 0.291
NP_442357.1_8 Forward -276 -257 7.27595 0.241
NP_441552.1_4 Forward -361 -342 18.9773 0.146
NP_441720.1_2 Forward -157 -138 8.35677 0.213
NP_440293.1_3 Forward -352 -333 -1.27885 0.239
NP_440293.1_3 Reverse -313 -332 -1.37718 0.239
NP_440766.1_4 Reverse -200 -214 2.35953 0.187
NP_440422.1_10 Forward -315 -296 12.8246 0.16
NP_441237.1_9 Forward -344 -334 11.3864 0.184
NP_442743.1_1 Forward -354 -335 8.06178 0.264
NP_442867.1_8 Forward -151 -132 4.12936 0.291
NP_440457.1_1 Reverse -200 -212 7.02048 0.105
NP_440798.1_6 Forward -152 -139 2.47756 0.17
NP_440798.1_6 Reverse -145 -158 0.510939 0.259
NP_441984.1_3 Reverse -311 -329 5.23069 0.293
NP_441871.1_4 Reverse -348 -367 11.8975 0.244
NP_441253.1_1 Forward -360 -341 8.16093 0.205
NP_440734.1_9 Reverse -149 -168 9.3409 0.294
NP_440554.1_4 Forward -152 -142 10.9931 0.0429
NP_440554.1_4 Reverse -145 -155 9.51814 0.0646
NP_440554.1_4 Reverse -117 -127 2.92996 0.248
NP_440478.1_4 Reverse -194 -213 10.3242 0.285
NP_440478.1_10 Reverse -214 -228 6.58777 0.288
NP_442341.1_7 Forward -126 -112 2.2612 0.263
NP_441756.1_5 Forward -205 -186 1.0811 0.219
NP_441756.1_5 Reverse -183 -202 -2.75381 0.283
NP_441756.1_5 Forward -202 -183 -3.04881 0.287
NP_441756.1_5 Forward -223 -204 -4.32711 0.294
NP_443000.1_7 Forward -155 -145 1.455 0.247
NP_441842.1_10 Reverse -197 -211 9.04604 0.2
NP_440275.1_3 Reverse -142 -152 8.23984 0.0602
NP_440275.1_3 Forward -155 -145 6.37155 0.111
NP_440091.1_1 Reverse -140 -152 8.00379 0.0714
NP_440091.1_1 Forward -129 -117 0.825626 0.227
NP_440091.1_1 Reverse -112 -124 0.727295 0.233
NP_440679.1_10 Reverse -209 -228 -12.3902 0.192
NP_440679.1_10 Reverse -137 -156 -20.1584 0.283
NP_441359.1_5 Forward -216 -197 4.12936 0.229
NP_442451.1_2 Reverse -313 -332 1.57275 0.144
NP_439962.1_4 Reverse -313 -332 6.98095 0.155
NP_439962.1_4 Forward -221 -202 4.22769 0.185
NP_439962.1_4 Forward -152 -133 -0.39387 0.199
NP_441875.1_10 Forward -205 -191 12.6843 0.232
NP_441105.1_3 Reverse -310 -329 -3.63879 0.184
NP_440216.1_1 Reverse -144 -158 5.50613 0.0196
NP_440216.1_9 Reverse -338 -347 5.70292 0.29
NP_440172.1_1 Reverse -144 -154 8.23984 0.0653
NP_440167.1_3 Reverse -326 -345 10.7175 0.233
NP_441226.1_7 Forward -152 -145 14.1984 0.024
NP_441111.1_7 Forward -152 -144 8.86921 0.0589
NP_441766.1_2 Forward -153 -144 6.39124 0.0993
NP_441766.1_2 Forward -125 -116 2.65466 0.254
NP_442252.1_2 Forward -330 -312 15.7521 0.27
NP_440416.1_9 Forward -160 -141 -16.6185 0.218
NP_440416.1_9 Forward -352 -333 -17.1101 0.231
NP_440416.1_9 Forward -214 -195 -18.9784 0.267
NP_443052.1_8 Reverse -106 -125 -9.53865 0.193
NP_443052.1_9 Forward -223 -204 0.196116 0.201
NP_443052.1_9 Forward -214 -195 0.0977854 0.203
NP_443052.1_9 Forward -217 -198 -2.75381 0.242
NP_443052.1_9 Forward -151 -132 -4.13045 0.254
NP_440072.1_5 Reverse -204 -222 1.19912 0.236
NP_442154.1_1 Reverse -205 -223 -5.68405 0.127
NP_442154.1_1 Reverse -342 -360 -11.1906 0.213
NP_442226.1_1 Reverse -106 -125 12.7825 0.281
NP_440261.1_5 Reverse -145 -158 -4.7006 0.165
NP_440261.1_5 Reverse -322 -335 -10.7971 0.21
NP_440261.1_5 Forward -344 -331 -12.4687 0.297
NP_440988.1_7 Reverse -137 -156 6.29264 0.116
NP_440988.1_10 Reverse -334 -348 5.67333 0.24
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TCCCCGTCCAAGTCATACACCATGGTGCCACAGGGAACTTGCACCACCACATCCTTGCCATTGGCCCCGGTGCAATTGCTAGAGCCGCCTTTTTTGCCGTCTTCCGCTTTAAAAATCCTGGCGTAGCGAAAATCCAACAGGGTTTGCAGATTGGCATCCGCTTCAAAAATTACCGAGCCACCCCGGCCCCCATTGCCCCCGGAAGGGCCCCCTGCTGGCACATACTTTTCCCGCCGAAAGGACACCATGCCATCGCCGCCTTTGCCGCCCTGAACTTCGATCTCCGCTTGATCAATAAATTGCATTCTCTAAAACTTACTTCCTGTTAATTCTGACTAAAAATAGACTTCAATTTTCCGAATAGCCTCTCTCCAAATGATATAACTCTTAGGGTGCTGAG

CDS

GTGGGCTGTGACTTCGCCATTGCCAAGGATTTTCTTCTGTTTTTCTTAACTAAGCCAATTTCCATGAAGCTTTCGGTTATCATTCCGATTTATAACGAAATCCAAACCATCGAAAAAATTCTCAAAAAAATTACCACGGTAATGCCTGAAATCCCCAAGGAAATTGTCATGGTGGACGATGGCTCTAAGGATGGTACGAGGGAATGGTTGGTGGATACCTTTGGCGATCCGGAACAGCATCCCGTTTTAGCCAACGTCAACTTAGCGGGTAAATTCCAGTGCTTTCCCCTTGATCAATCGGCGGAAACCAACGGCGATCGCCAGGGGAACAGTTTTGTTATGCCCAAGGAATGGGAAGTGAAAGTAATTTTCCATCGTCAGAATCAGGGCAAAGGGGGGGCTCTCCACACTGCTTTTGCCGCCGCCACCGGGGATGTGTTGATTATTCAAGATGCGGATTTGGAATACGACCCCGAGGATTGGGGTCCCATGTGGAAGTTAATTGATGGGGGTTGGGCCGATGTGGTGTACGGTTCCCGCTTCTACGGCAATCCCCATCGGGTGCTCTATTTCCATCATTATTTAGGCAATAAATTGATCACCAGTTTGATTGATTTGGTCTGTAATATTAACCTCACTGACATTGAAGTTTGTTACAAAATGTTTCGACGGGAAGTGTTGGAGGATTTACGTTTAACCTGTAATGATTTCGGTTTCGAAGTTGAATTTACAATGAAGGTAACCCGATCGCCGAAGCGATGGCGAATTTATGAAGTGGGGGTGGCCTATTATGGCCGTACCTTTGCGGAAGGAAAGAAAATCAATTGGCGAGATGGGGTTAAAGCTTTGGGCTACATTGCCAAATTTTGGTTAACCAACGCTTAA

Protein

MGCDFAIAKDFLLFFLTKPISMKLSVIIPIYNEIQTIEKILKKITTVMPEIPKEIVMVDDGSKDGTREWLVDTFGDPEQHPVLANVNLAGKFQCFPLDQSAETNGDRQGNSFVMPKEWEVKVIFHRQNQGKGGALHTAFAAATGDVLIIQDADLEYDPEDWGPMWKLIDGGWADVVYGSRFYGNPHRVLYFHHYLGNKLITSLIDLVCNINLTDIEVCYKMFRREVLEDLRLTCNDFGFEVEFTMKVTRSPKRWRIYEVGVAYYGRTFAEGKKINWRDGVKALGYIAKFWLTNA