Your browser is old and dusty. Try Google Chrome!

Details for sll1005

ORF sll1005
Accession NP_440363.1
Symbol
Category MazG protein homolog
Definition Regulatory functions
Regulatory function Yes
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -284 -298 3.14618 0.168
NP_441061.1_2 Reverse -206 -220 2.16287 0.178
NP_441061.1_2 Reverse -153 -167 1.47456 0.188
NP_441061.1_2 Forward -348 -334 -0.983719 0.246
NP_440557.1_1 Forward -336 -317 -2.26216 0.286
NP_440795.1_7 Forward -336 -329 14.6904 0.0123
NP_440795.1_7 Reverse -329 -336 14.6904 0.0123
NP_440795.1_7 Forward -207 -200 9.77388 0.169
NP_441418.1_6 Forward -337 -318 -13.0786 0.073
NP_441418.1_6 Reverse -328 -347 -28.1232 0.203
NP_440815.1_5 Reverse -328 -347 21.2389 0.0856
NP_441453.1_1 Reverse -321 -339 10.0481 0.141
NP_441453.1_4 Reverse -328 -336 16.539 0.00633
NP_441453.1_4 Forward -337 -329 16.539 0.00633
NP_441623.1_1 Reverse -138 -156 -1.45582 0.24
NP_442151.1_6 Forward -337 -323 13.0776 0.0599
NP_442151.1_6 Reverse -328 -342 10.6193 0.119
NP_442151.1_6 Reverse -199 -213 5.70279 0.266
NP_441818.1_1 Forward -336 -325 8.51463 0.288
NP_441818.1_9 Forward -385 -366 13.7658 0.106
NP_441818.1_9 Forward -314 -295 -5.21209 0.251
NP_440226.1_1 Forward -337 -318 9.93088 0.0679
NP_440226.1_1 Reverse -328 -347 9.24257 0.0754
NP_441630.1_3 Forward -345 -326 6.19431 0.129
NP_442623.1_3 Reverse -329 -348 -8.45701 0.127
NP_442287.1_1 Forward -180 -170 13.0576 0.288
NP_442173.1_1 Forward -336 -328 15.4574 0.00633
NP_442173.1_1 Reverse -329 -337 15.4574 0.00633
NP_442752.1_4 Forward -337 -330 13.8055 0.0199
NP_442752.1_4 Reverse -328 -335 13.8055 0.0199
NP_442752.1_4 Forward -298 -291 9.18389 0.116
NP_443027.1_4 Reverse -326 -336 7.35486 0.24
NP_441812.1_3 Forward -338 -324 9.73436 0.233
NP_442975.1_10 Forward -54 -40 3.44058 0.259
NP_440784.1_7 Forward -336 -329 15.9687 0.0123
NP_440784.1_7 Reverse -329 -336 15.9687 0.0123
NP_441250.1_3 Reverse -98 -117 2.65439 0.27
NP_440061.1_9 Forward -339 -325 11.7003 0.107
NP_440061.1_9 Forward -210 -196 6.39049 0.248
NP_440110.1_8 Forward -385 -366 -3.44213 0.297
NP_439979.1_9 Forward -219 -201 9.95058 0.231
NP_442062.1_8 Forward -337 -327 17.6796 0.00193
NP_442062.1_8 Reverse -328 -338 17.3846 0.00193
NP_441859.1_2 Reverse -206 -225 23.4013 0.042
NP_440304.1_4 Reverse -326 -336 18.9579 0.00406
NP_440304.1_4 Forward -339 -329 1.84832 0.299
NP_442242.1_4 Forward -336 -329 14.3954 0.0124
NP_442242.1_4 Reverse -329 -336 14.3954 0.0124
NP_440916.1_1 Forward -52 -38 17.2075 0.161
NP_441208.1_9 Forward -340 -326 6.98109 0.229
NP_442196.1_10 Reverse -229 -248 10.1275 0.268
NP_442742.1_9 Reverse -360 -379 -13.1769 0.269
NP_442110.1_7 Reverse -328 -342 0.786239 0.248
NP_440856.1_4 Forward -344 -325 0.982764 0.161
NP_441083.1_5 Reverse -328 -338 20.3345 0.00053
NP_441083.1_5 Forward -337 -327 19.3512 0.000718
NP_441738.1_2 Forward -335 -328 15.28 0.0102
NP_441738.1_2 Reverse -330 -337 15.28 0.0102
NP_441738.1_2 Reverse -148 -155 8.29857 0.176
NP_440209.1_1 Reverse -328 -336 18.1123 0.00295
NP_440209.1_1 Forward -337 -329 18.1123 0.00295
NP_442889.1_8 Reverse -325 -339 11.307 0.0733
NP_441713.1_1 Reverse -322 -341 -2.16383 0.113
NP_441713.1_8 Forward -99 -81 7.68896 0.294
NP_441770.1_4 Reverse -94 -113 -4.42544 0.204
NP_440178.1_7 Reverse -327 -346 -13.0786 0.129
NP_442570.1_3 Forward -345 -326 -2.45882 0.212
NP_442445.1_1 Reverse -172 -191 12.1925 0.266
NP_441716.1_1 Forward -337 -323 11.406 0.0936
NP_441716.1_1 Reverse -328 -342 4.32615 0.256
NP_441327.1_5 Reverse -273 -282 14.651 0.192
NP_442111.1_3 Forward -57 -44 16.9638 0.144
NP_442111.1_4 Forward -338 -324 10.9143 0.0518
NP_442111.1_4 Reverse -327 -341 7.86607 0.0849
NP_440343.1_3 Forward -185 -167 2.67334 0.291
NP_440906.1_5 Forward -336 -329 15.8704 0.0124
NP_440906.1_5 Reverse -329 -336 15.8704 0.0124
NP_440747.1_10 Forward -340 -328 24.7201 0.00036
NP_440747.1_10 Reverse -325 -337 7.80712 0.00223
NP_440747.1_10 Reverse -196 -208 -12.0557 0.199
NP_441486.1_1 Forward -340 -326 12.8809 0.00979
NP_441486.1_1 Reverse -325 -339 5.80112 0.0344
NP_442634.1_4 Forward -339 -325 -1.77037 0.149
NP_442634.1_4 Reverse -326 -340 -2.75368 0.156
NP_442634.1_4 Forward -371 -357 -5.50694 0.258
NP_441265.1_3 Forward -343 -329 4.42448 0.181
NP_441014.1_10 Reverse -151 -170 -0.0996487 0.246
NP_441014.1_10 Forward -142 -123 -2.36125 0.274
NP_441014.1_10 Forward -338 -319 -3.44288 0.3
NP_442848.1_1 Forward -167 -153 3.63784 0.128
NP_443018.1_3 Forward -336 -329 14.8871 0.0123
NP_443018.1_3 Reverse -329 -336 14.8871 0.0123
NP_441316.1_7 Reverse -326 -341 4.60145 0.124
NP_440376.1_1 Forward -337 -328 19.4693 0.000692
NP_440376.1_1 Reverse -328 -337 19.4693 0.000692
NP_440376.1_1 Reverse -224 -233 -1.18024 0.294
NP_441588.1_4 Reverse -330 -340 9.02648 0.14
NP_442730.1_8 Forward -345 -326 22.418 0.0559
NP_440266.1_1 Forward -331 -312 13.3725 0.274
NP_442687.1_7 Reverse -327 -337 18.5646 0.0028
NP_442687.1_7 Reverse -198 -208 13.7464 0.0426
NP_442687.1_7 Forward -338 -328 8.92815 0.0994
NP_442687.1_7 Reverse -223 -233 3.91327 0.278
NP_441077.1_6 Reverse -348 -364 1.64498 0.299
NP_441077.1_6 Reverse -224 -240 1.64498 0.299
NP_441950.1_7 Reverse -166 -185 -3.54046 0.211
NP_442296.1_9 Reverse -329 -348 1.86774 0.186
NP_442658.1_1 Reverse -326 -336 14.8275 0.0188
NP_442658.1_1 Forward -169 -159 7.55106 0.214
NP_442658.1_1 Forward -339 -329 6.76441 0.214
NP_442782.1_2 Forward -298 -284 2.5562 0.275
NP_442782.1_2 Forward -369 -355 -0.000409212 0.297
NP_441414.1_9 Reverse -328 -347 5.89931 0.0437
NP_441487.1_6 Forward -345 -326 13.5691 0.175
NP_441317.1_4 Forward -397 -383 11.1828 0.259
NP_441317.1_4 Forward -321 -307 10.3234 0.29
NP_441958.1_5 Reverse -327 -337 20.5312 0.000966
NP_441958.1_5 Forward -338 -328 12.2714 0.00183
NP_440610.1_1 Reverse -279 -298 13.2741 0.234
NP_442836.1_10 Reverse -170 -180 11.1898 0.269
NP_440203.1_5 Forward -334 -324 13.4509 0.115
NP_440203.1_5 Reverse -331 -341 10.5993 0.218
NP_441754.1_6 Forward -175 -156 13.7658 0.155
NP_440984.1_7 Forward -342 -328 9.43936 0.127
NP_440984.1_7 Forward -231 -217 4.81781 0.287
NP_439990.1_5 Reverse -323 -336 8.08242 0.181
NP_439990.1_5 Forward -214 -201 6.01747 0.261
NP_442690.1_1 Forward -323 -304 -12.0953 0.238
NP_442911.1_2 Reverse -318 -337 1.96607 0.0549
NP_442911.1_2 Forward -347 -328 0.58944 0.0657
NP_440153.1_8 Reverse -199 -212 -3.12731 0.285
NP_442064.1_1 Reverse -323 -342 -13.1769 0.285
NP_443055.1_3 Reverse -319 -338 13.9873 0.151
NP_443055.1_6 Reverse -144 -162 4.24662 0.184
NP_440993.1_4 Reverse -328 -345 4.75873 0.272
NP_439975.1_2 Reverse -165 -183 8.96727 0.215
NP_441099.1_5 Forward -347 -328 -10.7186 0.261
NP_442002.1_9 Reverse -327 -334 14.1004 0.074
NP_442002.1_9 Forward -156 -149 12.8221 0.185
NP_442567.1_4 Reverse -139 -158 8.84924 0.29
NP_441294.1_7 Reverse -260 -274 9.53859 0.241
NP_442438.1_10 Forward -342 -328 11.996 0.0412
NP_442438.1_10 Forward -213 -199 0.88457 0.213
NP_442431.1_10 Forward -220 -202 -0.275845 0.287
NP_441000.1_6 Reverse -327 -341 -3.93365 0.225
NP_442771.1_1 Reverse -326 -344 -4.20908 0.166
NP_440147.1_4 Forward -339 -326 11.6223 0.0326
NP_440147.1_4 Forward -235 -222 6.90245 0.0803
NP_440147.1_4 Reverse -326 -339 4.05085 0.173
NP_440147.1_4 Reverse -120 -133 1.39592 0.23
NP_441550.1_8 Reverse -326 -336 15.4175 0.0132
NP_441550.1_8 Forward -339 -329 14.6309 0.0132
NP_441916.1_7 Forward -337 -327 16.893 0.00407
NP_441916.1_7 Reverse -328 -338 10.3048 0.0261
NP_441041.1_4 Reverse -328 -347 -3.3438 0.121
NP_441041.1_4 Forward -220 -201 -8.752 0.207
NP_441041.1_4 Forward -226 -207 -10.522 0.233
NP_441041.1_7 Reverse -325 -337 9.94422 0.104
NP_441041.1_7 Forward -340 -328 8.58373 0.133
NP_442396.1_5 Forward -341 -328 10.639 0.106
NP_442004.1_6 Forward -337 -323 7.57108 0.159
NP_442004.1_6 Reverse -328 -342 5.40779 0.191
NP_442004.1_6 Forward -298 -284 2.65453 0.26
NP_441725.1_5 Forward -336 -326 21.0229 0.00533
NP_441725.1_5 Reverse -329 -339 2.04498 0.115
NP_439966.1_7 Reverse -326 -336 9.12434 0.119
NP_439966.1_7 Forward -339 -329 7.25606 0.15
NP_440202.1_8 Reverse -320 -339 16.6147 0.202
NP_442941.1_3 Forward -336 -326 11.3864 0.0116
NP_442941.1_3 Reverse -329 -339 11.0914 0.0116
NP_440289.1_2 Reverse -325 -338 13.0973 0.0132
NP_440289.1_2 Reverse -221 -234 5.82081 0.0605
NP_440289.1_2 Forward -340 -327 -2.144 0.251
NP_440260.1_8 Forward -346 -328 -3.02911 0.246
NP_442281.1_1 Reverse -323 -337 11.7003 0.0438
NP_442281.1_1 Forward -342 -328 9.6354 0.0684
NP_441334.1_7 Reverse -326 -345 -21.0434 0.287
NP_440177.1_5 Reverse -368 -387 12.5858 0.268
NP_442256.1_2 Reverse -326 -344 -5.97904 0.214
NP_440437.1_1 Forward -343 -324 -2.55715 0.219
NP_442012.1_1 Forward -343 -324 0.687771 0.235
NP_441556.1_10 Forward -343 -329 10.9032 0.253
NP_440498.1_1 Forward -346 -328 -1.65248 0.228
NP_440375.1_8 Reverse -329 -348 -0.983855 0.277
NP_441644.1_6 Reverse -328 -338 17.3841 0.00127
NP_441644.1_6 Forward -337 -327 15.7125 0.0048
NP_441644.1_6 Forward -208 -198 8.14104 0.106
NP_442215.1_1 Reverse -324 -343 1.96607 0.296
NP_442215.1_2 Forward -339 -323 12.8416 0.0271
NP_442215.1_2 Reverse -326 -342 4.68009 0.0831
NP_442215.1_2 Reverse -150 -166 -0.43312 0.167
NP_442215.1_2 Reverse -197 -213 -4.07137 0.227
NP_442029.1_6 Reverse -172 -191 3.24438 0.282
NP_440929.1_8 Forward -337 -328 19.2726 0.000701
NP_440929.1_8 Reverse -328 -337 19.2726 0.000701
NP_440566.1_1 Reverse -35 -54 22.8122 0.051
NP_442933.1_10 Forward -337 -328 17.601 0.00325
NP_442933.1_10 Reverse -328 -337 17.601 0.00325
NP_441751.2_8 Forward -336 -322 12.6843 0.0191
NP_441751.2_8 Reverse -329 -343 -0.0987402 0.125
NP_442554.1_8 Reverse -329 -339 15.3197 0.00882
NP_442554.1_8 Forward -336 -326 14.828 0.0108
NP_442554.1_8 Reverse -206 -216 2.92996 0.249
NP_441762.1_7 Reverse -327 -339 8.9871 0.0142
NP_441762.1_7 Forward -338 -326 -6.94252 0.284
NP_442142.1_4 Reverse -325 -338 15.1616 0.0289
NP_442142.1_4 Forward -340 -327 5.52525 0.188
NP_442142.1_4 Reverse -155 -168 3.36198 0.258
NP_442292.1_1 Reverse -329 -338 18.486 0.00229
NP_442292.1_1 Forward -336 -327 9.53783 0.0183
NP_440919.1_1 Forward -245 -226 -6.68705 0.258
NP_442476.1_6 Reverse -329 -343 1.08123 0.231
NP_442476.1_6 Forward -336 -322 0.196253 0.269
NP_443009.1_5 Forward -338 -327 15.7911 0.0107
NP_443009.1_5 Reverse -327 -338 11.1696 0.066
NP_441371.1_3 Reverse -94 -112 6.80398 0.277
NP_441715.1_4 Reverse -329 -339 7.94484 0.107
NP_441715.1_4 Forward -336 -326 7.25653 0.108
NP_441198.1_8 Reverse -326 -336 13.076 0.108
NP_440379.1_5 Forward -386 -367 -10.522 0.28
NP_440464.1_10 Reverse -329 -339 13.0082 0.169
NP_441468.1_1 Forward -336 -329 15.8704 0.0124
NP_441468.1_1 Reverse -329 -336 15.8704 0.0124
NP_441020.2_6 Reverse -326 -343 9.47861 0.17
NP_441020.2_6 Forward -339 -322 8.00365 0.212
NP_441015.1_8 Reverse -376 -395 5.80098 0.258
NP_441015.1_10 Reverse -323 -342 -7.86702 0.272
NP_441673.1_1 Forward -337 -328 20.8459 0.000698
NP_441673.1_1 Reverse -328 -337 20.8459 0.000698
NP_441673.1_1 Reverse -224 -233 -8.06341 0.254
NP_441673.1_1 Forward -208 -199 -8.06341 0.254
NP_441876.1_9 Forward -229 -219 11.2876 0.278
NP_441826.1_2 Forward -343 -329 5.40779 0.0975
NP_441826.1_2 Reverse -322 -336 3.04785 0.115
NP_441826.1_2 Reverse -218 -232 -3.93365 0.29
NP_441330.1_1 Forward -172 -153 -8.35868 0.183
NP_442868.1_6 Forward -339 -329 9.81313 0.038
NP_442868.1_6 Reverse -326 -336 9.22315 0.0527
NP_442868.1_6 Reverse -197 -207 -0.314959 0.284
NP_442719.1_2 Reverse -92 -110 -8.63467 0.252
NP_442677.1_3 Forward -236 -217 -7.08038 0.287
NP_441612.1_2 Reverse -224 -234 13.874 0.21
NP_441612.1_2 Reverse -388 -398 8.83972 0.21
NP_441612.1_2 Reverse -328 -338 8.54929 0.21
NP_442227.1_2 Reverse -151 -170 -3.54046 0.293
NP_442361.1_3 Forward -343 -330 7.98409 0.285
NP_442427.1_8 Reverse -319 -338 6.09597 0.249
NP_442808.1_1 Reverse -327 -337 8.73102 0.0481
NP_442808.1_1 Forward -338 -328 8.63269 0.0481
NP_442808.1_1 Reverse -367 -377 4.30615 0.2
NP_442113.1_5 Reverse -203 -222 5.50519 0.294
NP_442050.1_5 Reverse -326 -336 15.8108 0.0091
NP_442050.1_5 Forward -339 -329 7.64939 0.243
NP_441878.1_6 Reverse -327 -337 20.2362 0.0046
NP_441878.1_6 Forward -338 -328 10.4031 0.0176
NP_441878.1_6 Reverse -198 -208 -0.118297 0.167
NP_441878.1_6 Reverse -223 -233 -7.0998 0.204
NP_441878.1_6 Forward -209 -199 -7.19813 0.21
NP_441036.1_8 Reverse -327 -337 8.4365 0.174
NP_441036.1_8 Forward -338 -328 8.33817 0.174
NP_441557.1_5 Forward -337 -328 19.9609 0.000699
NP_441557.1_5 Reverse -328 -337 19.9609 0.000699
NP_441445.1_1 Reverse -319 -338 17.8957 0.0293
NP_441445.1_1 Forward -346 -327 7.07928 0.138
NP_441590.1_4 Reverse -285 -304 9.24175 0.249
NP_442267.1_4 Forward -103 -84 0.687771 0.285
NP_442066.2_4 Forward -233 -214 -1.57384 0.196
NP_442777.1_1 Reverse -151 -170 4.42355 0.3
NP_441739.1_2 Reverse -99 -115 12.5458 0.132
NP_440101.1_3 Forward -342 -323 0.58944 0.297
NP_441458.1_10 Reverse -319 -338 3.04771 0.256
NP_442183.1_1 Forward -337 -323 10.3243 0.0857
NP_442183.1_9 Forward -211 -201 10.1081 0.296
NP_440356.1_9 Reverse -375 -394 13.1758 0.198
NP_441549.1_9 Reverse -324 -342 2.28076 0.0963
NP_441238.1_10 Forward -379 -365 9.63603 0.295
NP_442347.1_2 Reverse -329 -338 12.4878 0.056
NP_442347.1_2 Forward -336 -327 3.34298 0.284
NP_442645.1_2 Forward -345 -326 -22.9117 0.299
NP_442888.1_6 Forward -178 -159 2.75272 0.249
NP_441037.1_4 Reverse -326 -336 9.65667 0.21
NP_441037.1_4 Forward -339 -329 7.9999 0.237
NP_442594.1_10 Forward -345 -326 10.9134 0.272
NP_441633.1_3 Forward -339 -326 10.5407 0.0286
NP_440136.1_2 Forward -336 -329 15.9687 0.0123
NP_440136.1_2 Reverse -329 -336 15.9687 0.0123
NP_442998.1_5 Reverse -142 -152 13.0581 0.158
NP_442998.1_5 Reverse -58 -68 11.9764 0.176
NP_442998.1_10 Forward -335 -328 15.5754 0.0102
NP_442998.1_10 Reverse -330 -337 15.5754 0.0102
NP_440899.1_2 Reverse -317 -336 17.7965 0.0462
NP_440299.1_1 Forward -341 -328 18.6032 0.00369
NP_440299.1_1 Reverse -324 -337 9.36014 0.0728
NP_441799.1_1 Reverse -324 -338 15.1419 0.0203
NP_441799.1_1 Forward -341 -327 10.1271 0.0797
NP_441007.1_10 Reverse -323 -336 1.9859 0.202
NP_441007.1_10 Forward -342 -329 -0.570702 0.287
NP_442333.2_5 Reverse -317 -336 -12.4886 0.249
NP_440256.1_1 Forward -340 -321 -6.29373 0.207
NP_440256.1_1 Reverse -325 -344 -9.44032 0.28
NP_440256.1_1 Forward -134 -115 -10.0303 0.293
NP_440456.1_7 Forward -113 -99 10.7177 0.285
NP_441559.1_8 Forward -46 -32 -4.03198 0.215
NP_441559.1_8 Forward -146 -132 -5.9986 0.271
NP_441559.1_8 Reverse -323 -337 -6.68692 0.279
NP_441270.1_5 Forward -395 -376 14.4581 0.211
NP_440915.1_6 Forward -341 -327 8.75105 0.0507
NP_440915.1_6 Reverse -206 -220 -1.5737 0.239
NP_440717.1_1 Reverse -329 -348 5.211 0.281
NP_440717.1_2 Reverse -215 -234 -11.1119 0.271
NP_441704.1_8 Reverse -317 -336 6.98015 0.253
NP_441704.1_8 Forward -348 -329 6.1935 0.262
NP_441464.1_10 Reverse -167 -181 7.57108 0.295
NP_441113.1_3 Reverse -386 -400 16.2235 0.235
NP_440695.1_5 Forward -208 -189 2.65439 0.254
NP_440695.1_6 Reverse -99 -113 9.73265 0.276
NP_442993.1_1 Forward -337 -321 -9.67623 0.19
NP_442386.1_9 Forward -338 -329 13.8639 0.0289
NP_442386.1_9 Reverse -327 -336 6.39082 0.219
NP_442386.1_10 Reverse -170 -183 4.24752 0.265
NP_440570.1_5 Forward -171 -152 8.16093 0.174
NP_441340.1_5 Forward -336 -329 15.6737 0.0124
NP_441340.1_5 Reverse -329 -336 15.6737 0.0124
NP_442186.1_9 Reverse -222 -241 4.71934 0.26
NP_441947.1_4 Reverse -317 -336 12.8808 0.226
NP_442484.1_2 Forward -219 -200 1.86774 0.226
NP_442484.1_2 Forward -348 -329 -0.983855 0.281
NP_442506.1_10 Reverse -330 -349 19.7631 0.236
NP_442240.1_1 Forward -188 -169 4.22689 0.273
NP_440161.1_3 Forward -133 -114 11.5042 0.213
NP_441027.1_1 Reverse -97 -111 16.2235 0.213
NP_440586.1_1 Forward -303 -284 -4.6221 0.278
NP_440586.1_8 Forward -336 -329 13.2151 0.026
NP_440586.1_8 Reverse -329 -336 13.2151 0.026
NP_442251.1_6 Forward -336 -329 15.2804 0.0124
NP_442251.1_6 Reverse -329 -336 15.2804 0.0124
NP_442251.1_6 Forward -130 -123 6.43063 0.298
NP_441262.1_3 Reverse -328 -335 14.7888 0.0223
NP_441262.1_3 Forward -337 -330 14.7888 0.0223
NP_440027.1_3 Reverse -318 -336 6.50823 0.225
NP_443051.1_1 Reverse -327 -336 18.0926 0.00402
NP_443051.1_1 Forward -338 -329 10.4228 0.00754
NP_439937.1_9 Reverse -357 -374 -11.3682 0.251
NP_439937.1_9 Reverse -327 -344 -14.7114 0.287
NP_442294.1_3 Forward -73 -59 14.0603 0.249
NP_440398.1_6 Forward -178 -159 6.98095 0.263
NP_441740.2_5 Forward -203 -184 15.2408 0.286
NP_440408.1_7 Reverse -328 -347 11.7008 0.218
NP_440408.1_7 Reverse -205 -224 9.63589 0.255
NP_440408.1_7 Reverse -171 -190 9.24257 0.264
NP_440439.1_1 Forward -340 -327 2.2809 0.136
NP_440439.1_1 Reverse -325 -338 0.215946 0.199
NP_439943.1_7 Reverse -153 -172 4.81767 0.277
NP_440372.1_2 Forward -336 -329 16.3621 0.0124
NP_440372.1_2 Reverse -329 -336 16.3621 0.0124
NP_441138.1_5 Forward -16 -3 3.78596 0.297
NP_442511.1_5 Reverse -47 -66 17.6697 0.195
NP_441789.1_7 Reverse -201 -220 7.27514 0.193
NP_440819.1_5 Reverse -386 -394 7.68924 0.266
NP_441572.1_7 Reverse -322 -341 4.42435 0.098
NP_442384.1_10 Reverse -328 -341 16.4406 0.00838
NP_442384.1_10 Forward -337 -324 16.1456 0.00939
NP_442384.1_10 Forward -208 -195 6.1158 0.11
NP_442114.1_8 Reverse -305 -319 4.32555 0.266
NP_441018.1_3 Forward -393 -374 17.4032 0.286
NP_441018.1_7 Forward -303 -284 8.25926 0.253
NP_442262.1_10 Forward -336 -329 14.1988 0.0123
NP_442262.1_10 Reverse -329 -336 14.1988 0.0123
NP_441689.1_5 Reverse -326 -336 8.63269 0.132
NP_441689.1_5 Forward -339 -329 5.78111 0.197
NP_440344.1_10 Reverse -321 -338 -1.14113 0.0505
NP_440531.1_6 Reverse -320 -339 21.8289 0.0353
NP_440531.1_6 Forward -76 -57 -3.63879 0.269
NP_440531.1_6 Forward -345 -326 -5.11376 0.293
NP_442910.1_1 Forward -344 -325 -6.09707 0.254
NP_441965.1_10 Reverse -325 -341 3.69678 0.256
NP_442693.1_6 Reverse -204 -223 -0.000545616 0.278
NP_440297.1_9 Forward -336 -326 19.0562 0.0359
NP_440297.1_9 Reverse -329 -339 -0.118297 0.282
NP_439926.1_7 Reverse -379 -397 6.50899 0.241
NP_442280.1_10 Forward -347 -329 10.5192 0.223
NP_442280.1_10 Reverse -154 -172 6.52583 0.274
NP_441103.1_9 Forward -229 -219 13.6614 0.243
NP_442067.1_4 Reverse -317 -336 14.1591 0.0784
NP_440999.1_2 Reverse -335 -354 17.3057 0.123
NP_440999.1_9 Reverse -195 -209 6.48943 0.0969
NP_440999.1_9 Reverse -324 -338 0.392915 0.187
NP_440888.1_2 Reverse -328 -342 9.93039 0.11
NP_440888.1_2 Reverse -199 -213 7.07881 0.208
NP_440600.1_4 Reverse -114 -132 -7.45401 0.291
NP_440491.1_1 Reverse -325 -344 10.8153 0.18
NP_439969.1_7 Reverse -222 -240 12.9005 0.253
NP_441543.1_2 Reverse -329 -338 16.9127 0.00359
NP_441543.1_2 Forward -336 -327 9.34117 0.0818
NP_442845.1_2 Forward -343 -329 6.6861 0.205
NP_442845.1_2 Reverse -328 -342 4.81781 0.251
NP_441551.1_5 Forward -341 -325 10.2842 0.193
NP_441469.1_8 Reverse -327 -336 13.3727 0.073
NP_441469.1_8 Forward -338 -329 6.48957 0.227
NP_443064.1_6 Forward -337 -327 13.8273 0.0796
NP_443064.1_6 Reverse -328 -338 12.5669 0.0796
NP_443064.1_6 Reverse -210 -220 9.07643 0.247
NP_442578.1_7 Forward -336 -329 14.5921 0.026
NP_442578.1_7 Reverse -329 -336 14.5921 0.026
NP_440710.1_1 Forward -345 -327 -5.88071 0.218
NP_441462.1_2 Forward -337 -327 20.1379 0.000967
NP_441462.1_2 Reverse -328 -338 11.5831 0.00406
NP_441621.1_7 Reverse -326 -340 -4.7203 0.242
NP_441929.1_6 Reverse -375 -394 5.50599 0.294
NP_443062.1_1 Reverse -328 -346 14.9814 0.0427
NP_443062.1_6 Forward -345 -326 1.27776 0.276
NP_442204.1_1 Reverse -324 -335 -0.0396598 0.285
NP_441560.1_5 Reverse -342 -361 15.6341 0.216
NP_441560.1_10 Reverse -320 -339 9.14423 0.235
NP_442487.1_5 Forward -338 -319 2.45694 0.3
NP_440516.1_8 Forward -337 -328 16.9127 0.00442
NP_440516.1_8 Reverse -328 -337 16.9127 0.00442
NP_442080.1_7 Forward -43 -24 1.86774 0.205
NP_442428.1_5 Forward -336 -329 15.8704 0.0124
NP_442428.1_5 Reverse -329 -336 15.8704 0.0124
NP_442823.1_8 Forward -57 -38 11.6025 0.284
NP_440673.1_2 Forward -218 -199 7.65814 0.296
NP_440673.1_3 Forward -335 -328 12.4288 0.0426
NP_440673.1_3 Reverse -330 -337 12.4288 0.0426
NP_441052.1_2 Reverse -328 -338 19.9412 0.00106
NP_441052.1_2 Forward -337 -327 10.4031 0.0285
NP_441052.1_2 Reverse -199 -209 5.09324 0.132
NP_440992.1_5 Reverse -203 -222 21.628 0.0644
NP_442219.1_9 Reverse -329 -338 17.7976 0.00718
NP_442219.1_9 Forward -336 -327 8.25953 0.0681
NP_440436.1_4 Reverse -329 -338 17.2072 0.00233
NP_440436.1_4 Forward -336 -327 15.9289 0.00508
NP_441884.1_8 Reverse -327 -346 0.786102 0.138
NP_441884.1_8 Reverse -204 -223 -8.752 0.262
NP_441884.1_9 Reverse -325 -344 -23.5016 0.284
NP_442864.1_2 Reverse -200 -219 19.2723 0.214
NP_440314.1_9 Reverse -225 -244 1.17943 0.0933
NP_442414.1_2 Forward -304 -285 8.06259 0.29
NP_442907.1_9 Reverse -284 -303 2.75272 0.171
NP_441086.1_3 Reverse -70 -89 9.01981 0.221
NP_441719.1_4 Forward -336 -329 16.3621 0.0124
NP_441719.1_4 Reverse -329 -336 16.3621 0.0124
NP_441733.1_10 Forward -340 -327 5.62415 0.21
NP_441004.1_1 Reverse -172 -191 -14.0619 0.263
NP_441004.1_1 Forward -304 -285 -14.5535 0.268
NP_442813.1_4 Forward -37 -18 -0.295539 0.224
NP_442366.1_3 Reverse -327 -345 1.49411 0.149
NP_442366.1_5 Forward -340 -330 14.0409 0.0497
NP_442873.1_5 Reverse -204 -223 7.96345 0.271
NP_440296.1_4 Forward -388 -369 16.0196 0.247
NP_441115.1_4 Reverse -229 -247 8.3765 0.25
NP_441115.1_4 Reverse -327 -345 7.29487 0.291
NP_440328.1_4 Forward -343 -324 4.71934 0.161
NP_440328.1_8 Reverse -281 -300 15.7258 0.294
NP_443054.1_2 Reverse -326 -340 3.44117 0.24
NP_440864.1_9 Forward -387 -368 12.7825 0.0633
NP_441851.1_10 Reverse -327 -337 17.4829 0.0027
NP_441851.1_10 Forward -338 -328 15.8113 0.00552
NP_441851.1_10 Forward -370 -360 4.0116 0.291
NP_441668.1_5 Forward -111 -92 6.19431 0.29
NP_442515.1_1 Forward -338 -324 13.6676 0.0278
NP_442515.1_1 Reverse -327 -341 -5.01529 0.298
NP_441396.1_5 Forward -304 -295 8.45619 0.224
NP_441683.1_7 Reverse -32 -51 -5.99873 0.264
NP_440593.1_3 Forward -213 -194 -2.95047 0.229
NP_441982.1_6 Forward -113 -104 10.48 0.296
NP_442709.1_3 Reverse -321 -340 3.83436 0.27
NP_441349.1_10 Forward -347 -328 12.1925 0.0216
NP_441349.1_10 Reverse -142 -161 -6.98204 0.239
NP_441661.1_3 Forward -161 -144 2.59545 0.226
NP_441409.1_6 Reverse -322 -341 4.22769 0.0404
NP_440432.1_2 Reverse -284 -303 -3.83545 0.268
NP_442843.1_3 Forward -306 -287 13.8641 0.0878
NP_442450.1_5 Reverse -326 -336 19.1546 0.0103
NP_442450.1_5 Forward -339 -329 7.55152 0.13
NP_442168.1_5 Reverse -329 -348 10.7175 0.137
NP_440588.1_2 Forward -346 -327 7.57094 0.0493
NP_440195.1_4 Forward -173 -154 4.71934 0.294
NP_440023.1_7 Reverse -159 -178 7.17762 0.269
NP_442006.1_2 Reverse -334 -351 -17.3657 0.274
NP_440483.1_1 Forward -168 -149 -4.03212 0.218
NP_441570.1_1 Reverse -328 -346 9.75391 0.0103
NP_441570.1_1 Forward -337 -319 -4.30741 0.0743
NP_441078.1_4 Forward -337 -328 19.6659 0.0007
NP_441078.1_4 Reverse -328 -337 19.6659 0.0007
NP_441078.1_4 Forward -233 -224 -1.08191 0.222
NP_441078.1_4 Forward -208 -199 -1.57357 0.266
NP_441078.1_4 Reverse -224 -233 -2.06522 0.295
NP_442729.1_8 Reverse -324 -337 9.95071 0.125
NP_441663.1_8 Forward -343 -324 0.786102 0.214
NP_442443.1_4 Reverse -308 -318 16.1058 0.155
NP_440526.1_3 Forward -336 -325 8.61296 0.118
NP_440526.1_3 Reverse -329 -340 8.02298 0.126
NP_441432.1_8 Forward -338 -329 16.8143 0.00595
NP_441432.1_8 Reverse -327 -336 8.35786 0.0755
NP_441432.1_8 Forward -234 -225 3.14632 0.259
NP_441333.1_1 Forward -319 -309 11.5899 0.241
NP_441732.1_2 Reverse -324 -340 -7.70961 0.0885
NP_441732.1_2 Forward -341 -325 -17.346 0.253
NP_442447.1_1 Forward -117 -98 9.0459 0.258
NP_442815.1_2 Forward -207 -189 4.14905 0.244
NP_440760.1_1 Forward -337 -318 -11.8003 0.0882
NP_442797.1_6 Forward -73 -54 12.4911 0.228
NP_442797.1_7 Forward -344 -326 3.16574 0.234
NP_442797.1_7 Forward -345 -327 -0.275845 0.282
NP_440199.1_10 Reverse -280 -290 7.05986 0.242
NP_442353.1_4 Forward -214 -195 5.70185 0.183
NP_440913.1_3 Reverse -199 -212 16.6372 0.192
NP_442727.1_1 Reverse -158 -172 14.1593 0.237
NP_443011.1_4 Forward -386 -367 10.2259 0.216
NP_440713.1_4 Forward -224 -205 8.94757 0.158
NP_440713.1_4 Forward -347 -328 7.37428 0.182
NP_440713.1_4 Reverse -330 -349 1.37609 0.287
NP_442489.1_7 Forward -337 -328 20.1576 0.000695
NP_442489.1_7 Reverse -328 -337 20.1576 0.000695
NP_442489.1_7 Forward -208 -199 -1.27858 0.185
NP_440757.1_7 Forward -214 -196 0.314141 0.269
NP_440941.1_1 Reverse -169 -179 17.9746 0.127
NP_440565.1_7 Forward -225 -206 -1.47551 0.282
NP_442079.1_7 Forward -336 -317 5.211 0.178
NP_440559.1_1 Reverse -329 -338 17.4043 0.00658
NP_440559.1_1 Forward -336 -327 17.306 0.00658
NP_441659.2_8 Forward -337 -327 19.3512 0.000966
NP_441659.2_8 Reverse -328 -338 18.1713 0.00133
NP_441659.2_8 Reverse -199 -209 3.32329 0.164
NP_440363.1_5 Forward -255 -236 18.3873 0.165
NP_440363.1_9 Forward -217 -199 18.407 0.119
NP_442913.1_10 Forward -346 -327 -1.47551 0.171
NP_441040.1_2 Forward -216 -197 -16.2252 0.294
NP_441040.1_5 Forward -342 -323 3.6377 0.269
NP_441040.1_5 Forward -303 -284 2.94938 0.275
NP_442008.1_2 Reverse -325 -344 17.5024 0.0705
NP_440708.1_6 Forward -347 -328 -6.09707 0.234
NP_442346.1_5 Reverse -327 -337 17.9746 0.00128
NP_442346.1_5 Forward -338 -328 16.6963 0.00248
NP_442346.1_5 Reverse -198 -208 8.53483 0.133
NP_440545.1_3 Forward -341 -324 20.59 0.00689
NP_440545.1_3 Forward -212 -195 -1.14113 0.163
NP_441856.1_8 Forward -222 -203 10.7175 0.279
NP_440831.1_3 Forward -346 -327 10.4644 0.177
NP_440459.1_2 Reverse -197 -214 8.20031 0.267
NP_442311.1_8 Forward -171 -152 11.0125 0.278
NP_442603.1_7 Forward -337 -323 15.2402 0.0502
NP_441233.1_4 Forward -339 -320 9.7334 0.267
NP_441585.1_5 Reverse -137 -156 4.22689 0.245
NP_441888.1_7 Reverse -153 -167 0.88457 0.276
NP_441050.1_5 Forward -372 -354 -0.7675 0.256
NP_441948.1_4 Reverse -321 -339 -1.45582 0.146
NP_441948.1_4 Forward -344 -326 -3.22577 0.189
NP_441833.1_4 Forward -336 -329 15.9687 0.0124
NP_441833.1_4 Reverse -329 -336 15.9687 0.0124
NP_441895.1_2 Forward -173 -154 -26.5499 0.24
NP_441895.1_2 Forward -172 -153 -26.7466 0.247
NP_442699.1_8 Forward -64 -45 6.39097 0.0733
NP_442699.1_8 Reverse -52 -71 -12.8819 0.261
NP_442162.1_9 Forward -336 -329 16.2637 0.0124
NP_442162.1_9 Reverse -329 -336 16.2637 0.0124
NP_440671.1_4 Reverse -322 -336 8.35772 0.201
NP_440671.1_4 Forward -167 -153 5.01447 0.297
NP_442546.1_2 Forward -399 -380 2.16195 0.275
NP_442140.1_3 Reverse -329 -339 12.2714 0.0632
NP_442140.1_3 Forward -336 -326 5.68323 0.198
NP_441671.1_10 Forward -375 -356 0.491109 0.281
NP_442547.1_7 Reverse -208 -227 11.0983 0.261
NP_441813.1_5 Reverse -326 -336 16.1063 0.01
NP_441813.1_5 Forward -339 -329 8.63316 0.0367
NP_440590.1_4 Reverse -329 -342 1.10092 0.133
NP_440567.1_1 Reverse -329 -343 16.0275 0.0166
NP_440035.1_6 Forward -111 -92 15.7324 0.251
NP_442497.1_10 Forward -336 -327 19.8626 0.00532
NP_442497.1_10 Reverse -329 -338 10.4228 0.0087
NP_440821.1_4 Reverse -326 -336 19.8429 0.00399
NP_440821.1_4 Forward -339 -329 9.41981 0.0286
NP_440927.1_4 Reverse -202 -221 13.1758 0.247
NP_441239.1_9 Reverse -326 -338 11.7404 0.0551
NP_441239.1_9 Forward -339 -327 6.92215 0.173
NP_441239.1_9 Forward -228 -216 3.18557 0.292
NP_441009.1_4 Reverse -328 -347 15.6341 0.158
NP_441009.1_7 Forward -215 -196 9.0459 0.294
NP_442897.1_7 Forward -161 -142 14.4541 0.263
NP_441892.1_1 Reverse -319 -336 11.9369 0.0533
NP_441892.1_1 Forward -346 -329 -0.157821 0.179
NP_441892.1_10 Forward -293 -274 10.2259 0.262
NP_440604.1_6 Reverse -328 -347 -1.08219 0.194
NP_441698.1_3 Forward -181 -167 17.3052 0.288
NP_442643.1_3 Reverse -153 -172 -1.37718 0.25
NP_442216.1_4 Forward -40 -32 8.37716 0.255
NP_442052.1_6 Reverse -374 -392 16.7346 0.251
NP_442052.1_6 Reverse -203 -221 15.948 0.262
NP_440546.1_4 Forward -337 -327 12.8578 0.0572
NP_440546.1_4 Reverse -328 -338 10.046 0.109
NP_440546.1_6 Forward -162 -143 8.94757 0.253
NP_440546.1_7 Forward -226 -216 15.8113 0.237
NP_440675.1_1 Forward -243 -224 9.14423 0.195
NP_440675.1_1 Forward -386 -367 6.19431 0.195
NP_440462.1_6 Reverse -326 -336 7.84651 0.0699
NP_440462.1_6 Forward -339 -329 1.35667 0.294
NP_440868.1_4 Forward -341 -329 13.2153 0.022
NP_440868.1_4 Reverse -324 -336 8.49544 0.0602
NP_440401.1_9 Forward -175 -168 12.6251 0.287
NP_442479.1_5 Reverse -115 -134 7.96164 0.222
NP_442402.1_4 Reverse -281 -300 -7.57277 0.276
NP_442402.1_10 Reverse -103 -113 16.2041 0.118
NP_442402.1_10 Reverse -102 -112 10.1076 0.3
NP_442039.1_4 Forward -336 -329 15.1821 0.0124
NP_442039.1_4 Reverse -329 -336 15.1821 0.0124
NP_442039.1_7 Forward -115 -105 7.74818 0.271
NP_441811.1_8 Reverse -322 -336 6.6861 0.265
NP_442679.1_1 Reverse -298 -317 -4.42544 0.278
NP_442679.1_1 Reverse -374 -393 -4.52377 0.281
NP_441926.1_3 Forward -240 -224 9.49831 0.17
NP_440825.1_2 Forward -176 -157 7.17762 0.267
NP_440825.1_7 Reverse -329 -339 12.9096 0.152
NP_442696.1_6 Forward -184 -165 -12.1936 0.251
NP_442837.1_3 Forward -336 -329 15.7721 0.0124
NP_442837.1_3 Reverse -329 -336 15.7721 0.0124
NP_441760.1_4 Forward -305 -287 12.9988 0.235
NP_440160.1_2 Reverse -58 -77 -9.34199 0.293
NP_439994.1_4 Reverse -51 -70 12.8808 0.223
NP_442053.1_1 Forward -337 -328 18.3876 0.0007
NP_442053.1_1 Reverse -328 -337 18.3876 0.0007
NP_440505.1_3 Forward -339 -329 9.22315 0.122
NP_440505.1_3 Reverse -326 -336 7.55152 0.151
NP_440505.1_7 Forward -389 -370 0.392778 0.259
NP_441959.1_10 Forward -220 -202 20.876 0.125
NP_441252.1_6 Forward -113 -106 11.6422 0.288
NP_440914.1_1 Reverse -328 -338 17.5935 0.000537
NP_440914.1_1 Forward -337 -327 8.51751 0.186
NP_441011.1_8 Forward -336 -327 14.356 0.0249
NP_441011.1_8 Reverse -329 -338 8.25953 0.144
NP_442101.1_10 Forward -345 -326 4.42435 0.0629
NP_442533.1_6 Forward -337 -328 17.2076 0.00137
NP_442533.1_6 Reverse -328 -337 17.2076 0.00137
NP_442533.1_6 Forward -208 -199 11.0128 0.0486
NP_442533.1_6 Forward -161 -152 1.57302 0.294
NP_442229.1_1 Forward -339 -325 5.99717 0.242
NP_443016.1_1 Forward -343 -324 9.93088 0.0793
NP_441482.1_7 Reverse -322 -336 9.73436 0.0155
NP_439944.1_9 Forward -336 -326 17.3846 0.00516
NP_439944.1_9 Reverse -329 -339 10.5014 0.0887
NP_439944.1_9 Forward -232 -222 8.4365 0.108
NP_442269.1_10 Reverse -159 -178 4.81767 0.241
NP_440816.1_7 Reverse -324 -343 14.8474 0.181
NP_441028.1_6 Forward -394 -384 12.0743 0.192
NP_441028.1_6 Reverse -363 -373 6.37109 0.23
NP_441028.1_6 Forward -149 -139 5.78111 0.243
NP_441028.1_6 Forward -230 -220 3.71617 0.281
NP_441028.1_6 Forward -229 -219 3.42118 0.296
NP_440116.1_5 Forward -340 -323 5.44704 0.176
NP_440116.1_8 Reverse -329 -348 8.25926 0.0381
NP_441527.1_4 Reverse -380 -399 5.0129 0.109
NP_441527.1_4 Reverse -381 -400 0.524783 0.136
NP_440115.1_6 Reverse -325 -335 9.7148 0.115
NP_440115.1_6 Forward -340 -330 9.32148 0.115
NP_440007.1_9 Reverse -324 -338 9.34103 0.171
NP_439965.1_1 Forward -346 -327 -9.93197 0.3
NP_439965.1_7 Forward -350 -331 15.2838 0.23
NP_441680.1_4 Reverse -207 -226 -3.44213 0.296
NP_441170.1_4 Forward -346 -328 6.90232 0.194
NP_441972.1_5 Reverse -329 -348 2.55606 0.121
NP_441106.1_1 Reverse -327 -336 9.73449 0.0311
NP_441106.1_1 Forward -338 -329 9.63616 0.0311
NP_441286.1_1 Forward -338 -326 23.9334 0.000767
NP_441286.1_1 Reverse -327 -339 3.48056 0.0467
NP_441286.1_1 Forward -234 -222 -4.9759 0.183
NP_442674.1_3 Reverse -320 -339 14.9449 0.174
NP_442674.1_3 Forward -345 -326 4.32522 0.294
NP_440670.1_8 Forward -337 -328 18.3876 0.000699
NP_440670.1_8 Reverse -328 -337 18.3876 0.000699
NP_440886.1_7 Reverse -327 -337 8.04271 0.0805
NP_440886.1_7 Forward -338 -328 7.94438 0.0805
NP_442614.1_2 Forward -337 -323 19.4691 0.0419
NP_442614.1_2 Reverse -328 -342 15.4376 0.0773
NP_442614.1_2 Reverse -59 -73 7.47274 0.273
NP_440404.1_10 Reverse -373 -386 15.6516 0.281
NP_442072.1_9 Reverse -327 -345 -20.0404 0.204
NP_441808.1_8 Forward -220 -201 6.29264 0.289
NP_440907.2_8 Forward -336 -326 9.81266 0.103
NP_440907.2_8 Reverse -329 -339 7.64939 0.117
NP_440326.1_5 Forward -339 -326 15.2606 0.179
NP_440841.1_4 Reverse -326 -345 -9.63698 0.26
NP_441463.1_3 Forward -347 -328 5.11266 0.0778
NP_441463.1_6 Forward -339 -325 6.51256 0.269
NP_442842.1_10 Forward -400 -381 8.32868 0.207
NP_442842.1_10 Forward -396 -377 -0.311184 0.283
NP_441626.1_2 Forward -336 -329 15.7721 0.0124
NP_441626.1_2 Reverse -329 -336 15.7721 0.0124
NP_442794.1_1 Forward -341 -329 12.232 0.0721
NP_442615.1_1 Forward -346 -328 10.1472 0.0223
NP_440387.1_1 Reverse -328 -344 4.3851 0.0426
NP_440387.1_1 Forward -337 -321 -5.54633 0.238
NP_441431.1_2 Reverse -325 -339 9.53707 0.183
NP_441431.1_2 Reverse -196 -210 5.50552 0.298
NP_441993.1_1 Forward -233 -214 6.62464 0.178
NP_440358.1_8 Forward -113 -94 4.52268 0.211
NP_440467.1_3 Reverse -329 -348 15.065 0.154
NP_440114.1_10 Forward -337 -323 6.48943 0.269
NP_442090.1_10 Forward -376 -363 11.9173 0.214
NP_440293.1_9 Forward -213 -199 10.7645 0.261
NP_441237.1_9 Reverse -329 -339 14.828 0.0242
NP_442635.1_9 Forward -287 -268 12.9603 0.262
NP_441311.1_2 Forward -343 -329 13.9619 0.229
NP_440457.1_1 Reverse -324 -336 11.052 0.092
NP_440457.1_1 Forward -341 -329 2.10393 0.217
NP_440798.1_6 Reverse -329 -342 13.0973 0.0445
NP_442680.1_5 Reverse -343 -362 1.83066 0.237
NP_441889.1_4 Forward -346 -327 10.9142 0.0842
NP_442509.1_9 Forward -337 -327 17.3841 0.00128
NP_442509.1_9 Reverse -328 -338 8.14104 0.192
NP_442509.1_9 Reverse -190 -200 8.04271 0.192
NP_442509.1_9 Forward -179 -169 6.76441 0.254
NP_440660.1_6 Forward -64 -45 11.1109 0.28
NP_440554.1_4 Forward -336 -326 6.96153 0.107
NP_441885.1_5 Reverse -328 -338 20.9245 0.000538
NP_441885.1_5 Forward -337 -327 11.3864 0.00668
NP_442341.1_7 Forward -338 -324 11.111 0.0574
NP_442341.1_7 Forward -234 -220 5.1128 0.167
NP_442341.1_7 Reverse -327 -341 4.12949 0.2
NP_442341.1_9 Forward -339 -325 11.307 0.127
NP_442341.1_9 Reverse -326 -340 9.24208 0.155
NP_441173.1_9 Reverse -104 -112 13.1954 0.184
NP_441173.1_9 Reverse -105 -113 12.507 0.206
NP_441173.1_9 Reverse -364 -372 10.1471 0.261
NP_442395.2_4 Reverse -204 -223 1.27698 0.245
NP_440423.1_6 Reverse -320 -339 -17.0118 0.232
NP_443000.1_7 Forward -339 -329 10.3048 0.0345
NP_443000.1_7 Reverse -326 -336 8.82982 0.0437
NP_440552.1_8 Reverse -119 -136 9.88781 0.287
NP_441842.1_10 Forward -344 -330 8.65272 0.213
NP_440275.1_3 Reverse -326 -336 10.0098 0.0454
NP_440275.1_3 Forward -339 -329 8.04317 0.0602
NP_440091.1_1 Forward -341 -329 1.41561 0.197
NP_442354.1_8 Forward -228 -209 8.55425 0.266
NP_443010.1_10 Forward -208 -191 2.19099 0.281
NP_441359.1_5 Reverse -202 -221 0.687771 0.29
NP_442451.1_2 Reverse -137 -156 -9.44032 0.259
NP_440175.1_7 Reverse -154 -172 8.67997 0.292
NP_440149.1_8 Forward -337 -318 -1.18052 0.157
NP_440149.1_8 Reverse -328 -347 -5.21209 0.221
NP_441105.1_3 Reverse -147 -166 -6.09707 0.229
NP_441105.1_3 Forward -225 -206 -6.39206 0.234
NP_441105.1_3 Forward -101 -82 -9.34199 0.288
NP_440216.1_1 Reverse -328 -342 8.65272 0.00592
NP_440216.1_1 Forward -337 -323 -2.16369 0.0482
NP_440172.1_1 Forward -337 -327 16.303 0.00854
NP_440172.1_1 Reverse -328 -338 15.0247 0.00945
NP_442015.1_10 Forward -341 -328 10.1474 0.0402
NP_442015.1_10 Reverse -324 -337 9.95071 0.043
NP_442015.1_10 Forward -212 -199 5.42749 0.142
NP_441226.1_7 Forward -336 -329 14.4934 0.0123
NP_441226.1_7 Reverse -329 -336 14.4934 0.0123
NP_441226.1_7 Reverse -206 -213 9.47853 0.147
NP_441757.1_3 Forward -338 -319 7.86593 0.122
NP_441111.1_7 Forward -336 -328 18.7023 0.00294
NP_441111.1_7 Reverse -329 -337 18.7023 0.00294
NP_442379.1_10 Forward -344 -327 10.1669 0.0936
NP_441766.1_2 Forward -337 -328 17.5026 0.00297
NP_441766.1_2 Reverse -328 -337 17.5026 0.00297
NP_440416.1_9 Forward -344 -325 17.7974 0.0122
NP_440416.1_9 Reverse -151 -170 -7.08038 0.0964
NP_440416.1_9 Forward -226 -207 -12.2919 0.156
NP_443052.1_9 Reverse -204 -223 4.52268 0.154
NP_443052.1_9 Reverse -207 -226 -3.93378 0.253
NP_443052.1_9 Forward -146 -127 -5.9004 0.274
NP_443052.1_9 Forward -225 -206 -5.99873 0.276
NP_440820.2_4 Reverse -219 -238 6.98095 0.228
NP_441019.1_1 Reverse -368 -387 17.9932 0.178
NP_440261.1_5 Forward -336 -323 16.2439 0.0122
NP_440261.1_5 Reverse -329 -342 -1.06236 0.0655
NP_440261.1_5 Forward -207 -194 -4.20895 0.142
NP_440261.1_10 Reverse -340 -354 13.9626 0.207
NP_440988.1_10 Reverse -326 -340 6.2542 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTTGTTTTTTTCCCTGTTGTTGATGCTTTGGGGGGAAGACTTTGACTTTTTAACCCTCCGCTTGGCGATCGCCCTGAATGGTTTTTTGCTTTTAGTTCGTTGGGGGATGCTGTTGGCCATTTATCCTTCCTATTACCGACCTTCAGAAAAAGGAGCCTGGAGTTATTGGCTTTCTCCCCTGGCGGATCCGTTGGCGGTGACCCGGATTATCATTTCCGCTTCCCAAACCCCCAAACAATGGCGGGGGCGAATTTACCCCGGTGCTTCCTAAAGATTGCTTAACTTAGTTGGGGAAAATTAGCCTGGCCTGAAACTTTGCTAACCCATCTGAGAGTTTTGGCCCGGTCAAAAATTACCCCCTGATTCCCCGTTGTATTGGTTAGATTAACTGCTGATTTTT

CDS

ATGGATGCCACTGCCCCCATTCTCCAAGCCCTAGAAAAATTAATTGCCGTAGTGGCCCAACTGCGATCGCCAAAGGGGGGATGCCCTTGGGATTTAGCCCAAACCCAACAAAGTTTAATTCCCTACGTGGTGGAAGAAGCCTACGAAGTGGTCCACGCCCTACAAAGCCAAGACCAAACGGCGATCGCCGAGGAATTGGGGGATTTATTGCTCCAGGTGGTACTCCAAGCCCAAGTGGCCCAGGATTTAGGACACTTCAATTTGCAACAGGTGGCAGAGGGCATTACCGCCAAACTTATCCGTCGCCATCCCCACGTTTTTGCTGAGGTAACAGTCAGCGATGCAGAGGAAGTGAAAGCCAATTGGCAGACGATTAAGGCACAGGAAAAGGGTTTAAACCCCGACCAAACACCACTTTTAAGCATCAAATTAGAACGCTATAACAGTACGTTGCCCCCCCTGATGGCCGGTAGTAAAATTTCTCAAAAGGCAGCGGCGGTGGGCTTTGAATGGCCAGATGTTGACGGCGTATGGGCTAAGTTTACAGAGGAGTTAACCGAATTTAAACAGGCTTTGACCACGGAGGATAAGGGCCATCAACAGGCAGAATTAGGGGATTTATTATTCACCCTCATCAACCTGGCCCGTTGGTACAATCTCGACGCTTCCTTGGCTCTCCATGGCACCAATCAAAGATTTATTCAGCGGCTACAATTGATGGAAAAATTTGCCGATCGCCCGTTGGATCAGTACAAATTAGAAGAGTTGGAAACCCTATGGCAGCAGGCCAAAAAGCAACTTAACCAATAA

Protein

MDATAPILQALEKLIAVVAQLRSPKGGCPWDLAQTQQSLIPYVVEEAYEVVHALQSQDQTAIAEELGDLLLQVVLQAQVAQDLGHFNLQQVAEGITAKLIRRHPHVFAEVTVSDAEEVKANWQTIKAQEKGLNPDQTPLLSIKLERYNSTLPPLMAGSKISQKAAAVGFEWPDVDGVWAKFTEELTEFKQALTTEDKGHQQAELGDLLFTLINLARWYNLDASLALHGTNQRFIQRLQLMEKFADRPLDQYKLEELETLWQQAKKQLNQ