Your browser is old and dusty. Try Google Chrome!

Details for sll0995

ORF sll0995
Accession NP_440476.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -286 -272 14.6509 0.0392
NP_441061.1_2 Forward -133 -119 5.60446 0.132
NP_440795.1_7 Forward -133 -126 14.6904 0.0123
NP_440795.1_7 Reverse -126 -133 14.6904 0.0123
NP_441418.1_6 Forward -134 -115 -30.0898 0.256
NP_442291.1_5 Reverse -124 -140 -0.531451 0.185
NP_442272.1_2 Forward -183 -164 12.9387 0.217
NP_441453.1_1 Forward -393 -375 10.2448 0.136
NP_441453.1_4 Reverse -125 -133 16.539 0.00633
NP_441453.1_4 Forward -134 -126 16.539 0.00633
NP_441453.1_4 Reverse -377 -385 6.80426 0.121
NP_441453.1_4 Forward -386 -378 6.11594 0.121
NP_441453.1_4 Forward -226 -218 5.0343 0.209
NP_441453.1_7 Reverse -147 -154 11.6422 0.298
NP_441623.1_1 Forward -154 -136 -4.40575 0.274
NP_442151.1_6 Forward -134 -120 18.7808 0.00618
NP_442151.1_6 Reverse -125 -139 8.16106 0.182
NP_441818.1_1 Reverse -126 -137 9.79292 0.232
NP_441818.1_9 Reverse -269 -288 -10.4236 0.293
NP_440226.1_1 Reverse -125 -144 10.7175 0.0603
NP_441465.1_8 Forward -297 -279 7.19731 0.246
NP_440259.1_4 Reverse -11 -25 9.21432 0.278
NP_440150.1_2 Reverse -258 -277 4.12856 0.281
NP_440150.1_6 Reverse -122 -141 2.75272 0.268
NP_442744.1_8 Forward -134 -115 1.47442 0.216
NP_442287.1_3 Reverse -131 -148 13.7061 0.294
NP_442655.1_1 Forward -139 -120 -0.197208 0.242
NP_442173.1_1 Forward -133 -125 15.4574 0.00633
NP_442173.1_1 Reverse -126 -134 15.4574 0.00633
NP_442173.1_1 Forward -385 -377 12.0158 0.0316
NP_442173.1_1 Reverse -378 -386 10.7375 0.0611
NP_442752.1_4 Reverse -377 -384 13.8055 0.0199
NP_442752.1_4 Forward -134 -127 13.8055 0.0199
NP_442752.1_4 Reverse -125 -132 13.8055 0.0199
NP_443027.1_4 Forward -136 -126 11.0914 0.107
NP_442975.1_10 Reverse -121 -135 2.65393 0.269
NP_440074.1_6 Forward -306 -287 18.6815 0.268
NP_440784.1_7 Forward -133 -126 15.9687 0.0123
NP_440784.1_7 Reverse -126 -133 15.9687 0.0123
NP_440784.1_7 Reverse -378 -385 6.23397 0.241
NP_440784.1_7 Forward -385 -378 6.13563 0.241
NP_440061.1_3 Reverse -138 -157 12.3892 0.235
NP_440061.1_9 Reverse -123 -137 19.6651 0.00478
NP_440061.1_9 Forward -136 -122 11.7003 0.107
NP_441054.1_2 Reverse -44 -63 15.9291 0.136
NP_442062.1_8 Forward -134 -124 17.3846 0.00193
NP_442062.1_8 Reverse -125 -135 17.3846 0.00193
NP_442062.1_8 Reverse -377 -387 7.55152 0.0946
NP_441859.1_3 Forward -287 -268 7.17681 0.164
NP_441859.1_3 Reverse -268 -287 3.9319 0.23
NP_441802.1_1 Forward -29 -10 15.3391 0.174
NP_440304.1_4 Forward -44 -34 3.32329 0.299
NP_440304.1_4 Forward -136 -126 1.84832 0.299
NP_440304.1_4 Reverse -123 -133 1.84832 0.299
NP_442242.1_4 Forward -133 -126 14.3954 0.0124
NP_442242.1_4 Reverse -126 -133 14.3954 0.0124
NP_442762.1_10 Reverse -257 -276 -2.55715 0.22
NP_442602.1_3 Forward -72 -53 8.84924 0.0877
NP_441935.1_1 Forward -280 -261 13.4708 0.159
NP_441208.1_9 Reverse -122 -136 7.37441 0.222
NP_441594.1_6 Reverse -116 -135 3.14605 0.236
NP_440132.1_1 Reverse -375 -393 8.08229 0.281
NP_442110.1_7 Forward -134 -120 1.76955 0.222
NP_442726.1_7 Forward -213 -195 3.95239 0.215
NP_441083.1_3 Reverse -196 -206 12.7626 0.248
NP_441083.1_5 Forward -134 -124 20.3345 0.00053
NP_441083.1_5 Reverse -125 -135 20.3345 0.00053
NP_441083.1_5 Forward -386 -376 8.73149 0.0307
NP_441083.1_5 Reverse -377 -387 7.05986 0.067
NP_441434.1_7 Reverse -328 -342 10.6193 0.163
NP_441738.1_2 Forward -384 -377 15.28 0.0102
NP_441738.1_2 Forward -132 -125 15.28 0.0102
NP_441738.1_2 Reverse -127 -134 15.28 0.0102
NP_441738.1_2 Forward -197 -190 6.72528 0.236
NP_441558.1_5 Forward -388 -369 4.12936 0.29
NP_441558.1_5 Forward -136 -117 3.93269 0.294
NP_441645.1_1 Reverse -317 -336 7.37347 0.286
NP_440209.1_1 Reverse -125 -133 18.1123 0.00295
NP_440209.1_1 Forward -134 -126 18.1123 0.00295
NP_440209.1_1 Reverse -377 -385 8.57422 0.0425
NP_442889.1_1 Reverse -256 -275 -12.8819 0.24
NP_442889.1_8 Forward -137 -123 5.40719 0.227
NP_440447.1_6 Forward -394 -376 4.9357 0.161
NP_441713.1_1 Reverse -119 -138 -17.0118 0.292
NP_441716.1_1 Reverse -125 -139 18.0925 0.0205
NP_441716.1_1 Forward -134 -120 13.1759 0.0689
NP_442111.1_4 Forward -135 -121 12.0943 0.0451
NP_442111.1_4 Reverse -376 -390 8.84938 0.0677
NP_442111.1_4 Reverse -124 -138 4.91614 0.185
NP_441624.1_7 Forward -292 -278 9.43936 0.22
NP_440906.1_5 Forward -133 -126 15.8704 0.0124
NP_440906.1_5 Reverse -126 -133 15.8704 0.0124
NP_440906.1_5 Reverse -378 -385 6.23397 0.234
NP_440906.1_5 Forward -385 -378 6.13563 0.241
NP_440747.1_10 Forward -137 -125 26.5883 0.000317
NP_440747.1_10 Reverse -122 -134 24.7201 0.00036
NP_440747.1_10 Forward -389 -377 -2.51763 0.0509
NP_442973.1_5 Forward -157 -138 9.63589 0.298
NP_441486.1_1 Forward -137 -123 6.3911 0.0344
NP_441486.1_1 Reverse -122 -136 5.89945 0.0344
NP_441486.1_1 Reverse -214 -228 -4.52363 0.201
NP_441486.1_1 Reverse -194 -208 -5.11362 0.222
NP_441486.1_1 Forward -229 -215 -5.9986 0.272
NP_442634.1_4 Forward -136 -122 -1.27871 0.149
NP_441265.1_3 Forward -392 -378 5.89945 0.181
NP_441265.1_3 Forward -140 -126 3.04785 0.181
NP_442848.1_5 Forward -129 -111 -3.52077 0.293
NP_443018.1_3 Forward -133 -126 14.8871 0.0123
NP_443018.1_3 Reverse -126 -133 14.8871 0.0123
NP_443018.1_3 Forward -385 -378 11.7405 0.0655
NP_443018.1_3 Reverse -378 -385 5.44732 0.193
NP_441634.1_8 Reverse -260 -274 -0.492064 0.259
NP_441634.1_8 Forward -136 -122 -3.147 0.295
NP_440376.1_1 Forward -134 -125 19.4693 0.000692
NP_440376.1_1 Reverse -125 -134 19.4693 0.000692
NP_440376.1_1 Reverse -377 -386 5.99792 0.111
NP_440376.1_1 Forward -226 -217 5.99792 0.111
NP_440376.1_1 Reverse -262 -271 1.96635 0.236
NP_440376.1_1 Forward -386 -377 -0.196935 0.285
NP_441588.1_4 Forward -384 -374 9.22315 0.14
NP_441588.1_4 Forward -132 -122 9.02648 0.14
NP_441588.1_4 Reverse -219 -229 5.38824 0.272
NP_442687.1_7 Forward -207 -197 13.1564 0.0574
NP_442687.1_7 Forward -135 -125 8.92815 0.0994
NP_442687.1_7 Reverse -124 -134 8.92815 0.0994
NP_442687.1_7 Reverse -376 -386 7.25653 0.136
NP_441077.1_6 Forward -105 -89 2.03061 0.29
NP_441422.1_3 Reverse -47 -66 14.3226 0.277
NP_441422.1_7 Forward -136 -119 -2.61609 0.218
NP_440533.1_9 Reverse -125 -144 11.3075 0.114
NP_442658.1_1 Forward -136 -126 7.94438 0.199
NP_442658.1_1 Reverse -123 -133 6.76441 0.214
NP_442658.1_1 Reverse -375 -385 5.09279 0.284
NP_440662.1_1 Reverse -73 -92 13.8641 0.0838
NP_442782.1_2 Reverse -191 -205 2.94952 0.269
NP_442496.1_8 Forward -179 -160 16.1319 0.101
NP_441414.1_9 Forward -134 -115 -7.76869 0.225
NP_441487.1_9 Reverse -124 -143 -2.75381 0.293
NP_442300.1_5 Reverse -123 -142 11.2092 0.282
NP_442937.1_5 Reverse -114 -133 10.0292 0.173
NP_442937.1_5 Forward -139 -120 9.24257 0.198
NP_442937.1_5 Reverse -120 -139 7.37428 0.254
NP_441958.1_5 Forward -135 -125 12.2714 0.00183
NP_441958.1_5 Reverse -124 -134 12.2714 0.00183
NP_441958.1_5 Reverse -376 -386 9.12481 0.025
NP_441958.1_5 Forward -387 -377 0.865012 0.12
NP_441958.1_5 Reverse -216 -226 0.668351 0.134
NP_441127.1_1 Forward -280 -266 11.5043 0.22
NP_440203.1_5 Forward -131 -121 14.2375 0.0886
NP_439905.1_1 Forward -253 -240 9.75405 0.216
NP_440984.1_7 Forward -139 -125 5.80112 0.24
NP_439990.1_5 Reverse -120 -133 20.7671 0.00296
NP_439990.1_5 Forward -139 -126 13.7856 0.0889
NP_442376.1_2 Reverse -200 -219 -13.4719 0.296
NP_442911.1_2 Reverse -115 -134 5.80098 0.0315
NP_442911.1_2 Forward -144 -125 -9.53865 0.258
NP_443055.1_3 Reverse -269 -288 12.7459 0.205
NP_443055.1_6 Forward -286 -268 7.29487 0.161
NP_443055.1_6 Forward -148 -130 -0.571569 0.263
NP_443055.1_6 Forward -142 -124 -1.35821 0.277
NP_443055.1_6 Reverse -111 -129 -2.04653 0.287
NP_440496.1_1 Reverse -64 -83 6.29264 0.266
NP_440602.1_2 Reverse -120 -139 2.75272 0.263
NP_442210.1_1 Forward -130 -111 8.55425 0.212
NP_441099.1_5 Forward -396 -377 9.0459 0.0328
NP_441099.1_5 Forward -144 -125 -2.45882 0.122
NP_441099.1_5 Reverse -115 -134 -10.3253 0.25
NP_442002.1_9 Reverse -376 -383 14.1004 0.074
NP_440809.1_7 Reverse -269 -288 11.7992 0.151
NP_441294.1_7 Reverse -373 -387 10.4025 0.191
NP_441294.1_7 Reverse -121 -135 9.15464 0.256
NP_441646.1_1 Reverse -118 -137 2.65439 0.216
NP_441646.1_1 Reverse -48 -67 0.884433 0.242
NP_441646.1_1 Forward -206 -187 -0.000545616 0.257
NP_442438.1_10 Reverse -192 -206 3.04785 0.166
NP_442438.1_10 Reverse -120 -134 0.786239 0.213
NP_441000.1_6 Forward -387 -373 2.94952 0.123
NP_441000.1_6 Reverse -124 -138 -3.73699 0.225
NP_440605.1_4 Forward -144 -125 17.3569 0.0955
NP_442771.1_1 Forward -280 -262 -9.0273 0.213
NP_440484.1_3 Forward -136 -122 9.73436 0.255
NP_441674.1_10 Forward -164 -146 2.87075 0.259
NP_440147.1_4 Reverse -123 -136 18.9972 0.00328
NP_440147.1_4 Reverse -375 -388 10.049 0.0355
NP_440147.1_4 Forward -136 -123 8.77074 0.0465
NP_441550.1_8 Reverse -375 -385 16.4008 0.013
NP_441550.1_8 Forward -136 -126 15.1225 0.0132
NP_441550.1_8 Reverse -123 -133 14.6309 0.0132
NP_441550.1_8 Forward -388 -378 13.9425 0.0202
NP_441916.1_7 Forward -134 -124 10.3048 0.0261
NP_441916.1_7 Reverse -125 -135 10.3048 0.0261
NP_441916.1_7 Forward -226 -216 7.05986 0.0779
NP_441916.1_10 Forward -142 -123 4.32602 0.223
NP_441041.1_4 Forward -134 -115 -13.3736 0.285
NP_441041.1_7 Reverse -374 -386 8.68091 0.133
NP_441041.1_7 Reverse -122 -134 8.58373 0.133
NP_441041.1_7 Forward -137 -125 7.51478 0.162
NP_441041.1_7 Forward -389 -377 5.37687 0.26
NP_443063.1_7 Reverse -112 -128 11.1699 0.196
NP_442004.1_6 Forward -134 -120 5.80112 0.181
NP_441725.1_5 Forward -133 -123 2.04498 0.115
NP_441725.1_5 Reverse -126 -136 2.04498 0.115
NP_441725.1_5 Forward -385 -375 1.94665 0.115
NP_441725.1_5 Reverse -378 -388 0.766681 0.149
NP_441725.1_5 Reverse -140 -150 -0.511621 0.26
NP_439966.1_7 Forward -136 -126 15.3192 0.0152
NP_439966.1_7 Reverse -123 -133 7.25606 0.15
NP_439966.1_7 Forward -388 -378 5.09279 0.243
NP_442941.1_3 Reverse -126 -136 19.2529 0.00262
NP_442941.1_3 Forward -133 -123 11.0914 0.0116
NP_440289.1_2 Forward -137 -124 3.06754 0.0811
NP_440289.1_2 Reverse -374 -387 -2.24233 0.253
NP_440289.1_2 Forward -389 -376 -3.61896 0.267
NP_440289.1_2 Reverse -122 -135 -4.9956 0.294
NP_440983.1_5 Forward -283 -264 -9.047 0.3
NP_440260.1_8 Reverse -268 -286 -4.60241 0.273
NP_440260.1_8 Forward -143 -125 -5.58572 0.275
NP_440260.1_8 Reverse -116 -134 -7.06068 0.295
NP_442281.1_1 Reverse -372 -386 10.5204 0.0576
NP_442281.1_1 Reverse -120 -134 9.53707 0.0685
NP_442281.1_1 Forward -291 -277 8.94708 0.0747
NP_442281.1_1 Forward -139 -125 8.84875 0.075
NP_442281.1_1 Forward -276 -262 1.96562 0.282
NP_442281.1_1 Forward -391 -377 1.86729 0.285
NP_442281.1_1 Forward -231 -217 1.86729 0.285
NP_440177.1_1 Forward -285 -267 5.72234 0.272
NP_442256.1_2 Forward -388 -370 -8.63398 0.232
NP_442256.1_2 Forward -136 -118 -8.83064 0.236
NP_001035871.2_7 Forward -152 -142 12.5664 0.264
NP_440437.1_1 Forward -154 -135 -3.73712 0.244
NP_440437.1_1 Forward -205 -186 -3.83545 0.246
NP_442012.1_5 Reverse -304 -323 -0.295539 0.288
NP_442049.1_4 Reverse -263 -282 -3.24547 0.273
NP_441556.1_10 Reverse -120 -134 13.4339 0.178
NP_440498.1_1 Reverse -208 -226 0.707465 0.214
NP_441644.1_6 Forward -134 -124 17.3841 0.00127
NP_441644.1_6 Reverse -125 -135 17.3841 0.00127
NP_441644.1_6 Forward -386 -376 6.0761 0.167
NP_441644.1_6 Reverse -269 -279 5.68278 0.18
NP_441644.1_6 Reverse -377 -387 3.61784 0.272
NP_443049.1_6 Reverse -376 -386 11.9337 0.24
NP_442215.1_2 Forward -136 -120 6.35172 0.0719
NP_442215.1_2 Reverse -137 -153 1.73016 0.128
NP_442215.1_2 Reverse -123 -139 -2.89139 0.206
NP_442029.1_6 Forward -139 -120 7.27595 0.224
NP_440253.1_2 Reverse -125 -143 16.1454 0.0145
NP_440929.1_8 Forward -134 -125 19.2726 0.000701
NP_440929.1_8 Reverse -125 -134 19.2726 0.000701
NP_440929.1_8 Forward -386 -377 14.651 0.0105
NP_440929.1_8 Reverse -377 -386 7.66954 0.0624
NP_441346.1_4 Reverse -376 -395 11.7008 0.286
NP_442933.1_10 Forward -134 -125 17.601 0.00325
NP_442933.1_10 Reverse -125 -134 17.601 0.00325
NP_441751.2_8 Forward -133 -119 7.37441 0.0339
NP_441751.2_8 Reverse -126 -140 4.91614 0.0453
NP_441751.2_8 Forward -205 -191 -5.70361 0.231
NP_442554.1_8 Reverse -126 -136 16.2046 0.0065
NP_442554.1_8 Forward -133 -123 15.3197 0.00882
NP_442554.1_8 Reverse -378 -388 9.41981 0.0594
NP_442554.1_8 Forward -385 -375 4.40493 0.188
NP_442554.1_8 Reverse -278 -288 3.71661 0.215
NP_441762.1_7 Forward -135 -123 0.432302 0.0747
NP_441762.1_7 Reverse -124 -136 -6.74586 0.284
NP_442142.1_4 Forward -137 -124 13.49 0.0348
NP_442142.1_4 Reverse -122 -135 12.2117 0.0464
NP_442142.1_4 Forward -236 -223 5.82024 0.182
NP_442292.1_1 Forward -133 -124 18.486 0.00229
NP_442292.1_1 Reverse -126 -135 18.486 0.00229
NP_442292.1_1 Forward -385 -376 -0.295266 0.24
NP_442292.1_1 Reverse -378 -387 -0.786921 0.287
NP_442292.1_5 Reverse -186 -205 9.0459 0.138
NP_440122.1_2 Forward -280 -261 2.55606 0.237
NP_441525.1_1 Reverse -190 -203 11.0324 0.296
NP_440895.1_6 Reverse -119 -132 20.1771 0.0221
NP_440895.1_6 Forward -140 -127 11.3273 0.202
NP_442381.1_8 Reverse -122 -141 -4.6221 0.137
NP_441711.1_4 Reverse -325 -344 2.85105 0.264
NP_441523.1_6 Forward -138 -119 3.73603 0.27
NP_443009.1_5 Reverse -124 -135 8.90795 0.0965
NP_443009.1_5 Forward -135 -124 8.90795 0.0965
NP_443009.1_5 Reverse -376 -387 7.23633 0.135
NP_442408.2_1 Reverse -140 -159 -5.21209 0.269
NP_441715.1_4 Reverse -126 -136 17.3846 0.0106
NP_441715.1_4 Forward -133 -123 7.94484 0.107
NP_440279.1_2 Reverse -2 -21 18.289 0.0479
NP_441448.1_2 Forward -204 -185 1.76863 0.195
NP_440464.1_10 Forward -133 -123 13.0082 0.169
NP_441468.1_1 Forward -133 -126 15.8704 0.0124
NP_441468.1_1 Reverse -126 -133 15.8704 0.0124
NP_441468.1_1 Reverse -378 -385 6.13563 0.209
NP_441468.1_1 Forward -385 -378 6.0373 0.223
NP_441015.1_10 Forward -139 -120 -7.4737 0.267
NP_441673.1_1 Forward -134 -125 20.8459 0.000698
NP_441673.1_1 Reverse -125 -134 20.8459 0.000698
NP_441673.1_1 Reverse -377 -386 1.37636 0.114
NP_441673.1_1 Forward -386 -377 1.1797 0.163
NP_441673.1_1 Reverse -197 -206 -8.06341 0.254
NP_441826.1_2 Reverse -119 -133 6.78443 0.09
NP_441826.1_2 Forward -206 -192 -2.85201 0.277
NP_441330.1_1 Forward -139 -120 -4.72043 0.1
NP_442490.1_9 Forward -212 -193 -9.047 0.299
NP_441764.1_8 Forward -27 -17 11.5021 0.284
NP_442868.1_6 Forward -136 -126 19.2529 0.00563
NP_442868.1_6 Reverse -123 -133 9.81313 0.038
NP_442868.1_6 Forward -388 -378 -0.216628 0.273
NP_442719.1_2 Forward -70 -52 -3.42315 0.2
NP_442719.1_2 Reverse -262 -280 -11.8796 0.297
NP_441056.1_1 Reverse -125 -144 -8.752 0.283
NP_441612.1_2 Reverse -125 -135 8.54929 0.21
NP_441612.1_2 Forward -134 -124 8.54929 0.21
NP_442427.1_8 Reverse -368 -387 14.3558 0.119
NP_442808.1_1 Reverse -124 -134 8.63269 0.0481
NP_442808.1_1 Forward -135 -125 8.63269 0.0481
NP_442808.1_1 Forward -272 -262 2.83119 0.254
NP_441290.1_3 Reverse -262 -281 16.2241 0.187
NP_440145.1_3 Forward -144 -125 17.8957 0.00908
NP_440145.1_3 Reverse -115 -134 -0.983855 0.145
NP_440145.1_3 Reverse -367 -386 -5.99873 0.286
NP_442050.1_5 Forward -136 -126 14.3359 0.0206
NP_442050.1_5 Forward -388 -378 10.8943 0.126
NP_442050.1_5 Reverse -123 -133 7.64939 0.243
NP_442342.1_9 Forward -280 -264 2.32015 0.29
NP_440558.1_2 Reverse -307 -326 4.32602 0.152
NP_440558.1_2 Forward -143 -124 -1.7705 0.218
NP_440558.1_2 Forward -203 -184 -6.58872 0.277
NP_441518.1_3 Forward -144 -125 -10.522 0.246
NP_441878.1_6 Forward -135 -125 10.4031 0.0176
NP_441878.1_6 Reverse -124 -134 10.4031 0.0176
NP_441878.1_6 Reverse -376 -386 0.766681 0.134
NP_441878.1_6 Forward -387 -377 0.57002 0.14
NP_441878.1_6 Forward -207 -197 -0.118297 0.167
NP_441878.1_6 Reverse -196 -206 -7.19813 0.21
NP_441878.1_6 Forward -149 -139 -7.68978 0.255
NP_441036.1_8 Forward -135 -125 8.33817 0.174
NP_441036.1_8 Reverse -124 -134 8.33817 0.174
NP_442650.1_2 Forward -134 -120 8.25939 0.13
NP_440614.1_8 Reverse -173 -192 12.2908 0.237
NP_441557.1_5 Forward -134 -125 19.9609 0.000699
NP_441557.1_5 Reverse -125 -134 19.9609 0.000699
NP_441557.1_5 Forward -386 -377 7.57121 0.049
NP_441557.1_5 Reverse -377 -386 1.08137 0.0794
NP_441557.1_5 Reverse -217 -226 -0.590259 0.219
NP_441445.1_1 Reverse -116 -135 13.1758 0.0613
NP_441445.1_1 Forward -143 -124 1.86774 0.247
NP_441433.1_8 Forward -258 -239 -0.688862 0.249
NP_441458.1_10 Reverse -116 -135 6.09597 0.204
NP_442830.1_5 Forward -201 -187 6.19383 0.219
NP_442830.1_5 Forward -272 -258 5.80051 0.228
NP_441564.1_2 Reverse -377 -396 -5.40875 0.271
NP_442397.1_9 Forward -278 -259 2.26107 0.28
NP_442397.1_9 Reverse -133 -152 0.982764 0.299
NP_441467.1_9 Reverse -146 -160 20.0591 0.141
NP_442347.1_2 Forward -133 -124 12.4878 0.056
NP_442347.1_2 Reverse -126 -135 12.4878 0.056
NP_442645.1_2 Forward -142 -123 -12.7836 0.144
NP_442645.1_2 Reverse -152 -171 -20.2567 0.288
NP_441037.1_4 Reverse -267 -277 11.0211 0.17
NP_441037.1_4 Reverse -215 -225 9.75413 0.21
NP_441037.1_4 Reverse -375 -385 8.29227 0.237
NP_441037.1_4 Reverse -123 -133 7.9999 0.237
NP_441633.1_3 Forward -136 -123 3.46087 0.0699
NP_441633.1_3 Reverse -123 -136 1.19926 0.109
NP_441633.1_3 Forward -388 -375 -2.34066 0.177
NP_440136.1_2 Forward -133 -126 15.9687 0.0123
NP_440136.1_2 Reverse -126 -133 15.9687 0.0123
NP_440136.1_2 Reverse -378 -385 6.23397 0.171
NP_440136.1_2 Forward -385 -378 6.13563 0.193
NP_442998.1_10 Forward -384 -377 15.5754 0.0102
NP_442998.1_10 Forward -132 -125 15.5754 0.0102
NP_442998.1_10 Reverse -127 -134 15.5754 0.0102
NP_440731.1_2 Reverse -212 -231 3.44104 0.295
NP_440299.1_1 Reverse -121 -134 22.3398 0.000547
NP_440299.1_1 Forward -138 -125 10.6384 0.0557
NP_440299.1_1 Forward -390 -377 5.91857 0.158
NP_441799.1_1 Forward -138 -124 13.1753 0.0348
NP_441799.1_1 Reverse -121 -135 8.84875 0.105
NP_441799.1_1 Reverse -213 -227 3.63724 0.289
NP_442201.1_10 Reverse -114 -133 -4.52377 0.152
NP_442201.1_10 Forward -281 -262 -7.57203 0.201
NP_440256.1_1 Reverse -214 -233 -8.16202 0.253
NP_440256.1_1 Forward -338 -319 -9.44032 0.28
NP_440256.1_1 Reverse -122 -141 -10.227 0.297
NP_441559.1_8 Forward -139 -125 3.04785 0.143
NP_441559.1_8 Reverse -120 -134 2.65453 0.143
NP_441559.1_8 Forward -204 -190 -2.45868 0.192
NP_441559.1_8 Forward -391 -377 -7.08024 0.283
NP_440915.1_6 Reverse -121 -135 3.73617 0.1
NP_440915.1_6 Forward -138 -124 1.08123 0.147
NP_440915.1_6 Forward -390 -376 0.982901 0.148
NP_442158.1_1 Forward -178 -159 16.8651 0.21
NP_442866.1_1 Reverse -272 -291 -4.03212 0.224
NP_442866.1_1 Reverse -134 -153 -9.34199 0.292
NP_440748.1_5 Reverse -328 -347 -1.67217 0.267
NP_440702.1_2 Reverse -185 -204 -5.11376 0.257
NP_439985.1_7 Forward -140 -121 2.0644 0.296
NP_442993.1_1 Reverse -125 -141 -7.61128 0.146
NP_442993.1_1 Forward -206 -190 -9.97122 0.201
NP_440677.1_1 Reverse -116 -135 10.9142 0.163
NP_442386.1_9 Reverse -124 -133 13.8639 0.0289
NP_442386.1_9 Forward -135 -126 13.8639 0.0289
NP_442386.1_9 Forward -272 -263 7.37413 0.219
NP_441750.1_1 Reverse -263 -282 -8.16202 0.284
NP_441291.1_3 Forward -211 -192 14.4541 0.252
NP_441340.1_5 Forward -133 -126 15.6737 0.0124
NP_441340.1_5 Reverse -126 -133 15.6737 0.0124
NP_441340.1_5 Reverse -378 -385 13.5105 0.0314
NP_441340.1_5 Forward -385 -378 5.84064 0.208
NP_441340.1_9 Forward -26 -16 7.58037 0.256
NP_442240.1_2 Forward -133 -114 -18.9784 0.295
NP_440586.1_8 Forward -133 -126 13.2151 0.026
NP_440586.1_8 Reverse -126 -133 13.2151 0.026
NP_440586.1_8 Forward -385 -378 9.47853 0.146
NP_440586.1_8 Reverse -378 -385 5.74197 0.283
NP_442251.1_6 Forward -133 -126 15.2804 0.0124
NP_442251.1_6 Reverse -126 -133 15.2804 0.0124
NP_440684.1_9 Forward -212 -198 10.521 0.195
NP_440684.1_9 Reverse -119 -133 8.94771 0.221
NP_441262.1_3 Reverse -377 -384 14.7888 0.0223
NP_441262.1_3 Reverse -125 -132 14.7888 0.0223
NP_441262.1_3 Forward -134 -127 14.7888 0.0223
NP_443051.1_1 Reverse -376 -385 15.1427 0.00754
NP_443051.1_1 Reverse -124 -133 10.4228 0.00754
NP_443051.1_1 Forward -135 -126 10.4228 0.00754
NP_443051.1_1 Forward -387 -378 6.19458 0.0849
NP_443051.1_1 Reverse -216 -225 0.29472 0.195
NP_439984.1_10 Forward -195 -181 12.3887 0.232
NP_439937.1_9 Forward -201 -184 -11.7615 0.264
NP_439937.1_9 Forward -356 -339 -14.7114 0.287
NP_439937.1_9 Forward -135 -118 -16.383 0.287
NP_439937.1_9 Reverse -376 -393 -16.973 0.291
NP_440408.1_7 Reverse -256 -275 10.4225 0.247
NP_440439.1_1 Forward -137 -124 1.9859 0.138
NP_440439.1_1 Forward -389 -376 -0.865694 0.241
NP_442239.1_8 Reverse -268 -287 7.27595 0.258
NP_439943.1_1 Reverse -263 -282 -12.2919 0.296
NP_440372.1_2 Forward -133 -126 16.3621 0.0124
NP_440372.1_2 Reverse -126 -133 16.3621 0.0124
NP_440372.1_2 Reverse -378 -385 13.8055 0.0214
NP_440372.1_2 Forward -385 -378 6.52896 0.188
NP_441181.1_6 Reverse -179 -197 4.6407 0.243
NP_441803.1_2 Reverse -257 -276 9.93088 0.0928
NP_441803.1_2 Forward -127 -108 0.687771 0.247
NP_439977.1_5 Forward -140 -121 -1.57384 0.256
NP_440139.1_1 Forward -284 -265 2.16195 0.237
NP_440139.1_1 Reverse -371 -390 1.96529 0.242
NP_442384.1_10 Forward -134 -121 17.4239 0.00585
NP_442384.1_10 Reverse -125 -138 11.9173 0.0319
NP_442384.1_10 Reverse -377 -390 1.9859 0.24
NP_440472.1_1 Forward -395 -376 11.995 0.265
NP_440472.1_1 Reverse -301 -320 9.7334 0.298
NP_442121.1_4 Reverse -145 -164 -5.60541 0.286
NP_441877.1_5 Reverse -30 -49 -0.39387 0.276
NP_440476.1_5 Forward -351 -332 20.2556 0.137
NP_442790.1_4 Reverse -116 -135 -11.1119 0.221
NP_442262.1_10 Forward -133 -126 14.1988 0.0123
NP_442262.1_10 Reverse -126 -133 14.1988 0.0123
NP_442262.1_10 Forward -385 -378 13.2155 0.0213
NP_441689.1_5 Forward -136 -126 5.78111 0.197
NP_441689.1_5 Reverse -123 -133 5.78111 0.197
NP_440163.1_10 Forward -323 -313 12.3697 0.162
NP_440344.1_10 Reverse -118 -135 1.41547 0.0308
NP_440282.1_3 Forward -276 -257 -3.93378 0.298
NP_440282.1_10 Forward -132 -113 -10.1286 0.294
NP_440531.1_6 Reverse -270 -289 2.16274 0.161
NP_440531.1_6 Reverse -117 -136 -0.885524 0.225
NP_440531.1_6 Forward -142 -123 -3.63879 0.269
NP_440531.1_6 Forward -156 -137 -5.11376 0.293
NP_442917.1_8 Reverse -316 -335 13.9625 0.245
NP_442910.1_1 Reverse -370 -389 -5.40875 0.254
NP_442910.1_1 Reverse -118 -137 -6.88371 0.254
NP_442910.1_1 Forward -293 -274 -7.86702 0.269
NP_440562.1_3 Reverse -126 -143 6.52869 0.15
NP_440562.1_10 Forward -143 -125 15.7521 0.123
NP_441965.1_7 Forward -286 -267 21.5331 0.056
NP_441965.1_10 Forward -137 -121 3.20513 0.271
NP_442693.1_7 Forward -135 -116 11.2092 0.227
NP_440297.1_9 Reverse -140 -150 0.865012 0.282
NP_440297.1_9 Reverse -378 -388 0.176696 0.282
NP_440297.1_9 Forward -133 -123 -0.118297 0.282
NP_440297.1_9 Reverse -126 -136 -0.118297 0.282
NP_440297.1_9 Forward -385 -375 -0.216628 0.282
NP_441896.1_3 Forward -395 -376 4.71934 0.14
NP_440999.1_9 Reverse -121 -135 3.24451 0.133
NP_440999.1_9 Forward -138 -124 0.589577 0.18
NP_440999.1_9 Forward -390 -376 -3.147 0.287
NP_440888.1_2 Reverse -125 -139 13.4703 0.0285
NP_440888.1_2 Forward -134 -120 9.04542 0.139
NP_440888.1_2 Forward -206 -192 5.1122 0.293
NP_440792.1_5 Reverse -126 -145 12.6841 0.159
NP_440600.1_4 Reverse -117 -135 -0.7675 0.155
NP_439969.1_3 Reverse -120 -139 4.22769 0.214
NP_442033.1_10 Forward -136 -117 -7.67036 0.186
NP_442033.1_10 Reverse -123 -142 -8.752 0.206
NP_442033.1_10 Reverse -375 -394 -13.1769 0.283
NP_442871.1_4 Forward -204 -185 -9.53937 0.283
NP_441543.1_2 Forward -133 -124 16.9127 0.00359
NP_441543.1_2 Reverse -126 -135 16.9127 0.00359
NP_441543.1_2 Reverse -218 -227 4.42462 0.246
NP_442845.1_2 Reverse -119 -133 13.3726 0.0955
NP_441178.1_6 Forward -296 -277 9.53674 0.245
NP_441918.1_7 Reverse -268 -287 -3.63879 0.297
NP_439904.1_4 Reverse -146 -165 19.657 0.17
NP_441469.1_8 Forward -135 -126 6.48957 0.227
NP_441469.1_8 Reverse -124 -133 6.48957 0.227
NP_443064.1_6 Forward -134 -124 12.5669 0.0796
NP_443064.1_6 Reverse -125 -135 12.5669 0.0796
NP_442578.1_7 Forward -133 -126 14.5921 0.026
NP_442578.1_7 Reverse -126 -133 14.5921 0.026
NP_442578.1_7 Reverse -378 -385 6.0373 0.18
NP_441462.1_2 Forward -134 -124 11.5831 0.00406
NP_441462.1_2 Reverse -125 -135 11.5831 0.00406
NP_441462.1_2 Reverse -377 -387 9.51814 0.0171
NP_441462.1_2 Forward -386 -376 0.471689 0.148
NP_443062.1_1 Forward -134 -116 6.8883 0.19
NP_442204.1_1 Reverse -121 -132 8.7118 0.0852
NP_442204.1_1 Forward -138 -127 1.82863 0.266
NP_442204.1_1 Forward -290 -279 0.0586712 0.284
NP_442204.1_1 Forward -51 -40 -0.236322 0.289
NP_441560.1_10 Reverse -117 -136 9.43923 0.228
NP_440544.1_5 Reverse -20 -27 14.5681 0.264
NP_442487.1_5 Forward -304 -285 4.03023 0.265
NP_440255.1_5 Reverse -163 -177 19.11 0.19
NP_440516.1_2 Reverse -119 -137 4.54237 0.138
NP_440516.1_2 Forward -392 -374 -2.14413 0.298
NP_440516.1_8 Forward -134 -125 16.9127 0.00442
NP_440516.1_8 Reverse -125 -134 16.9127 0.00442
NP_440516.1_8 Reverse -377 -386 9.53783 0.0136
NP_440516.1_8 Reverse -269 -278 5.89959 0.103
NP_440516.1_8 Forward -386 -377 5.01461 0.118
NP_442428.1_5 Forward -133 -126 15.8704 0.0124
NP_442428.1_5 Reverse -126 -133 15.8704 0.0124
NP_442428.1_5 Reverse -378 -385 6.13563 0.209
NP_442428.1_5 Forward -385 -378 6.0373 0.212
NP_441443.1_10 Reverse -141 -159 15.8496 0.149
NP_440673.1_2 Forward -281 -262 10.8773 0.194
NP_440673.1_2 Reverse -267 -286 9.90183 0.228
NP_440673.1_3 Forward -384 -377 12.4288 0.0426
NP_440673.1_3 Forward -132 -125 12.4288 0.0426
NP_440673.1_3 Reverse -127 -134 12.4288 0.0426
NP_440865.1_9 Reverse -371 -390 -4.6221 0.207
NP_441052.1_2 Forward -134 -124 19.9412 0.00106
NP_441052.1_2 Reverse -125 -135 19.9412 0.00106
NP_441052.1_2 Forward -271 -261 2.43831 0.204
NP_441052.1_2 Forward -128 -118 1.55333 0.238
NP_441052.1_2 Forward -148 -138 1.455 0.244
NP_442219.1_8 Reverse -267 -286 11.4526 0.177
NP_442219.1_8 Forward -288 -269 10.3897 0.205
NP_442219.1_9 Forward -133 -124 17.7976 0.00718
NP_442219.1_9 Reverse -126 -135 17.7976 0.00718
NP_440436.1_4 Forward -133 -124 17.2072 0.00233
NP_440436.1_4 Reverse -126 -135 17.2072 0.00233
NP_440436.1_4 Forward -385 -376 6.29249 0.164
NP_440314.1_9 Reverse -126 -145 -8.35868 0.247
NP_441719.1_4 Forward -133 -126 16.3621 0.0124
NP_441719.1_4 Reverse -126 -133 16.3621 0.0124
NP_441719.1_4 Reverse -378 -385 6.82395 0.0855
NP_441719.1_4 Forward -385 -378 6.52896 0.188
NP_441004.1_1 Reverse -148 -167 -10.522 0.221
NP_441004.1_1 Reverse -263 -282 -12.7836 0.251
NP_441004.1_2 Reverse -143 -162 1.86774 0.217
NP_441004.1_4 Reverse -266 -276 11.1898 0.254
NP_441004.1_5 Reverse -265 -279 6.88276 0.296
NP_442366.1_3 Forward -135 -117 6.50899 0.0776
NP_442366.1_3 Forward -207 -189 -1.06249 0.204
NP_442366.1_5 Reverse -374 -384 14.8275 0.0375
NP_442366.1_5 Reverse -122 -132 14.0409 0.0497
NP_442366.1_5 Forward -209 -199 11.6809 0.168
NP_442206.1_1 Forward -320 -301 -3.93378 0.176
NP_442206.1_10 Reverse -377 -392 0.0782283 0.274
NP_440328.1_4 Reverse -119 -138 5.11266 0.154
NP_443054.1_2 Forward -388 -374 7.27608 0.164
NP_443054.1_2 Reverse -260 -274 0.687908 0.256
NP_443054.1_2 Forward -136 -122 -0.393733 0.294
NP_441851.1_10 Forward -135 -125 15.8113 0.00552
NP_441851.1_10 Reverse -124 -134 15.8113 0.00552
NP_441851.1_10 Reverse -376 -386 7.64985 0.135
NP_441851.1_10 Reverse -189 -199 6.37155 0.172
NP_441851.1_10 Forward -387 -377 6.07655 0.187
NP_442856.1_7 Forward -143 -124 -3.73712 0.247
NP_441668.1_4 Reverse -115 -134 -0.197208 0.249
NP_442515.1_1 Reverse -124 -138 9.83269 0.0596
NP_442515.1_1 Forward -135 -121 -4.81863 0.298
NP_440593.1_3 Reverse -192 -211 -6.88371 0.282
NP_441349.1_10 Reverse -187 -206 3.14605 0.0696
NP_441349.1_10 Reverse -115 -134 1.76941 0.0809
NP_441349.1_10 Forward -144 -125 -1.47551 0.104
NP_441409.1_6 Reverse -119 -138 9.63589 0.0243
NP_441409.1_6 Forward -392 -373 -13.8652 0.244
NP_440432.1_9 Forward -385 -370 5.78142 0.0512
NP_440431.1_3 Forward -135 -116 -2.75381 0.175
NP_442450.1_5 Reverse -375 -385 7.84651 0.13
NP_442450.1_5 Reverse -123 -133 7.55152 0.13
NP_440588.1_2 Forward -209 -190 0.982764 0.141
NP_440588.1_2 Reverse -116 -135 -3.54046 0.189
NP_439950.1_1 Forward -15 -6 12.5861 0.279
NP_440195.1_5 Reverse -271 -290 7.27595 0.181
NP_440195.1_5 Reverse -371 -390 5.50599 0.244
NP_442006.1_3 Reverse -263 -281 -6.86402 0.298
NP_441003.1_9 Forward -173 -154 4.916 0.274
NP_441570.1_1 Forward -134 -116 -16.3038 0.242
NP_441078.1_4 Forward -134 -125 19.6659 0.0007
NP_441078.1_4 Reverse -125 -134 19.6659 0.0007
NP_441078.1_4 Reverse -377 -386 0.196389 0.205
NP_441078.1_4 Forward -386 -377 -0.000272808 0.205
NP_441078.1_4 Reverse -217 -226 -1.18024 0.237
NP_441078.1_4 Reverse -197 -206 -1.77023 0.266
NP_442729.1_5 Reverse -268 -278 8.73149 0.248
NP_441091.1_5 Forward -138 -119 2.16274 0.29
NP_440526.1_3 Forward -133 -122 8.02298 0.126
NP_440526.1_3 Reverse -126 -137 8.02298 0.126
NP_440526.1_3 Forward -385 -374 1.3365 0.267
NP_441432.1_8 Reverse -124 -133 16.8143 0.00595
NP_441432.1_8 Forward -135 -126 16.8143 0.00595
NP_441432.1_8 Reverse -216 -225 6.09625 0.121
NP_441432.1_8 Reverse -376 -385 5.60459 0.147
NP_441432.1_8 Forward -287 -278 5.21127 0.185
NP_441432.1_8 Forward -43 -34 2.65466 0.292
NP_441432.1_9 Reverse -9 -22 7.91967 0.298
NP_442320.1_8 Reverse -371 -385 -4.4253 0.168
NP_441732.1_2 Reverse -121 -137 2.02515 0.0253
NP_441732.1_2 Forward -138 -122 -16.2644 0.165
NP_440685.1_6 Forward -389 -370 16.2232 0.231
NP_440760.1_1 Forward -134 -115 -13.7669 0.112
NP_440760.1_1 Reverse -125 -144 -21.0434 0.228
NP_442797.1_1 Forward -294 -275 -6.29373 0.296
NP_442797.1_7 Forward -279 -261 0.0191479 0.279
NP_441057.1_4 Reverse -268 -286 9.55725 0.141
NP_442353.1_4 Reverse -119 -138 6.29183 0.18
NP_440913.1_1 Reverse -324 -342 7.78729 0.196
NP_441072.1_2 Reverse -366 -385 9.43923 0.218
NP_441072.1_2 Reverse -114 -133 9.14423 0.224
NP_440713.1_4 Reverse -115 -134 5.211 0.214
NP_442489.1_7 Forward -134 -125 20.1576 0.000695
NP_442489.1_7 Reverse -125 -134 20.1576 0.000695
NP_442489.1_7 Forward -386 -377 0.688044 0.152
NP_442489.1_7 Reverse -377 -386 0.688044 0.152
NP_442489.1_7 Reverse -197 -206 -1.08191 0.179
NP_441830.1_2 Reverse -35 -54 3.73603 0.224
NP_441830.1_6 Reverse -38 -54 19.1347 0.0856
NP_440559.1_1 Forward -133 -124 17.4043 0.00658
NP_440559.1_1 Reverse -126 -135 17.4043 0.00658
NP_440559.1_1 Reverse -378 -387 13.6677 0.0368
NP_440559.1_1 Forward -385 -376 7.66954 0.0999
NP_441659.2_8 Forward -134 -124 18.1713 0.00133
NP_441659.2_8 Reverse -125 -135 18.1713 0.00133
NP_441659.2_8 Forward -206 -196 9.81313 0.0269
NP_441659.2_8 Forward -386 -376 6.66654 0.0694
NP_441659.2_8 Reverse -377 -387 6.46988 0.0744
NP_440426.1_7 Forward -144 -125 1.0811 0.248
NP_441092.1_3 Forward -132 -113 5.01433 0.183
NP_442913.1_10 Forward -143 -124 -0.295539 0.158
NP_441040.1_5 Forward -68 -49 8.55425 0.226
NP_441040.1_5 Forward -139 -120 2.16274 0.291
NP_441800.1_3 Forward -139 -121 3.55906 0.292
NP_442346.1_2 Reverse -114 -133 5.89931 0.281
NP_442346.1_5 Forward -135 -125 16.6963 0.00248
NP_442346.1_5 Reverse -124 -134 16.6963 0.00248
NP_442346.1_5 Forward -207 -197 11.5831 0.0634
NP_442346.1_5 Forward -149 -139 8.53483 0.133
NP_442346.1_5 Reverse -376 -386 7.55152 0.165
NP_440545.1_3 Reverse -121 -138 3.57876 0.0817
NP_440545.1_3 Reverse -373 -390 2.79211 0.0941
NP_440545.1_3 Forward -138 -121 -2.41943 0.184
NP_440459.1_2 Forward -136 -119 8.20031 0.267
NP_440459.1_2 Forward -280 -263 8.10198 0.27
NP_440459.1_2 Forward -235 -218 7.217 0.299
NP_440010.1_4 Forward -138 -119 3.83357 0.22
NP_440010.1_4 Reverse -115 -134 -2.55791 0.284
NP_441943.1_8 Reverse -144 -163 -13.3736 0.265
NP_442311.1_5 Reverse -178 -197 3.83436 0.245
NP_442603.1_7 Forward -134 -120 11.307 0.117
NP_442603.1_7 Reverse -125 -139 9.14375 0.155
NP_442603.1_7 Reverse -377 -391 8.75042 0.166
NP_440449.1_6 Reverse -261 -279 9.1312 0.187
NP_441502.1_3 Forward -136 -117 10.8159 0.21
NP_441833.1_4 Forward -133 -126 15.9687 0.0124
NP_441833.1_4 Reverse -126 -133 15.9687 0.0124
NP_441833.1_4 Forward -385 -378 6.52896 0.0924
NP_441833.1_4 Reverse -378 -385 6.23397 0.163
NP_442162.1_9 Forward -133 -126 16.2637 0.0124
NP_442162.1_9 Reverse -126 -133 16.2637 0.0124
NP_442162.1_9 Forward -385 -378 12.9205 0.0282
NP_442162.1_9 Reverse -378 -385 12.9205 0.0282
NP_440671.1_4 Reverse -119 -133 10.7177 0.151
NP_440671.1_4 Reverse -191 -205 5.01447 0.297
NP_440671.1_4 Reverse -204 -218 4.91614 0.3
NP_442140.1_3 Forward -133 -123 12.2714 0.0632
NP_442140.1_3 Reverse -270 -280 12.0747 0.0664
NP_442140.1_3 Forward -385 -375 11.4848 0.0757
NP_442140.1_3 Reverse -126 -136 10.3048 0.0902
NP_442021.1_3 Forward -225 -206 -7.08038 0.261
NP_441609.1_1 Reverse -55 -74 -2.55715 0.29
NP_441671.1_10 Reverse -108 -127 0.392778 0.281
NP_440875.1_9 Reverse -127 -137 8.37203 0.233
NP_441813.1_5 Forward -136 -126 18.1713 0.00743
NP_441813.1_5 Forward -388 -378 14.4347 0.0152
NP_441813.1_5 Reverse -123 -133 8.63316 0.0367
NP_440590.1_4 Forward -133 -120 12.9006 0.013
NP_440590.1_4 Reverse -126 -139 4.93583 0.0585
NP_440590.1_4 Reverse -378 -391 -3.71729 0.255
NP_440590.1_4 Forward -277 -264 -3.81562 0.255
NP_440567.1_1 Forward -225 -211 4.52282 0.118
NP_440567.1_1 Forward -133 -119 4.03116 0.131
NP_442497.1_10 Forward -133 -124 10.4228 0.0087
NP_442497.1_10 Reverse -126 -135 10.4228 0.0087
NP_442497.1_10 Forward -385 -376 10.0295 0.0222
NP_442497.1_10 Reverse -378 -387 8.25953 0.047
NP_440821.1_4 Reverse -123 -133 9.41981 0.0286
NP_440821.1_4 Forward -136 -126 9.41981 0.0286
NP_440821.1_4 Reverse -375 -385 1.25834 0.139
NP_440821.1_4 Forward -388 -378 0.57002 0.169
NP_441239.1_9 Forward -388 -376 14.887 0.0247
NP_441239.1_9 Forward -288 -276 6.92215 0.173
NP_441239.1_9 Forward -136 -124 5.25052 0.223
NP_441239.1_9 Reverse -123 -135 3.38223 0.285
NP_440156.1_4 Reverse -97 -107 16.4008 0.176
NP_441892.1_1 Reverse -116 -133 12.3302 0.0491
NP_441892.1_1 Forward -215 -198 0.92382 0.159
NP_441892.1_1 Forward -137 -120 -4.48438 0.261
NP_441017.1_8 Reverse -136 -151 7.35472 0.273
NP_440833.1_6 Forward -305 -291 6.88214 0.296
NP_442216.1_4 Forward -198 -190 15.3586 0.255
NP_441526.1_6 Reverse -260 -279 3.34271 0.271
NP_441617.1_3 Forward -307 -288 9.53756 0.161
NP_442138.1_10 Reverse -125 -144 -1.18052 0.171
NP_440546.1_4 Forward -134 -124 10.046 0.109
NP_440546.1_4 Reverse -125 -135 10.046 0.109
NP_440546.1_4 Reverse -269 -279 8.78555 0.171
NP_440546.1_4 Reverse -377 -387 6.94336 0.269
NP_441230.1_5 Reverse -272 -291 0.294447 0.271
NP_440462.1_6 Forward -136 -126 9.61647 0.0429
NP_440462.1_6 Reverse -123 -133 1.35667 0.294
NP_440868.1_4 Forward -138 -126 14.7886 0.0169
NP_440868.1_4 Reverse -121 -133 6.1355 0.0878
NP_440341.1_7 Forward -302 -288 12.1926 0.208
NP_442402.1_10 Forward -196 -186 11.1893 0.269
NP_441848.1_4 Forward -32 -16 12.8982 0.195
NP_440653.1_10 Forward -133 -114 4.916 0.238
NP_442358.1_1 Forward -142 -124 15.6538 0.194
NP_442039.1_4 Forward -133 -126 15.1821 0.0124
NP_442039.1_4 Reverse -126 -133 15.1821 0.0124
NP_442039.1_4 Reverse -378 -385 11.6422 0.0747
NP_442039.1_7 Reverse -148 -158 11.4848 0.257
NP_441811.1_1 Forward -62 -43 8.25926 0.28
NP_441811.1_8 Reverse -119 -133 5.80112 0.289
NP_440825.1_7 Forward -133 -123 12.9096 0.152
NP_442696.1_2 Reverse -124 -142 14.0805 0.128
NP_442837.1_3 Forward -133 -126 15.7721 0.0124
NP_442837.1_3 Reverse -126 -133 15.7721 0.0124
NP_442837.1_3 Forward -385 -378 6.0373 0.25
NP_442837.1_3 Reverse -378 -385 6.0373 0.25
NP_440160.1_9 Reverse -310 -329 17.404 0.131
NP_440160.1_9 Reverse -377 -396 12.8808 0.216
NP_442053.1_1 Forward -134 -125 18.3876 0.0007
NP_442053.1_1 Reverse -125 -134 18.3876 0.0007
NP_442053.1_1 Forward -386 -377 7.07956 0.105
NP_440505.1_3 Forward -136 -126 18.3679 0.00213
NP_440505.1_3 Reverse -123 -133 9.22315 0.122
NP_442456.1_4 Forward -104 -85 16.2232 0.244
NP_441203.1_1 Forward -133 -114 -20.0601 0.297
NP_441408.2_7 Reverse -215 -234 -2.75381 0.272
NP_440914.1_1 Forward -134 -124 17.5935 0.000537
NP_440914.1_1 Reverse -125 -135 17.5935 0.000537
NP_441011.1_8 Reverse -218 -227 11.8978 0.0614
NP_441011.1_8 Forward -133 -124 8.25953 0.144
NP_441011.1_8 Reverse -126 -135 8.25953 0.144
NP_442533.1_1 Reverse -184 -203 -14.8485 0.247
NP_442533.1_6 Forward -134 -125 17.2076 0.00137
NP_442533.1_6 Reverse -125 -134 17.2076 0.00137
NP_442533.1_6 Forward -271 -262 6.5879 0.106
NP_442533.1_6 Forward -386 -377 4.42462 0.179
NP_442533.1_6 Reverse -197 -206 4.0313 0.194
NP_442232.1_3 Reverse -117 -136 -14.5535 0.288
NP_441482.1_7 Forward -392 -378 -2.65535 0.0979
NP_441482.1_7 Reverse -119 -133 -8.45687 0.193
NP_441482.1_7 Forward -140 -126 -10.4235 0.209
NP_439944.1_9 Forward -133 -123 10.5014 0.0887
NP_439944.1_9 Reverse -126 -136 10.5014 0.0887
NP_441028.1_6 Reverse -19 -29 12.0743 0.192
NP_440115.1_6 Forward -137 -127 16.008 0.0325
NP_440115.1_6 Reverse -122 -132 9.32148 0.115
NP_440007.1_9 Forward -152 -138 2.75286 0.277
NP_440007.1_9 Reverse -121 -135 0.786239 0.29
NP_441961.1_4 Reverse -308 -327 4.03102 0.277
NP_441602.1_4 Forward -159 -140 8.65258 0.282
NP_441972.1_5 Forward -133 -114 -5.9004 0.226
NP_441106.1_1 Forward -135 -126 9.63616 0.0311
NP_441106.1_1 Reverse -124 -133 9.63616 0.0311
NP_439903.1_6 Forward -137 -118 0.883656 0.256
NP_442588.1_6 Forward -131 -112 2.0644 0.231
NP_442306.1_10 Forward -291 -272 -14.1602 0.197
NP_442306.1_10 Reverse -321 -340 -14.5535 0.197
NP_441286.1_1 Forward -135 -123 12.9203 0.00815
NP_441286.1_1 Reverse -124 -136 12.9203 0.00815
NP_441286.1_1 Forward -387 -375 -5.07423 0.188
NP_442674.1_3 Forward -156 -137 11.11 0.174
NP_442674.1_3 Reverse -117 -136 4.32522 0.294
NP_440670.1_8 Forward -134 -125 18.3876 0.000699
NP_440670.1_8 Reverse -125 -134 18.3876 0.000699
NP_440670.1_8 Reverse -377 -386 16.0277 0.00443
NP_440670.1_8 Forward -386 -377 12.5861 0.0253
NP_440886.1_7 Forward -135 -125 7.94438 0.0805
NP_440886.1_7 Reverse -124 -134 7.94438 0.0805
NP_442614.1_2 Reverse -377 -391 11.8976 0.176
NP_442614.1_2 Reverse -125 -139 9.04604 0.242
NP_442614.1_2 Forward -134 -120 8.25939 0.255
NP_441427.1_6 Reverse -265 -283 7.29564 0.297
NP_440907.2_8 Forward -385 -375 14.4342 0.0312
NP_440907.2_8 Forward -133 -123 7.64939 0.117
NP_442264.1_5 Forward -43 -29 10.6193 0.292
NP_441021.1_1 Forward -277 -258 -8.26035 0.194
NP_441463.1_3 Reverse -108 -127 -8.65367 0.272
NP_441626.1_2 Forward -133 -126 15.7721 0.0124
NP_441626.1_2 Reverse -126 -133 15.7721 0.0124
NP_441626.1_2 Reverse -378 -385 12.2322 0.0511
NP_441626.1_2 Forward -385 -378 5.93897 0.231
NP_441626.1_2 Forward -225 -218 4.759 0.258
NP_441460.1_5 Reverse -231 -245 18.4851 0.114
NP_442794.1_1 Reverse -121 -133 21.9668 0.00123
NP_442794.1_1 Forward -138 -126 10.2654 0.0721
NP_442794.1_1 Forward -390 -378 7.31547 0.142
NP_442794.1_1 Forward -290 -278 5.44718 0.221
NP_442615.1_1 Forward -143 -125 3.46073 0.0542
NP_442615.1_1 Reverse -116 -134 -0.865831 0.122
NP_440387.1_1 Forward -134 -118 5.36841 0.0325
NP_440387.1_1 Reverse -125 -141 -2.98973 0.153
NP_440855.1_5 Reverse -117 -136 5.80018 0.285
NP_441431.1_2 Forward -137 -123 10.422 0.159
NP_441431.1_2 Forward -389 -375 8.25877 0.221
NP_441431.1_2 Forward -158 -144 5.99717 0.281
NP_441488.1_8 Reverse -120 -134 12.782 0.146
NP_441836.1_2 Forward -140 -121 -0.885524 0.215
NP_441993.1_1 Reverse -119 -138 10.9128 0.122
NP_440467.1_3 Forward -133 -114 11.3539 0.278
NP_440114.1_10 Forward -286 -272 7.07942 0.246
NP_441510.2_6 Forward -144 -125 16.7149 0.13
NP_440293.1_3 Reverse -276 -295 -4.32711 0.262
NP_439988.1_3 Forward -217 -203 9.04604 0.249
NP_441237.1_9 Forward -133 -123 14.828 0.0242
NP_441237.1_9 Forward -277 -267 9.81313 0.265
NP_442743.1_5 Reverse -257 -276 17.404 0.0613
NP_441311.1_2 Reverse -211 -225 11.602 0.248
NP_442930.1_1 Reverse -169 -179 10.4026 0.276
NP_439910.1_2 Reverse -369 -386 -22.5773 0.267
NP_440457.1_1 Forward -390 -378 4.75886 0.154
NP_440457.1_1 Reverse -373 -385 3.38223 0.196
NP_440457.1_1 Forward -138 -126 0.628964 0.25
NP_440457.1_1 Reverse -121 -133 -0.452677 0.263
NP_440798.1_6 Forward -225 -212 2.96921 0.158
NP_440798.1_6 Forward -385 -372 2.87088 0.159
NP_440142.1_7 Forward -133 -114 17.994 0.0648
NP_442297.1_4 Reverse -121 -140 14.4749 0.195
NP_441984.1_3 Forward -297 -279 5.82068 0.276
NP_441436.1_8 Reverse -124 -143 13.0775 0.215
NP_440473.1_1 Reverse -122 -141 13.8604 0.179
NP_442509.1_9 Reverse -377 -387 10.8943 0.152
NP_442509.1_9 Forward -386 -376 10.5993 0.167
NP_442509.1_9 Forward -134 -124 8.14104 0.192
NP_442509.1_9 Reverse -125 -135 8.14104 0.192
NP_440554.1_4 Reverse -126 -136 8.92815 0.0646
NP_441885.1_5 Forward -134 -124 20.9245 0.000538
NP_441885.1_5 Reverse -125 -135 20.9245 0.000538
NP_441885.1_5 Reverse -377 -387 -0.0199663 0.186
NP_441885.1_5 Reverse -217 -227 -0.511621 0.202
NP_441885.1_5 Forward -148 -138 -1.19994 0.255
NP_440478.1_4 Reverse -121 -140 13.4708 0.19
NP_440478.1_10 Reverse -123 -137 7.9644 0.257
NP_442341.1_7 Forward -135 -121 16.1259 0.0186
NP_442341.1_7 Reverse -138 -152 2.16287 0.267
NP_442341.1_9 Forward -136 -122 12.5853 0.101
NP_442341.1_9 Forward -388 -374 6.39049 0.228
NP_441756.1_5 Reverse -121 -140 1.67108 0.215
NP_440423.1_6 Reverse -369 -388 -18.2901 0.233
NP_443000.1_7 Forward -136 -126 19.9412 0.00223
NP_443000.1_7 Reverse -123 -133 10.3048 0.0345
NP_440507.2_3 Forward -143 -124 12.88 0.145
NP_440275.1_3 Forward -136 -126 15.123 0.0182
NP_440275.1_3 Reverse -123 -133 8.04317 0.0602
NP_440275.1_3 Forward -388 -378 7.45319 0.0714
NP_440275.1_3 Reverse -375 -385 7.35486 0.0755
NP_440091.1_1 Forward -138 -126 -0.452677 0.273
NP_442275.1_1 Reverse -346 -365 -0.197208 0.295
NP_441397.1_8 Forward -28 -15 12.8577 0.255
NP_441902.1_3 Forward -28 -18 12.2043 0.259
NP_441105.1_3 Reverse -114 -133 10.0292 0.043
NP_442373.1_1 Forward -280 -261 -1.67217 0.183
NP_440216.1_1 Reverse -125 -139 7.37441 0.00942
NP_440216.1_1 Forward -386 -372 -5.70361 0.135
NP_440216.1_1 Forward -134 -120 -10.2268 0.145
NP_440216.1_1 Forward -226 -212 -11.5051 0.192
NP_440216.1_1 Reverse -377 -391 -11.8001 0.219
NP_440172.1_1 Forward -134 -124 15.0247 0.00945
NP_440172.1_1 Reverse -125 -135 15.0247 0.00945
NP_440172.1_1 Forward -386 -376 3.51995 0.224
NP_440172.1_1 Reverse -269 -279 1.74999 0.299
NP_442015.1_10 Forward -390 -377 21.7504 0.00329
NP_442015.1_10 Reverse -121 -134 19.8821 0.00366
NP_442015.1_10 Forward -138 -125 11.4257 0.0372
NP_441226.1_7 Forward -133 -126 14.4934 0.0123
NP_441226.1_7 Reverse -126 -133 14.4934 0.0123
NP_441226.1_7 Reverse -378 -385 12.7234 0.0312
NP_441226.1_7 Forward -385 -378 11.5435 0.0757
NP_441111.1_7 Forward -133 -125 18.7023 0.00294
NP_441111.1_7 Reverse -126 -134 18.7023 0.00294
NP_441111.1_7 Forward -385 -377 8.86921 0.0589
NP_441111.1_7 Forward -225 -217 -0.570565 0.233
NP_441766.1_2 Forward -134 -125 17.5026 0.00297
NP_441766.1_2 Reverse -125 -134 17.5026 0.00297
NP_441766.1_2 Forward -386 -377 12.6844 0.0158
NP_442252.1_3 Reverse -370 -388 9.26226 0.244
NP_440416.1_9 Reverse -118 -137 2.26107 0.0409
NP_440416.1_9 Forward -141 -122 -16.2252 0.21
NP_443052.1_9 Forward -288 -269 -5.31042 0.266
NP_443052.1_9 Reverse -267 -286 -7.27704 0.295
NP_440261.1_5 Reverse -126 -139 4.8375 0.0516
NP_440261.1_5 Forward -133 -120 -2.83231 0.0932
NP_440261.1_5 Reverse -378 -391 -4.79893 0.17
NP_440988.1_10 Forward -136 -122 7.22233 0.219
NP_440988.1_10 Reverse -123 -137 6.44783 0.232
NP_440988.1_10 Reverse -104 -118 5.4797 0.243
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CGCCTTGCTTCCCGTCCGATCGCCCATTTATTTAAGACCTTTAGCCAGGATGTCAGCACAGAACGGGTCATTGGTTGCACGGGCACTGTCACCTCGAAAAAGTTGCCCTACCTAGCCAATGGCACCATCGGCCAAGCCCATGTTTATGACAATGCGGGAAATCTAATCACCATCAGCGTTAGCCTACCGGATTGGGCCACCGTCATTCCCCACCATAATCAGGAAATTTTGATCATTGACCAGTCCCCCAAGGGTTATGGCTACCTGGCGATCGCCAAGGACAGTTCCGACGAGGATAAATGGTTAAAGTCTTAAAGACCCAAACTTTTCAGTGTTGGTCAAAGTCCCACCCATGCGAGGCATTGTCTAGACTGGAGAAAAAATTGCGAGGATTAACCCC

CDS

ATGACCGTAGCCCTCGACCGAGAAATCATTTACCCCGACAGCGATGGACAGCCCATGGCCGACAACACAGAACAATTTGAATGGATTGTCCTCCTGAAAGAAAATTTGGAATGCCTCTTCGCCCACAACCCAGACGTATTTGTCGGGGGAGACCTGTTGTGGTATCCCGTGGAAGGGCATCCAGAAATTCGCGTGGCACCGGACGTAATGGTGGCTTTGGGCAGACCCAAGGGAAAACGGGGTTCCTACCGCCAGTGGCAGGAAAATAACCAAGCGCCCCAAGTGGTGTTTGAAATTTTATCCCCTGGCAACACCCTCAAGGAAATGACCAAAAAGTTGAAGTTCTATGACCATCACGGCGTAGAAGAGTACTATGTTTATGATCCAGATGACAATGAGCTAACTGGGTTGCAACGAATTGGCGGAGAGTTGACCATCATCGAGGAGATGGCCCATTGGGTTAGTCCTTTGTTGGGCATAAAATTTGAGCTGAGCGCTGAGACTTTGCGGGTTTATTATCCTGACGGGCGACCTTTTCTCTCCACCGTGGCATTAGCAACCCAGGCTGAACAAGCATCCCAACGGGCCAACGAAGAGGCTCAACGGGCTGAGCGGGAAAAACTCCGGGCCGAATTAGCGGAAGCAGAAAACGATCGCCTCAAGGCATTGTTAGCGGAGGCCGGCATTGACGTTTAA

Protein

MTVALDREIIYPDSDGQPMADNTEQFEWIVLLKENLECLFAHNPDVFVGGDLLWYPVEGHPEIRVAPDVMVALGRPKGKRGSYRQWQENNQAPQVVFEILSPGNTLKEMTKKLKFYDHHGVEEYYVYDPDDNELTGLQRIGGELTIIEEMAHWVSPLLGIKFELSAETLRVYYPDGRPFLSTVALATQAEQASQRANEEAQRAEREKLRAELAEAENDRLKALLAEAGIDV