Your browser is old and dusty. Try Google Chrome!

Details for sll1011

ORF sll1011
Accession NP_440353.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -268 -282 5.60446 0.132
NP_440795.1_7 Forward -275 -268 14.6904 0.0123
NP_440795.1_7 Reverse -268 -275 14.6904 0.0123
NP_441418.1_6 Forward -276 -257 -13.6686 0.0777
NP_442291.1_5 Forward -277 -261 -1.90808 0.204
NP_440897.1_6 Reverse -267 -286 0.195343 0.18
NP_441453.1_4 Reverse -267 -275 16.539 0.00633
NP_441453.1_4 Forward -276 -268 16.539 0.00633
NP_441453.1_7 Reverse -393 -400 11.9372 0.298
NP_442151.1_6 Reverse -267 -281 18.7808 0.00618
NP_442151.1_6 Forward -276 -262 8.55439 0.171
NP_441818.1_1 Forward -275 -264 14.4145 0.0502
NP_440226.1_1 Forward -276 -257 4.42435 0.192
NP_441098.1_3 Reverse -292 -311 -7.26748 0.285
NP_440996.1_2 Reverse -295 -304 14.8477 0.248
NP_443002.1_5 Reverse -98 -116 7.88485 0.299
NP_442173.1_1 Forward -275 -267 15.4574 0.00633
NP_442173.1_1 Reverse -268 -276 15.4574 0.00633
NP_442752.1_4 Forward -276 -269 13.8055 0.0199
NP_442752.1_4 Reverse -267 -274 13.8055 0.0199
NP_442752.1_4 Reverse -260 -267 7.90559 0.144
NP_442752.1_4 Forward -196 -189 5.54565 0.194
NP_443027.1_4 Forward -59 -49 7.35486 0.24
NP_443027.1_4 Reverse -265 -275 6.46988 0.275
NP_442975.1_10 Reverse -263 -277 3.8339 0.252
NP_440784.1_7 Forward -275 -268 15.9687 0.0123
NP_440784.1_7 Reverse -268 -275 15.9687 0.0123
NP_440061.1_9 Forward -278 -264 13.2736 0.0819
NP_440110.1_4 Forward -287 -268 12.1925 0.096
NP_441054.1_2 Forward -100 -81 11.4058 0.27
NP_441054.1_4 Reverse -257 -275 2.37909 0.169
NP_442062.1_8 Forward -276 -266 17.6796 0.00193
NP_442062.1_8 Reverse -267 -277 17.3846 0.00193
NP_440761.1_4 Reverse -262 -281 -13.3736 0.257
NP_441859.1_3 Forward -277 -258 3.34192 0.244
NP_441802.1_1 Reverse -197 -216 5.60432 0.279
NP_440304.1_4 Reverse -265 -275 17.9746 0.00654
NP_440304.1_4 Forward -278 -268 1.84832 0.299
NP_442242.1_4 Forward -275 -268 14.3954 0.0124
NP_442242.1_4 Reverse -268 -275 14.3954 0.0124
NP_440044.1_8 Reverse -268 -287 -2.95047 0.274
NP_441781.1_7 Forward -276 -257 -3.24547 0.295
NP_440011.1_1 Forward -204 -185 13.0775 0.258
NP_441200.1_4 Reverse -195 -214 10.6192 0.189
NP_441619.1_9 Forward -358 -339 3.6377 0.269
NP_441208.1_9 Forward -279 -265 9.04604 0.219
NP_441208.1_9 Forward -78 -64 7.37441 0.222
NP_441208.1_9 Reverse -170 -184 6.3911 0.246
NP_441594.1_6 Reverse -258 -277 0.58944 0.282
NP_442742.1_9 Forward -305 -286 -14.3569 0.3
NP_442110.1_7 Reverse -267 -281 1.76955 0.222
NP_440330.1_2 Forward -69 -50 9.73422 0.297
NP_440330.1_2 Forward -208 -189 9.63589 0.297
NP_441083.1_5 Reverse -267 -277 20.3345 0.00053
NP_441083.1_5 Forward -276 -266 19.3512 0.000718
NP_441434.1_1 Reverse -297 -311 10.1338 0.233
NP_441434.1_7 Forward -274 -260 5.50613 0.225
NP_441738.1_2 Forward -274 -267 15.28 0.0102
NP_441738.1_2 Reverse -269 -276 15.28 0.0102
NP_441738.1_2 Reverse -36 -43 6.03696 0.295
NP_441558.1_5 Forward -278 -259 9.53756 0.118
NP_441558.1_5 Reverse -265 -284 4.81767 0.269
NP_440209.1_1 Reverse -267 -275 18.1123 0.00295
NP_440209.1_1 Forward -276 -268 18.1123 0.00295
NP_442889.1_8 Reverse -264 -278 20.0584 0.00547
NP_441713.1_1 Reverse -261 -280 -13.8652 0.257
NP_441713.1_1 Forward -282 -263 -14.4552 0.259
NP_441716.1_1 Reverse -267 -281 13.1759 0.0689
NP_441716.1_1 Forward -276 -262 11.0127 0.0936
NP_441598.1_3 Reverse -193 -212 11.606 0.292
NP_442111.1_4 Forward -277 -263 11.406 0.0509
NP_442111.1_4 Reverse -266 -280 9.63603 0.0593
NP_442111.1_4 Reverse -87 -101 3.14618 0.253
NP_441163.1_1 Reverse -96 -113 7.41293 0.245
NP_441163.1_1 Forward -284 -267 5.053 0.281
NP_441215.1_1 Forward -290 -271 8.75091 0.147
NP_440906.1_5 Forward -275 -268 15.8704 0.0124
NP_440906.1_5 Reverse -268 -275 15.8704 0.0124
NP_440747.1_10 Forward -279 -267 24.7201 0.00036
NP_440747.1_10 Reverse -264 -276 -1.92764 0.0192
NP_441130.1_10 Forward -278 -264 8.55439 0.134
NP_441486.1_1 Reverse -264 -278 6.29277 0.0344
NP_441486.1_1 Forward -279 -265 6.09611 0.0344
NP_441880.2_10 Forward -275 -257 8.47561 0.273
NP_442634.1_4 Reverse -265 -279 5.01447 0.0671
NP_441265.1_3 Reverse -261 -275 6.6861 0.181
NP_441265.1_3 Forward -202 -188 2.85119 0.181
NP_440842.1_10 Reverse -264 -278 1.27789 0.294
NP_442848.1_4 Reverse -145 -159 12.291 0.266
NP_443018.1_3 Forward -275 -268 14.8871 0.0123
NP_443018.1_3 Reverse -268 -275 14.8871 0.0123
NP_441316.1_7 Reverse -265 -280 2.43817 0.154
NP_441634.1_8 Forward -278 -264 5.1128 0.114
NP_440376.1_1 Forward -276 -267 19.4693 0.000692
NP_440376.1_1 Reverse -267 -276 19.4693 0.000692
NP_440376.1_1 Forward -358 -349 2.458 0.221
NP_440376.1_1 Forward -63 -54 1.47469 0.251
NP_441002.1_3 Forward -221 -202 8.94676 0.293
NP_441588.1_4 Reverse -269 -279 9.02648 0.14
NP_442730.1_8 Forward -284 -265 4.32522 0.273
NP_442687.1_7 Reverse -266 -276 18.5646 0.0028
NP_442687.1_7 Forward -277 -267 8.92815 0.0994
NP_442687.1_7 Reverse -133 -143 8.04317 0.116
NP_442485.1_3 Forward -111 -92 -3.83545 0.277
NP_440042.1_2 Reverse -257 -276 -4.91709 0.295
NP_442658.1_1 Reverse -265 -275 17.6791 0.00565
NP_442658.1_1 Forward -379 -369 7.84605 0.205
NP_442658.1_1 Forward -278 -268 6.76441 0.214
NP_440353.1_1 Forward -54 -35 21.4347 0.0702
NP_440353.1_3 Forward -79 -67 19.6068 0.123
NP_441855.2_4 Forward -284 -265 12.2225 0.2
NP_442782.1_2 Reverse -135 -149 7.17775 0.205
NP_442205.1_9 Reverse -261 -277 -3.48138 0.283
NP_441414.1_9 Reverse -267 -286 -4.42544 0.153
NP_442937.1_5 Forward -281 -262 7.66927 0.244
NP_442937.1_5 Forward -161 -142 5.80098 0.3
NP_441958.1_5 Reverse -266 -276 20.5312 0.000966
NP_441958.1_5 Forward -277 -267 12.2714 0.00183
NP_440450.1_10 Forward -315 -296 15.2305 0.209
NP_440203.1_5 Reverse -270 -280 14.2375 0.0886
NP_439905.1_5 Reverse -297 -311 11.7993 0.288
NP_439990.1_5 Forward -281 -268 20.7671 0.00296
NP_442376.1_2 Reverse -262 -281 -10.3253 0.286
NP_442911.1_2 Reverse -257 -276 -0.787193 0.0786
NP_442911.1_2 Forward -286 -267 -1.96717 0.092
NP_440153.1_5 Reverse -89 -103 2.65453 0.219
NP_442064.1_1 Forward -281 -262 -11.5053 0.259
NP_442064.1_1 Forward -219 -200 -13.1769 0.285
NP_443055.1_6 Forward -290 -272 6.21323 0.172
NP_440496.1_6 Reverse -291 -310 6.39097 0.281
NP_441913.1_3 Reverse -289 -302 17.5368 0.218
NP_442853.1_10 Reverse -125 -144 7.96345 0.283
NP_441099.1_5 Reverse -257 -276 -1.47551 0.109
NP_441099.1_5 Forward -286 -267 -9.24366 0.216
NP_442002.1_1 Forward -349 -331 -6.27403 0.249
NP_442002.1_9 Reverse -266 -273 14.1004 0.074
NP_442567.1_1 Reverse -198 -217 16.9124 0.283
NP_441294.1_7 Reverse -263 -277 19.5214 0.00282
NP_441646.1_1 Forward -283 -264 3.44104 0.207
NP_441646.1_1 Forward -107 -88 0.0977854 0.254
NP_442438.1_10 Reverse -262 -276 3.14618 0.166
NP_442438.1_10 Forward -105 -91 0.982901 0.21
NP_442438.1_10 Forward -281 -267 0.786239 0.213
NP_441000.1_6 Forward -277 -263 -4.52363 0.245
NP_442771.1_1 Forward -278 -260 -4.79907 0.166
NP_442771.1_1 Reverse -265 -283 -5.48739 0.166
NP_440147.1_3 Reverse -95 -114 19.469 0.0299
NP_440147.1_4 Forward -278 -265 21.0621 0.00143
NP_440147.1_4 Reverse -265 -278 4.05085 0.173
NP_441550.1_8 Reverse -265 -275 19.8424 0.00352
NP_441550.1_8 Forward -278 -268 14.6309 0.0132
NP_441916.1_7 Forward -276 -266 16.893 0.00407
NP_441916.1_7 Reverse -267 -277 10.3048 0.0261
NP_441916.1_10 Reverse -259 -278 3.04771 0.236
NP_440206.1_4 Reverse -93 -112 -0.39464 0.29
NP_440345.1_3 Forward -303 -289 10.1338 0.29
NP_440465.1_9 Forward -387 -369 11.1305 0.119
NP_441041.1_4 Forward -112 -93 -5.99873 0.162
NP_441041.1_4 Reverse -267 -286 -10.9153 0.238
NP_441041.1_7 Reverse -264 -276 21.8971 0.000853
NP_441041.1_7 Forward -279 -267 8.58373 0.133
NP_443063.1_6 Reverse -74 -93 15.4374 0.157
NP_443063.1_7 Forward -378 -362 5.36841 0.288
NP_441547.1_2 Forward -287 -269 7.4923 0.215
NP_442004.1_6 Reverse -267 -281 5.80112 0.181
NP_441725.1_5 Forward -275 -265 18.7612 0.0119
NP_441725.1_5 Reverse -268 -278 2.04498 0.115
NP_439966.1_7 Reverse -265 -275 8.14104 0.14
NP_439966.1_7 Reverse -126 -136 7.74772 0.15
NP_439966.1_7 Forward -278 -268 7.25606 0.15
NP_439966.1_9 Reverse -265 -274 0.983037 0.253
NP_442941.1_3 Reverse -268 -278 11.0914 0.0116
NP_442941.1_3 Forward -275 -265 2.43831 0.14
NP_440289.1_2 Reverse -264 -277 20.9638 0.003
NP_440289.1_2 Forward -279 -266 -2.144 0.251
NP_440260.1_8 Forward -79 -61 0.904127 0.193
NP_440260.1_8 Forward -292 -274 -5.48739 0.275
NP_440260.1_8 Forward -285 -267 -7.35568 0.295
NP_441514.1_6 Reverse -210 -217 14.2971 0.248
NP_442281.1_1 Forward -281 -267 9.53707 0.0685
NP_442281.1_1 Reverse -168 -182 4.22722 0.203
NP_442281.1_1 Reverse -262 -276 2.26061 0.272
NP_441079.1_7 Forward -315 -296 -3.83621 0.238
NP_442575.1_9 Reverse -46 -65 12.6841 0.275
NP_440177.1_1 Forward -111 -93 7.19731 0.272
NP_442256.1_2 Reverse -265 -283 -8.53565 0.227
NP_442500.1_8 Forward -388 -374 15.3843 0.146
NP_439983.1_1 Forward -222 -204 9.85146 0.289
NP_441087.1_6 Reverse -171 -189 0.0184138 0.258
NP_441556.1_10 Forward -281 -267 13.4339 0.178
NP_441644.1_6 Reverse -267 -277 17.3841 0.00127
NP_441644.1_6 Forward -276 -266 15.7125 0.0048
NP_441644.1_6 Forward -269 -259 4.40448 0.239
NP_443049.1_6 Forward -197 -187 12.812 0.231
NP_442215.1_2 Forward -278 -262 6.74504 0.0702
NP_442215.1_2 Reverse -265 -281 4.3851 0.0845
NP_442215.1_2 Forward -285 -269 -2.39974 0.197
NP_440253.1_4 Forward -65 -46 11.7008 0.274
NP_440929.1_8 Forward -276 -267 19.2726 0.000701
NP_440929.1_8 Reverse -267 -276 19.2726 0.000701
NP_441346.1_7 Forward -81 -62 10.7175 0.249
NP_442933.1_10 Forward -276 -267 17.601 0.00325
NP_442933.1_10 Reverse -267 -276 17.601 0.00325
NP_441751.2_8 Forward -275 -261 21.1407 0.00597
NP_441751.2_8 Reverse -268 -282 7.37441 0.0339
NP_442554.1_8 Forward -275 -265 16.9913 0.0065
NP_442554.1_8 Reverse -268 -278 15.3197 0.00882
NP_441762.1_7 Reverse -266 -278 8.9871 0.0142
NP_441762.1_7 Forward -277 -265 2.59558 0.0676
NP_442313.1_5 Forward -62 -43 10.1275 0.191
NP_442142.1_4 Reverse -264 -277 11.9167 0.0504
NP_442142.1_4 Forward -279 -266 5.52525 0.188
NP_442142.1_4 Forward -60 -47 2.37867 0.294
NP_442292.1_1 Reverse -268 -277 18.486 0.00229
NP_442292.1_1 Forward -275 -266 9.53783 0.0183
NP_442143.1_10 Forward -275 -256 11.0125 0.293
NP_441024.1_2 Forward -304 -290 19.683 0.237
NP_440895.1_6 Forward -282 -269 20.1771 0.0221
NP_443009.1_5 Forward -277 -266 15.7911 0.0107
NP_443009.1_5 Reverse -266 -277 11.1696 0.066
NP_441715.1_4 Reverse -268 -278 7.94484 0.107
NP_443034.1_4 Forward -128 -109 19.0757 0.153
NP_440015.1_9 Forward -276 -258 16.0471 0.0329
NP_441198.1_8 Reverse -265 -275 15.2245 0.0427
NP_440464.1_10 Reverse -268 -278 13.0082 0.169
NP_441468.1_1 Forward -275 -268 15.8704 0.0124
NP_441468.1_1 Reverse -268 -275 15.8704 0.0124
NP_441015.1_8 Reverse -254 -273 2.26107 0.272
NP_441015.1_10 Reverse -255 -274 -8.16202 0.272
NP_441673.1_1 Forward -276 -267 20.8459 0.000698
NP_441673.1_1 Reverse -267 -276 20.8459 0.000698
NP_441731.1_3 Forward -284 -265 3.83436 0.159
NP_441876.1_9 Reverse -123 -133 10.796 0.287
NP_441826.1_2 Reverse -261 -275 13.1759 0.0227
NP_441826.1_2 Forward -282 -268 6.78443 0.09
NP_441826.1_5 Reverse -98 -117 7.17762 0.221
NP_441826.1_5 Forward -174 -155 0.491109 0.3
NP_441764.1_8 Reverse -66 -76 11.1193 0.287
NP_442868.1_6 Reverse -265 -275 16.7946 0.0131
NP_442868.1_6 Forward -278 -268 9.81313 0.038
NP_441612.1_2 Reverse -293 -303 11.4537 0.21
NP_441612.1_2 Reverse -267 -277 8.54929 0.21
NP_442559.1_3 Reverse -124 -143 8.45592 0.285
NP_442427.1_8 Reverse -258 -277 5.50599 0.264
NP_442808.1_1 Reverse -266 -276 8.73102 0.0481
NP_442808.1_1 Forward -277 -267 8.63269 0.0481
NP_442808.1_1 Reverse -186 -196 5.38779 0.155
NP_442808.1_1 Reverse -74 -84 2.43787 0.266
NP_441101.1_10 Forward -280 -261 10.5209 0.122
NP_440145.1_3 Forward -286 -267 -1.37718 0.151
NP_440145.1_3 Reverse -81 -100 -4.13045 0.221
NP_442542.1_2 Reverse -265 -278 13.4906 0.114
NP_442050.1_5 Reverse -265 -275 14.9258 0.0175
NP_442050.1_5 Forward -278 -268 7.64939 0.243
NP_442342.1_9 Reverse -265 -281 12.3499 0.107
NP_440630.1_1 Forward -93 -74 2.26107 0.263
NP_441878.1_4 Forward -196 -177 4.52268 0.271
NP_441878.1_6 Reverse -266 -276 20.2362 0.0046
NP_441878.1_6 Forward -277 -267 10.4031 0.0176
NP_441036.1_8 Reverse -266 -276 8.4365 0.174
NP_441036.1_8 Forward -277 -267 8.33817 0.174
NP_442650.1_2 Reverse -267 -281 8.25939 0.13
NP_441557.1_5 Forward -276 -267 19.9609 0.000699
NP_441557.1_5 Reverse -267 -276 19.9609 0.000699
NP_441445.1_1 Reverse -258 -277 6.98095 0.138
NP_441445.1_1 Forward -285 -266 2.75272 0.229
NP_442066.2_4 Reverse -267 -286 -8.06369 0.293
NP_442469.1_2 Forward -202 -184 14.2771 0.298
NP_441116.1_10 Forward -300 -281 8.25926 0.257
NP_440979.1_3 Forward -275 -257 10.5406 0.245
NP_441819.1_5 Forward -308 -289 8.6416 0.295
NP_440157.1_5 Reverse -203 -222 19.3367 0.0889
NP_440861.1_2 Reverse -280 -299 11.9368 0.27
NP_442347.1_2 Reverse -268 -277 12.4878 0.056
NP_442347.1_2 Forward -275 -266 3.34298 0.284
NP_442645.1_2 Reverse -46 -65 -17.5035 0.256
NP_440547.1_1 Forward -117 -98 7.27514 0.294
NP_441037.1_4 Reverse -265 -275 18.9151 0.00351
NP_441037.1_4 Forward -353 -343 9.46176 0.214
NP_441037.1_4 Forward -278 -268 7.9999 0.237
NP_442317.1_6 Forward -281 -262 2.26107 0.285
NP_441633.1_3 Forward -278 -265 20.3738 0.00512
NP_440136.1_2 Forward -275 -268 15.9687 0.0123
NP_440136.1_2 Reverse -268 -275 15.9687 0.0123
NP_442590.1_10 Reverse -260 -279 2.94938 0.299
NP_442998.1_5 Reverse -278 -288 10.1081 0.225
NP_442998.1_10 Forward -274 -267 15.5754 0.0102
NP_442998.1_10 Reverse -269 -276 15.5754 0.0102
NP_440299.1_1 Forward -280 -267 22.3398 0.000547
NP_440299.1_1 Reverse -263 -276 6.60689 0.136
NP_441799.1_1 Reverse -263 -277 12.5853 0.0421
NP_441007.1_10 Reverse -262 -275 3.5592 0.182
NP_442201.1_10 Forward -287 -268 -14.4552 0.282
NP_441362.1_5 Forward -396 -378 10.4709 0.274
NP_441512.1_4 Reverse -263 -282 7.47261 0.272
NP_441559.1_8 Forward -281 -267 2.65453 0.143
NP_441559.1_8 Forward -105 -91 -7.57189 0.295
NP_442756.1_2 Forward -164 -145 6.78429 0.27
NP_441270.1_5 Forward -141 -122 14.6533 0.211
NP_441270.1_5 Forward -208 -189 12.6039 0.236
NP_440915.1_6 Reverse -263 -277 13.1759 0.0194
NP_440915.1_6 Forward -280 -266 11.5043 0.0256
NP_442158.1_4 Forward -285 -275 12.8614 0.239
NP_441464.1_8 Forward -276 -262 16.7159 0.083
NP_441464.1_10 Forward -139 -125 9.2427 0.262
NP_441199.1_6 Forward -280 -261 14.8474 0.0389
NP_439985.1_7 Reverse -261 -280 12.3892 0.163
NP_442993.1_1 Forward -276 -260 2.22182 0.0502
NP_440677.1_1 Forward -285 -266 10.7175 0.163
NP_442386.1_9 Forward -277 -268 13.8639 0.0289
NP_442386.1_9 Reverse -266 -275 6.39082 0.219
NP_441340.1_5 Forward -275 -268 15.6737 0.0124
NP_441340.1_5 Reverse -268 -275 15.6737 0.0124
NP_440194.1_3 Reverse -24 -43 6.4893 0.271
NP_440059.1_9 Reverse -199 -218 15.3391 0.163
NP_442240.1_1 Forward -284 -265 8.84842 0.233
NP_440586.1_1 Forward -116 -97 -3.63879 0.272
NP_440586.1_1 Forward -82 -63 -4.91709 0.278
NP_440586.1_8 Forward -275 -268 13.2151 0.026
NP_440586.1_8 Reverse -268 -275 13.2151 0.026
NP_442251.1_6 Forward -275 -268 15.2804 0.0124
NP_442251.1_6 Reverse -268 -275 15.2804 0.0124
NP_440684.1_9 Forward -282 -268 8.94771 0.221
NP_441262.1_3 Reverse -267 -274 14.7888 0.0223
NP_441262.1_3 Forward -276 -269 14.7888 0.0223
NP_443051.1_1 Reverse -266 -275 18.0926 0.00402
NP_443051.1_1 Forward -277 -268 10.4228 0.00754
NP_439937.1_9 Forward -277 -260 -5.37003 0.157
NP_439937.1_9 Reverse -266 -283 -6.94332 0.157
NP_439937.1_9 Reverse -102 -119 -13.1381 0.28
NP_439937.1_9 Reverse -186 -203 -17.0714 0.291
NP_440439.1_1 Forward -279 -266 2.2809 0.136
NP_442239.1_8 Forward -113 -94 11.4058 0.239
NP_439943.1_1 Forward -100 -81 -6.39206 0.237
NP_440372.1_2 Forward -275 -268 16.3621 0.0124
NP_440372.1_2 Reverse -268 -275 16.3621 0.0124
NP_440171.1_3 Forward -199 -180 5.50599 0.284
NP_440574.1_2 Reverse -326 -345 7.37428 0.242
NP_440819.1_5 Reverse -293 -301 7.59091 0.272
NP_441803.1_2 Forward -281 -262 5.211 0.17
NP_440139.1_1 Reverse -261 -280 3.9319 0.194
NP_441572.1_7 Reverse -261 -280 4.12936 0.104
NP_440267.1_2 Reverse -83 -97 8.25877 0.169
NP_442384.1_10 Reverse -267 -280 17.4239 0.00585
NP_442384.1_10 Forward -276 -263 3.5592 0.186
NP_442384.1_10 Reverse -91 -104 0.510939 0.289
NP_441018.1_7 Forward -286 -267 9.24257 0.23
NP_442262.1_10 Forward -275 -268 14.1988 0.0123
NP_442262.1_10 Reverse -268 -275 14.1988 0.0123
NP_441689.1_5 Forward -278 -268 5.78111 0.197
NP_440163.1_10 Reverse -365 -375 12.1731 0.167
NP_440344.1_10 Reverse -260 -277 -0.256152 0.0402
NP_440344.1_10 Forward -283 -266 -7.82764 0.119
NP_441060.1_4 Reverse -73 -91 9.55725 0.186
NP_442910.1_1 Forward -283 -264 -6.09707 0.254
NP_441335.1_8 Forward -115 -96 6.88262 0.281
NP_440562.1_3 Forward -275 -258 7.31533 0.15
NP_441965.1_10 Reverse -264 -280 11.3666 0.107
NP_440297.1_9 Forward -275 -265 9.51814 0.0917
NP_440297.1_9 Reverse -268 -278 -0.118297 0.282
NP_440297.1_9 Reverse -49 -59 -0.216628 0.282
NP_440350.1_5 Forward -222 -203 1.96607 0.158
NP_440350.1_5 Forward -231 -212 -5.70374 0.292
NP_440350.1_5 Reverse -164 -183 -6.1954 0.296
NP_440350.1_5 Reverse -373 -392 -6.88371 0.299
NP_441592.1_4 Reverse -267 -286 5.99764 0.128
NP_441103.1_9 Forward -218 -208 14.931 0.192
NP_440700.1_8 Forward -130 -116 11.5043 0.28
NP_440894.1_10 Forward -117 -98 3.93269 0.261
NP_441894.1_1 Reverse -192 -211 -5.99873 0.282
NP_440999.1_9 Reverse -263 -277 4.42448 0.116
NP_440999.1_9 Forward -280 -266 0.982901 0.172
NP_440888.1_2 Forward -276 -262 10.6187 0.0893
NP_440888.1_2 Reverse -267 -281 9.04542 0.139
NP_442454.1_2 Forward -326 -307 9.88299 0.291
NP_440491.1_1 Reverse -264 -283 8.57379 0.236
NP_439969.1_1 Forward -120 -101 -7.4737 0.297
NP_439969.1_3 Forward -281 -262 4.42435 0.214
NP_442277.1_4 Forward -159 -140 2.6536 0.24
NP_442277.1_4 Reverse -258 -277 2.35861 0.246
NP_442033.1_10 Reverse -265 -284 -7.57203 0.186
NP_441543.1_2 Reverse -268 -277 16.9127 0.00359
NP_441543.1_2 Forward -275 -266 9.34117 0.0818
NP_442845.1_2 Forward -282 -268 13.3726 0.0955
NP_442845.1_2 Reverse -261 -275 4.81781 0.251
NP_441469.1_8 Reverse -266 -275 13.3727 0.073
NP_441469.1_8 Forward -58 -49 10.8161 0.195
NP_441469.1_8 Forward -277 -268 6.48957 0.227
NP_443064.1_6 Forward -276 -266 13.8273 0.0796
NP_443064.1_6 Reverse -267 -277 12.5669 0.0796
NP_442578.1_7 Forward -275 -268 14.5921 0.026
NP_442578.1_7 Reverse -268 -275 14.5921 0.026
NP_440710.1_1 Reverse -112 -130 -8.33898 0.262
NP_441462.1_2 Forward -276 -266 20.1379 0.000967
NP_441462.1_2 Reverse -267 -277 11.5831 0.00406
NP_441621.1_7 Reverse -265 -279 5.01447 0.0934
NP_443062.1_1 Reverse -48 -66 5.23067 0.235
NP_443062.1_1 Reverse -267 -285 3.96308 0.279
NP_443062.1_6 Forward -284 -265 14.7491 0.0802
NP_441601.1_4 Forward -114 -95 -0.885524 0.293
NP_442204.1_1 Forward -280 -269 8.7118 0.0852
NP_442204.1_1 Reverse -256 -267 5.8602 0.186
NP_441560.1_8 Forward -281 -262 19.3038 0.0153
NP_440544.1_5 Forward -73 -66 13.8024 0.28
NP_440516.1_8 Forward -276 -267 16.9127 0.00442
NP_440516.1_8 Reverse -267 -276 16.9127 0.00442
NP_442428.1_4 Forward -277 -258 3.04771 0.247
NP_442428.1_5 Forward -275 -268 15.8704 0.0124
NP_442428.1_5 Reverse -268 -275 15.8704 0.0124
NP_441867.1_2 Reverse -94 -113 -20.3551 0.291
NP_440673.1_3 Forward -274 -267 12.4288 0.0426
NP_440673.1_3 Reverse -269 -276 12.4288 0.0426
NP_440865.1_9 Reverse -261 -280 -4.81876 0.207
NP_441052.1_2 Reverse -267 -277 19.9412 0.00106
NP_441052.1_2 Forward -276 -266 10.4031 0.0285
NP_441052.1_2 Reverse -88 -98 2.43831 0.204
NP_441052.1_2 Reverse -273 -283 1.55333 0.238
NP_442219.1_9 Reverse -268 -277 17.7976 0.00718
NP_442219.1_9 Forward -275 -266 8.25953 0.0681
NP_440436.1_4 Reverse -268 -277 17.2072 0.00233
NP_440436.1_4 Forward -275 -266 15.9289 0.00508
NP_441884.1_9 Reverse -264 -283 -13.9635 0.138
NP_441719.1_4 Forward -275 -268 16.3621 0.0124
NP_441719.1_4 Reverse -268 -275 16.3621 0.0124
NP_441733.1_10 Reverse -264 -277 10.049 0.106
NP_441733.1_10 Forward -279 -266 5.62415 0.21
NP_441733.1_10 Forward -199 -186 5.62415 0.21
NP_441004.1_1 Reverse -261 -280 -16.0285 0.281
NP_441004.1_1 Reverse -98 -117 -17.0118 0.288
NP_441004.1_2 Forward -350 -331 2.3594 0.215
NP_441004.1_5 Forward -200 -186 7.86607 0.282
NP_442813.1_4 Forward -216 -197 13.3725 0.139
NP_442813.1_4 Forward -215 -196 -6.78538 0.299
NP_442366.1_3 Reverse -266 -284 22.8319 0.00586
NP_442366.1_5 Forward -279 -269 14.0409 0.0497
NP_440129.1_4 Reverse -270 -288 15.1613 0.174
NP_440129.1_10 Reverse -361 -375 1.86788 0.293
NP_440296.1_10 Forward -199 -180 -14.4552 0.269
NP_441115.1_4 Forward -277 -259 8.27817 0.254
NP_443054.1_2 Forward -278 -264 10.226 0.0761
NP_443054.1_2 Reverse -258 -272 -0.492064 0.295
NP_440864.1_9 Forward -214 -195 -2.55715 0.177
NP_441851.1_10 Reverse -266 -276 17.4829 0.0027
NP_441851.1_10 Forward -277 -267 15.8113 0.00552
NP_442856.1_7 Reverse -101 -120 -5.9004 0.289
NP_441668.1_4 Forward -166 -147 1.57275 0.212
NP_442515.1_1 Forward -277 -263 7.07942 0.0949
NP_442515.1_1 Reverse -266 -280 -4.91696 0.298
NP_440593.1_3 Reverse -99 -118 -3.14714 0.233
NP_440593.1_3 Reverse -142 -161 -6.68705 0.28
NP_440593.1_3 Forward -117 -98 -7.17871 0.288
NP_441982.1_6 Reverse -292 -301 11.6259 0.288
NP_440355.1_1 Reverse -56 -75 25.8596 0.00512
NP_441349.1_10 Forward -286 -267 8.35759 0.0274
NP_441409.1_6 Forward -282 -263 -10.1286 0.2
NP_441062.1_10 Reverse -110 -129 12.6841 0.099
NP_440474.1_8 Forward -275 -261 10.6187 0.13
NP_441477.1_8 Reverse -126 -145 19.469 0.0729
NP_440431.1_3 Reverse -266 -285 -11.8003 0.291
NP_440431.1_4 Reverse -214 -233 -8.64244 0.275
NP_440431.1_7 Reverse -378 -397 -1.57384 0.297
NP_442450.1_5 Reverse -265 -275 10.1081 0.115
NP_442450.1_5 Forward -278 -268 7.55152 0.13
NP_440588.1_2 Forward -285 -266 23.5989 0.00766
NP_440588.1_2 Forward -278 -259 -4.13045 0.207
NP_440195.1_5 Reverse -261 -280 1.47442 0.287
NP_442006.1_2 Reverse -126 -143 -19.0374 0.297
NP_441003.1_9 Forward -285 -266 4.03102 0.29
NP_442243.1_3 Forward -227 -208 20.3531 0.0863
NP_440078.1_10 Reverse -267 -286 7.47261 0.217
NP_441078.1_4 Forward -276 -267 19.6659 0.0007
NP_441078.1_4 Reverse -267 -276 19.6659 0.0007
NP_442348.1_2 Reverse -368 -377 14.7494 0.146
NP_440793.1_1 Reverse -373 -387 11.602 0.279
NP_440793.1_1 Reverse -382 -396 9.6354 0.293
NP_441094.1_6 Reverse -260 -277 7.70792 0.276
NP_440526.1_3 Forward -275 -264 20.7076 0.0073
NP_440526.1_3 Reverse -268 -279 8.02298 0.126
NP_441432.1_8 Forward -277 -268 16.8143 0.00595
NP_441432.1_8 Reverse -266 -275 8.35786 0.0755
NP_441333.1_1 Reverse -382 -392 12.9245 0.217
NP_441732.1_2 Forward -280 -264 2.12349 0.0253
NP_441732.1_2 Reverse -62 -78 -8.0046 0.105
NP_440760.1_1 Reverse -267 -286 -15.9302 0.16
NP_440760.1_1 Forward -358 -339 -21.24 0.233
NP_442797.1_7 Forward -114 -96 8.27895 0.194
NP_441072.1_2 Reverse -256 -275 13.2741 0.168
NP_440713.1_4 Forward -286 -267 2.85105 0.256
NP_442489.1_7 Forward -276 -267 20.1576 0.000695
NP_442489.1_7 Reverse -267 -276 20.1576 0.000695
NP_440757.1_7 Forward -117 -99 0.904127 0.269
NP_440559.1_1 Reverse -268 -277 17.4043 0.00658
NP_440559.1_1 Forward -275 -266 17.306 0.00658
NP_441659.2_8 Forward -276 -266 19.3512 0.000966
NP_441659.2_8 Reverse -267 -277 18.1713 0.00133
NP_441022.1_1 Forward -147 -138 12.4095 0.232
NP_440363.1_9 Forward -109 -91 12.2122 0.291
NP_441040.1_2 Forward -120 -101 3.6377 0.119
NP_441040.1_2 Forward -284 -265 -13.7669 0.284
NP_441040.1_5 Reverse -262 -281 5.99764 0.229
NP_442346.1_5 Reverse -266 -276 17.9746 0.00128
NP_442346.1_5 Forward -277 -267 16.6963 0.00248
NP_442346.1_5 Reverse -47 -57 6.46988 0.201
NP_442346.1_10 Forward -59 -40 9.3409 0.147
NP_440352.1_5 Reverse -269 -288 12.2664 0.229
NP_440352.1_5 Forward -399 -380 9.83295 0.289
NP_440545.1_3 Forward -280 -263 12.8219 0.0194
NP_440545.1_3 Reverse -263 -280 2.79211 0.0941
NP_441629.1_1 Reverse -259 -278 11.1109 0.154
NP_440555.1_1 Forward -287 -268 0.687771 0.294
NP_440486.1_6 Reverse -266 -285 16.3224 0.207
NP_440010.1_4 Reverse -81 -100 -1.77127 0.268
NP_440010.1_10 Reverse -248 -267 6.68596 0.226
NP_442603.1_7 Reverse -267 -281 11.307 0.117
NP_440449.1_6 Forward -158 -140 5.14342 0.283
NP_440170.1_6 Forward -351 -332 14.3558 0.216
NP_441833.1_4 Forward -275 -268 15.9687 0.0124
NP_441833.1_4 Reverse -268 -275 15.9687 0.0124
NP_443040.1_1 Forward -388 -374 10.0873 0.291
NP_442799.1_8 Reverse -205 -224 6.91701 0.296
NP_441329.1_4 Reverse -297 -315 12.1295 0.251
NP_441329.1_6 Reverse -202 -221 -2.14899 0.293
NP_441895.1_2 Reverse -195 -214 -26.5499 0.24
NP_441895.1_10 Reverse -208 -227 -27.6315 0.282
NP_441112.1_6 Reverse -59 -78 -3.73712 0.296
NP_442162.1_9 Forward -275 -268 16.2637 0.0124
NP_442162.1_9 Reverse -268 -275 16.2637 0.0124
NP_442796.1_2 Reverse -194 -213 20.654 0.0472
NP_442796.1_10 Reverse -198 -217 9.93088 0.249
NP_440671.1_4 Forward -282 -268 10.7177 0.151
NP_440671.1_4 Reverse -261 -275 5.50613 0.281
NP_441973.1_1 Forward -285 -270 0.27489 0.235
NP_440772.1_8 Reverse -116 -135 12.5858 0.253
NP_440204.1_4 Forward -81 -62 1.0811 0.238
NP_442140.1_3 Forward -275 -265 14.828 0.0433
NP_442140.1_3 Reverse -268 -278 12.2714 0.0632
NP_440875.1_9 Forward -274 -264 8.5667 0.233
NP_441813.1_5 Reverse -265 -275 8.92815 0.0347
NP_441813.1_5 Forward -278 -268 8.63316 0.0367
NP_440594.1_8 Forward -275 -262 11.5234 0.152
NP_442254.1_7 Forward -70 -51 15.9291 0.205
NP_440590.1_4 Reverse -268 -281 12.9006 0.013
NP_440590.1_4 Forward -275 -262 4.8375 0.0585
NP_440590.1_4 Forward -106 -93 -5.68391 0.286
NP_440590.1_4 Reverse -89 -102 -5.97891 0.296
NP_440567.1_1 Forward -275 -261 10.3243 0.0377
NP_440567.1_1 Reverse -268 -282 4.03116 0.131
NP_442497.1_10 Forward -275 -266 19.8626 0.00532
NP_442497.1_10 Reverse -268 -277 10.4228 0.0087
NP_440821.1_4 Reverse -265 -275 19.5479 0.00399
NP_440821.1_4 Forward -278 -268 9.41981 0.0286
NP_441239.1_9 Reverse -265 -277 14.4936 0.0272
NP_441239.1_9 Forward -278 -266 6.92215 0.173
NP_441239.1_9 Reverse -102 -114 3.57889 0.283
NP_441009.1_4 Reverse -187 -206 14.9458 0.167
NP_441892.1_1 Reverse -258 -275 -2.61609 0.224
NP_442083.1_9 Reverse -250 -269 8.65258 0.283
NP_440354.1_1 Reverse -9 -27 27.0602 0.000182
NP_442138.1_1 Reverse -46 -65 3.9319 0.24
NP_440412.1_2 Reverse -139 -158 8.06259 0.281
NP_440546.1_4 Forward -276 -266 12.8578 0.0572
NP_440546.1_4 Reverse -267 -277 10.046 0.109
NP_440462.1_6 Reverse -265 -275 10.4031 0.0396
NP_440462.1_6 Forward -278 -268 1.35667 0.294
NP_442340.1_3 Forward -55 -36 -7.27704 0.23
NP_442611.1_1 Reverse -98 -117 3.73603 0.206
NP_440868.1_4 Forward -280 -268 6.1355 0.0878
NP_440868.1_4 Reverse -263 -275 0.825626 0.199
NP_441582.1_5 Forward -278 -259 8.35677 0.164
NP_441474.1_1 Forward -270 -251 4.12856 0.221
NP_442402.1_4 Reverse -240 -259 -10.1294 0.297
NP_442402.1_10 Forward -302 -292 13.9425 0.182
NP_441848.1_9 Forward -270 -259 13.2345 0.263
NP_442039.1_4 Forward -275 -268 15.1821 0.0124
NP_442039.1_4 Reverse -268 -275 15.1821 0.0124
NP_442039.1_4 Forward -136 -129 8.69224 0.172
NP_441811.1_8 Reverse -261 -275 9.04604 0.227
NP_441811.1_8 Forward -282 -268 5.80112 0.289
NP_442380.1_10 Reverse -93 -111 9.36059 0.262
NP_441926.1_3 Forward -276 -260 6.15506 0.17
NP_440825.1_7 Reverse -268 -278 12.9096 0.152
NP_442837.1_3 Forward -275 -268 15.7721 0.0124
NP_442837.1_3 Reverse -268 -275 15.7721 0.0124
NP_442053.1_1 Forward -276 -267 18.3876 0.0007
NP_442053.1_1 Reverse -267 -276 18.3876 0.0007
NP_440505.1_3 Forward -278 -268 9.22315 0.122
NP_440505.1_3 Reverse -265 -275 7.84651 0.147
NP_440505.1_3 Reverse -52 -62 5.19158 0.241
NP_440351.1_8 Forward -167 -149 9.65558 0.191
NP_441203.1_1 Reverse -268 -287 -19.6667 0.297
NP_441408.2_7 Reverse -265 -284 5.70265 0.172
NP_440914.1_1 Reverse -267 -277 17.5935 0.000537
NP_440914.1_1 Forward -276 -266 8.51751 0.186
NP_441011.1_8 Forward -275 -266 14.356 0.0249
NP_441011.1_8 Reverse -268 -277 8.25953 0.144
NP_442533.1_6 Forward -276 -267 17.2076 0.00137
NP_442533.1_6 Reverse -267 -276 17.2076 0.00137
NP_442533.1_6 Forward -269 -260 2.65466 0.246
NP_442533.1_6 Forward -57 -48 2.06468 0.275
NP_442541.1_3 Reverse -93 -112 5.50599 0.244
NP_440854.1_2 Forward -197 -178 13.1758 0.26
NP_442229.1_1 Forward -278 -264 6.98048 0.2
NP_441482.1_7 Forward -282 -268 -8.45687 0.193
NP_439944.1_9 Forward -275 -265 17.4829 0.00423
NP_439944.1_9 Reverse -268 -278 10.5014 0.0887
NP_439944.1_9 Reverse -142 -152 5.87989 0.214
NP_442203.1_3 Reverse -296 -315 6.51289 0.266
NP_441028.1_6 Reverse -182 -192 12.0743 0.192
NP_441028.1_6 Reverse -145 -155 3.42118 0.296
NP_440116.1_5 Forward -279 -262 5.25038 0.176
NP_440116.1_8 Forward -275 -256 -3.83545 0.158
NP_441527.1_4 Reverse -206 -225 1.00224 0.134
NP_441527.1_4 Forward -392 -373 -0.907597 0.146
NP_441527.1_4 Reverse -200 -219 -4.63178 0.188
NP_441527.1_4 Reverse -205 -224 -8.73794 0.25
NP_441527.1_4 Forward -393 -374 -9.78835 0.262
NP_441527.1_4 Reverse -215 -234 -10.7433 0.274
NP_441527.1_4 Reverse -203 -222 -11.5072 0.282
NP_441527.1_4 Reverse -69 -88 -12.3666 0.285
NP_441527.1_4 Forward -395 -376 -12.4621 0.288
NP_441527.1_4 Reverse -216 -235 -13.0351 0.298
NP_440115.1_6 Reverse -264 -274 10.1081 0.115
NP_440115.1_6 Forward -279 -269 9.32148 0.115
NP_440007.1_9 Reverse -263 -277 0.687908 0.292
NP_441680.1_4 Forward -379 -360 -3.24547 0.288
NP_441059.1_10 Reverse -209 -222 12.114 0.229
NP_441106.1_1 Reverse -266 -275 9.73449 0.0311
NP_441106.1_1 Forward -277 -268 9.63616 0.0311
NP_441420.1_1 Forward -277 -258 10.8159 0.118
NP_440429.1_4 Reverse -260 -279 16.2241 0.242
NP_439903.1_6 Reverse -264 -283 0.490334 0.261
NP_441286.1_1 Forward -277 -265 24.2284 0.000758
NP_441286.1_1 Reverse -266 -278 3.48056 0.0467
NP_440670.1_8 Forward -276 -267 18.3876 0.000699
NP_440670.1_8 Reverse -267 -276 18.3876 0.000699
NP_440886.1_7 Reverse -266 -276 8.04271 0.0805
NP_440886.1_7 Forward -277 -267 7.94438 0.0805
NP_440886.1_7 Forward -270 -260 6.0761 0.147
NP_440886.1_7 Reverse -186 -196 5.19112 0.194
NP_440886.1_7 Reverse -348 -358 5.09279 0.201
NP_442614.1_2 Forward -276 -262 13.6676 0.122
NP_442614.1_2 Reverse -267 -281 8.25939 0.255
NP_442072.1_9 Forward -277 -259 -2.0458 0.0316
NP_442072.1_9 Reverse -266 -284 -21.6137 0.211
NP_441403.1_6 Reverse -170 -189 15.0441 0.21
NP_440907.2_8 Forward -275 -265 19.449 0.00351
NP_440907.2_8 Reverse -268 -278 7.64939 0.117
NP_440907.2_8 Reverse -188 -198 5.78111 0.188
NP_441021.1_1 Forward -275 -256 5.60432 0.0704
NP_441463.1_3 Reverse -90 -109 -10.3253 0.293
NP_441626.1_2 Forward -275 -268 15.7721 0.0124
NP_441626.1_2 Reverse -268 -275 15.7721 0.0124
NP_441460.1_1 Reverse -302 -321 15.8987 0.228
NP_442794.1_1 Forward -280 -268 21.9668 0.00123
NP_442615.1_1 Forward -285 -267 14.5721 0.00963
NP_442615.1_1 Reverse -258 -276 11.4255 0.0179
NP_442615.1_1 Forward -205 -187 -7.25734 0.283
NP_442467.1_3 Forward -69 -55 16.937 0.257
NP_441962.1_4 Reverse -98 -117 -4.6221 0.158
NP_441962.1_4 Reverse -262 -281 -9.047 0.211
NP_441742.1_4 Reverse -261 -280 12.7825 0.293
NP_440387.1_1 Reverse -267 -283 5.36841 0.0325
NP_440387.1_1 Forward -276 -260 1.33684 0.106
NP_441431.1_2 Reverse -264 -278 16.2235 0.0387
NP_441431.1_2 Reverse -100 -114 5.70218 0.291
NP_442020.1_1 Forward -386 -367 0.293673 0.255
NP_441488.1_8 Forward -281 -267 12.782 0.146
NP_441836.1_1 Forward -287 -268 12.9603 0.232
NP_441836.1_2 Reverse -261 -280 -3.3438 0.237
NP_441993.1_1 Forward -282 -263 3.89583 0.227
NP_442352.1_10 Forward -59 -41 3.06741 0.246
NP_440814.1_4 Reverse -258 -277 -11.3086 0.224
NP_440814.1_4 Forward -285 -266 -12.3902 0.23
NP_440114.1_10 Forward -276 -262 14.1593 0.0429
NP_442698.1_10 Reverse -269 -288 5.50599 0.238
NP_441156.1_2 Reverse -216 -232 18.5322 0.175
NP_440293.1_3 Forward -284 -265 -6.68705 0.291
NP_440293.1_9 Reverse -161 -175 11.0544 0.261
NP_440766.1_4 Forward -280 -266 6.19444 0.104
NP_440766.1_5 Reverse -291 -303 13.3853 0.222
NP_441237.1_9 Forward -275 -265 17.2863 0.00348
NP_441237.1_9 Reverse -268 -278 14.828 0.0242
NP_439910.1_2 Reverse -259 -276 -21.299 0.183
NP_440457.1_1 Reverse -263 -275 17.7386 0.0426
NP_440457.1_1 Forward -200 -188 6.62715 0.116
NP_440457.1_1 Forward -280 -268 -0.452677 0.263
NP_440213.1_5 Forward -294 -275 6.98095 0.297
NP_440798.1_6 Forward -275 -262 2.2809 0.182
NP_440142.1_7 Reverse -268 -287 5.40766 0.289
NP_441984.1_1 Reverse -261 -279 6.80398 0.283
NP_442509.1_9 Forward -276 -266 17.3841 0.00128
NP_442509.1_9 Reverse -267 -277 8.14104 0.192
NP_442509.1_9 Reverse -91 -101 5.97777 0.298
NP_441496.1_1 Forward -309 -295 17.4866 0.265
NP_442514.1_5 Reverse -139 -158 -3.04956 0.222
NP_442514.1_5 Forward -164 -145 -7.3761 0.276
NP_442514.1_5 Reverse -120 -139 -8.35941 0.285
NP_441159.1_6 Reverse -326 -345 5.99764 0.164
NP_440554.1_4 Forward -275 -265 6.27322 0.123
NP_442737.1_5 Forward -372 -353 13.2668 0.239
NP_441885.1_5 Reverse -267 -277 20.9245 0.000538
NP_441885.1_5 Forward -276 -266 11.3864 0.00668
NP_440628.1_1 Forward -392 -382 14.6456 0.248
NP_442703.1_4 Reverse -267 -286 0.981987 0.284
NP_442341.1_7 Reverse -266 -280 13.8643 0.0334
NP_442341.1_7 Forward -277 -263 9.34103 0.0751
NP_442341.1_9 Forward -271 -257 4.91554 0.287
NP_441173.1_9 Forward -300 -292 14.3753 0.161
NP_441173.1_9 Forward -299 -291 10.2454 0.261
NP_442395.2_4 Reverse -97 -116 1.76863 0.234
NP_440423.1_6 Reverse -259 -278 -21.24 0.284
NP_443000.1_7 Forward -278 -268 10.3048 0.0345
NP_443000.1_7 Reverse -265 -275 2.14332 0.226
NP_440275.1_3 Reverse -265 -275 19.5479 0.00756
NP_440275.1_3 Forward -278 -268 8.04317 0.0602
NP_440091.1_1 Reverse -263 -275 12.7237 0.0353
NP_442451.1_2 Forward -284 -265 -10.3253 0.267
NP_441122.1_1 Forward -287 -272 4.50312 0.28
NP_440880.1_2 Reverse -19 -38 18.6683 0.124
NP_440149.1_8 Forward -63 -44 -4.91709 0.215
NP_441105.1_3 Forward -287 -268 3.44104 0.0917
NP_441105.1_3 Reverse -136 -155 -3.83545 0.185
NP_440216.1_1 Forward -276 -262 7.66941 0.00931
NP_440216.1_1 Reverse -267 -281 -10.2268 0.145
NP_440216.1_9 Reverse -77 -86 7.37455 0.286
NP_440216.1_9 Forward -399 -390 7.27622 0.286
NP_440216.1_9 Reverse -275 -284 5.99792 0.289
NP_440172.1_1 Forward -276 -266 16.303 0.00854
NP_440172.1_1 Reverse -267 -277 15.0247 0.00945
NP_442015.1_10 Forward -280 -267 19.8821 0.00366
NP_441226.1_7 Forward -275 -268 14.4934 0.0123
NP_441226.1_7 Reverse -268 -275 14.4934 0.0123
NP_441111.1_7 Forward -275 -267 18.7023 0.00294
NP_441111.1_7 Reverse -268 -276 18.7023 0.00294
NP_441766.1_2 Forward -276 -267 17.5026 0.00297
NP_441766.1_2 Reverse -267 -276 17.5026 0.00297
NP_440416.1_9 Forward -283 -264 -6.09707 0.0854
NP_440416.1_9 Forward -215 -196 -22.0267 0.3
NP_443052.1_8 Forward -107 -88 -8.85033 0.179
NP_443052.1_9 Reverse -93 -112 -0.983855 0.219
NP_442564.1_10 Reverse -103 -117 10.4227 0.29
NP_442564.1_10 Reverse -192 -206 8.06273 0.296
NP_440261.1_5 Forward -275 -262 6.70579 0.0318
NP_440261.1_5 Reverse -268 -281 -2.83231 0.0932
NP_440988.1_10 Reverse -52 -66 10.7076 0.187
NP_440988.1_10 Reverse -265 -279 6.54464 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACCAGGGAAAACAGAAAAATAGCAACAATGCCCGTTGTGAAGGGAGTTAGGCGAAGCTTCGGGAACTGGTTAAGCATTGAAGTTCAATCAATTCAATTATTTTTCCCAAAACCGTTTTGTCCTTGGCGATCGCCCCTCACCTTGATGCTAAATTCGGCTAACTGACAATTTATCTTTACTCTTCTTCCCCTTCTTCTTCTGCGGGGGGATAGAGGAAAGTAGAACGGCCAGATAAAATGGATTTGCCGAGGGACAAAGCCTTTTGCGCTTGGGAGGAAGCTTGTCTGCGCCAGTGGGCCCGGCGTTGATCACGTTTTGCTTTGGAGGTTTTCTTCTTGGGAACTGCCATGACTTCTCTGGGATCTTAAAAATTGACAACCTTTCTATATTACGCTTTTAG

CDS

GTGGGCCATTGCACAGCGGTGATTATGCAAGAGTTTTCCCACTATTACGAAATCCTGGGGCTAGAGGTAGGGGCTAGTCTGGAGGAAATCAATGAAGCCTATCGAGATTTAGCCTTTGTTTGGCACCCCGATCGCCTGCCCAGGGACAATCCCCGCCTATTGGCCAAAGCGGCCAGGAAACTCAAAGAAATTAACCAAGCCCGCGATCGCCTCAAGGAATTATTGGAGCTGGAGTTAAGCGCTAAAACTTCCCAGATTCCTAAAAAGGACCAGACCAGCAAAGCTCCCAAAGCTAAACCCAAATCCAAGCCCAAGGCCACATCTCCTCCACCTTACCCGCCCCCCGGCGATCGTCCACCTCAATCCCATCACCATCATCACCAGACCAACCACAACCACAGTTCCAGTTCCCAGCACCATCACCAAGAAAACCACAATCGACCCTACTATCGGGACTTAACCGGGGCAGATTTGCGTTGGGCTAATTTAAAAGAGAAGGATTTGTCAGGACGGAAAATGGTGTCTGCCAATCTAAGTAATGCAGATTTGAGCGACAGTTTTTTACACCAAGTTAATTTGGAAAATGCCAATCTTTTTCGGGCTAATCTTTTCCGGGCCAATTTGTTGGAAGCTAATCTGCGGGGAGCTAATTTGCAGGAAGCTAATCTGGTAGGAGCAGATTTAAGTGGGGCGGATCTGAGTGGAGCTAATTTACAGGGAGCCAAAATTGGCGCAGGTAATCGAATTATGGTCAAACTAACGGCCGCTAAGTTGACGGGAACTATTCTCCCCGATGGCACTAAGCATAGTTAG

Protein

MGHCTAVIMQEFSHYYEILGLEVGASLEEINEAYRDLAFVWHPDRLPRDNPRLLAKAARKLKEINQARDRLKELLELELSAKTSQIPKKDQTSKAPKAKPKSKPKATSPPPYPPPGDRPPQSHHHHHQTNHNHSSSSQHHHQENHNRPYYRDLTGADLRWANLKEKDLSGRKMVSANLSNADLSDSFLHQVNLENANLFRANLFRANLLEANLRGANLQEANLVGADLSGADLSGANLQGAKIGAGNRIMVKLTAAKLTGTILPDGTKHS