Your browser is old and dusty. Try Google Chrome!

Details for sll0992

ORF sll0992
Accession NP_440483.1
Symbol
Category Other
Definition putative esterase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -27 -41 -1.5737 0.265
NP_441453.1_4 Reverse -265 -273 5.42762 0.135
NP_441623.1_1 Reverse -353 -371 -2.53746 0.241
NP_440150.1_6 Forward -255 -236 0.687771 0.296
NP_442287.1_1 Reverse -238 -248 17.1874 0.122
NP_442173.1_1 Reverse -266 -274 9.45919 0.0825
NP_442975.1_10 Reverse -176 -190 5.99717 0.198
NP_440061.1_9 Reverse -263 -277 14.7486 0.0595
NP_440061.1_9 Forward -250 -236 6.39049 0.248
NP_440110.1_8 Forward -292 -273 1.37609 0.211
NP_440110.1_8 Forward -138 -119 -0.197208 0.219
NP_439979.1_9 Reverse -186 -204 8.27895 0.269
NP_442062.1_8 Forward -63 -53 4.40493 0.217
NP_442062.1_8 Reverse -265 -275 3.71661 0.256
NP_440839.1_8 Forward -250 -237 19.4888 0.147
NP_441859.1_3 Reverse -264 -283 1.37531 0.287
NP_440304.1_4 Forward -276 -266 5.97822 0.185
NP_442762.1_10 Reverse -210 -229 -12.2919 0.284
NP_439918.1_2 Forward -309 -290 -3.73712 0.261
NP_440893.1_3 Reverse -264 -283 7.07848 0.262
NP_440764.1_10 Reverse -268 -287 12.4867 0.253
NP_442110.1_7 Forward -310 -296 -0.000409212 0.27
NP_441082.1_10 Forward -288 -275 10.5407 0.236
NP_440856.1_7 Forward -296 -277 -9.14533 0.283
NP_441083.1_5 Reverse -265 -275 -1.00328 0.289
NP_440109.1_6 Reverse -223 -242 8.75091 0.268
NP_441558.1_5 Forward -197 -178 5.11266 0.26
NP_440407.1_6 Forward -331 -317 14.1593 0.212
NP_441713.1_1 Reverse -233 -252 -15.3402 0.261
NP_440178.1_7 Forward -354 -335 -22.125 0.255
NP_442570.1_3 Forward -191 -172 -6.88371 0.263
NP_441716.1_1 Reverse -180 -194 3.04785 0.282
NP_440343.1_9 Forward -258 -239 15.0441 0.139
NP_440747.1_10 Reverse -236 -248 -4.38592 0.0974
NP_441486.1_1 Reverse -262 -276 -6.09693 0.278
NP_441486.1_1 Reverse -194 -208 -6.09693 0.278
NP_440403.1_4 Reverse -174 -193 5.01433 0.111
NP_441014.1_5 Forward -301 -283 9.75391 0.274
NP_441014.1_8 Reverse -347 -366 -8.65367 0.288
NP_443018.1_3 Reverse -266 -273 8.8889 0.136
NP_440376.1_1 Forward -248 -239 4.42462 0.159
NP_442687.1_7 Forward -275 -265 15.418 0.0158
NP_442191.1_4 Reverse -275 -289 11.9627 0.233
NP_442485.1_3 Reverse -237 -256 0.0977854 0.247
NP_441846.1_10 Forward -365 -346 -21.7317 0.256
NP_441013.1_2 Forward -259 -241 -1.94747 0.282
NP_440550.1_7 Forward -71 -52 18.5831 0.0766
NP_440360.1_10 Reverse -267 -281 5.30946 0.227
NP_442658.1_1 Forward -276 -266 6.37109 0.231
NP_442782.1_2 Reverse -174 -188 14.9459 0.173
NP_442782.1_2 Reverse -27 -41 7.76774 0.202
NP_442782.1_2 Reverse -54 -68 0.294584 0.291
NP_441414.1_9 Forward -274 -255 -5.50708 0.177
NP_441487.1_6 Reverse -23 -42 -0.000545616 0.259
NP_441958.1_5 Forward -275 -265 7.25653 0.0347
NP_442836.1_5 Forward -280 -261 5.89931 0.185
NP_440203.1_5 Reverse -268 -278 8.43603 0.299
NP_439905.1_1 Reverse -266 -279 15.5556 0.0887
NP_442376.1_7 Forward -46 -27 5.80098 0.248
NP_441591.1_10 Forward -286 -267 4.916 0.297
NP_443055.1_3 Forward -257 -238 11.982 0.234
NP_443055.1_6 Reverse -265 -283 3.36165 0.196
NP_442002.1_9 Forward -275 -268 12.4288 0.185
NP_440809.1_9 Forward -302 -284 -7.65067 0.225
NP_441646.1_1 Reverse -339 -358 1.47442 0.231
NP_442431.1_10 Forward -188 -170 5.32902 0.201
NP_442771.1_1 Forward -122 -104 -0.472507 0.108
NP_440147.1_4 Reverse -263 -276 -0.669033 0.294
NP_441550.1_8 Forward -276 -266 9.02601 0.11
NP_441041.1_4 Forward -206 -187 -3.24547 0.12
NP_441041.1_4 Reverse -317 -336 -11.8003 0.252
NP_442004.1_6 Forward -195 -181 6.29277 0.178
NP_441725.1_5 Reverse -266 -276 7.35486 0.101
NP_442281.1_1 Reverse -319 -333 2.16228 0.276
NP_442281.1_1 Reverse -175 -189 1.67063 0.293
NP_001035871.2_7 Reverse -56 -66 14.533 0.187
NP_440437.1_1 Forward -201 -182 0.491109 0.17
NP_442982.1_5 Forward -205 -186 -3.3438 0.297
NP_441644.1_6 Reverse -265 -275 9.12434 0.084
NP_442215.1_2 Reverse -165 -181 -2.98973 0.207
NP_442029.1_6 Forward -257 -238 5.30933 0.253
NP_442313.1_5 Forward -188 -169 5.80098 0.255
NP_440919.1_1 Forward -279 -260 -3.14714 0.221
NP_441024.1_6 Reverse -81 -100 6.82725 0.292
NP_443009.1_5 Forward -224 -213 8.21964 0.114
NP_442408.2_1 Forward -63 -44 -2.55715 0.241
NP_442408.2_1 Reverse -32 -51 -7.4737 0.3
NP_440015.1_9 Forward -274 -256 3.75572 0.17
NP_442076.1_5 Forward -339 -320 5.50599 0.293
NP_440183.1_9 Reverse -241 -260 -13.8652 0.26
NP_441198.1_8 Forward -276 -266 11.2205 0.217
NP_440379.1_5 Forward -257 -238 -11.1119 0.288
NP_441468.1_1 Forward -247 -240 6.72562 0.126
NP_441339.1_4 Forward -304 -285 -3.3438 0.227
NP_441876.1_9 Reverse -270 -280 13.4509 0.267
NP_442745.1_9 Forward -373 -355 19.1937 0.0961
NP_442868.1_6 Forward -276 -266 3.81494 0.192
NP_442719.1_2 Reverse -258 -276 -11.4863 0.292
NP_443058.1_7 Reverse -379 -398 4.71934 0.255
NP_442808.1_1 Reverse -273 -283 13.0576 0.0481
NP_442808.1_1 Reverse -247 -257 1.65123 0.282
NP_442808.1_1 Reverse -137 -147 1.06124 0.296
NP_442542.1_2 Forward -276 -263 8.18076 0.16
NP_442342.1_9 Forward -122 -106 6.74504 0.217
NP_441114.1_3 Reverse -181 -190 6.68623 0.254
NP_441878.1_6 Forward -249 -239 1.06167 0.116
NP_441557.1_5 Forward -274 -265 -0.786921 0.239
NP_441557.1_8 Reverse -275 -285 14.7292 0.183
NP_441445.1_1 Reverse -139 -158 -0.4922 0.294
NP_442183.1_1 Forward -120 -106 10.6193 0.0821
NP_442183.1_9 Forward -179 -169 16.6963 0.206
NP_440979.1_3 Reverse -266 -284 9.85225 0.291
NP_441549.1_9 Reverse -182 -200 -11.0923 0.299
NP_442347.1_2 Forward -162 -153 3.63797 0.284
NP_442645.1_2 Forward -335 -316 -20.0601 0.288
NP_442594.1_8 Forward -179 -160 2.55606 0.295
NP_441633.1_3 Reverse -263 -276 -6.66722 0.265
NP_442590.1_10 Forward -366 -347 7.66927 0.221
NP_442998.1_10 Reverse -267 -274 12.5271 0.0457
NP_440899.1_1 Forward -321 -302 6.84597 0.267
NP_440899.1_2 Reverse -169 -188 11.405 0.13
NP_441799.1_1 Forward -278 -264 5.50552 0.206
NP_442334.1_2 Forward -284 -267 -3.8944 0.2
NP_442333.2_5 Reverse -169 -188 -7.96535 0.234
NP_440087.1_1 Forward -283 -264 -8.45701 0.28
NP_441559.1_8 Forward -253 -239 0.88457 0.16
NP_440915.1_6 Forward -287 -273 -1.37704 0.233
NP_441179.1_9 Reverse -136 -146 8.73102 0.284
NP_440717.1_3 Reverse -114 -128 16.0269 0.179
NP_442866.1_1 Reverse -48 -67 -6.58872 0.255
NP_442866.1_1 Forward -371 -352 -9.047 0.288
NP_440748.1_5 Reverse -182 -201 -0.590531 0.26
NP_441464.1_10 Forward -285 -271 8.06273 0.287
NP_440026.1_4 Reverse -210 -229 8.25926 0.28
NP_440695.1_6 Forward -237 -223 11.4779 0.265
NP_442453.1_6 Reverse -245 -259 19.3641 0.0983
NP_441417.1_2 Reverse -103 -122 3.53937 0.167
NP_440677.1_1 Forward -378 -359 7.7676 0.228
NP_442386.1_9 Reverse -273 -282 7.57079 0.219
NP_440570.1_5 Forward -94 -75 1.57275 0.237
NP_441340.1_5 Forward -273 -266 4.07068 0.239
NP_440327.1_3 Reverse -279 -298 14.0608 0.286
NP_440586.1_9 Reverse -208 -227 6.98095 0.277
NP_440027.1_3 Reverse -274 -292 7.3932 0.211
NP_440027.1_3 Reverse -265 -283 5.32826 0.245
NP_443051.1_1 Forward -275 -266 5.40793 0.0926
NP_439937.1_9 Reverse -110 -127 -7.72996 0.165
NP_439937.1_9 Reverse -264 -281 -17.0714 0.291
NP_440926.1_9 Forward -138 -119 7.86593 0.275
NP_440408.1_7 Forward -189 -170 7.66927 0.284
NP_440439.1_1 Reverse -298 -311 -0.0790467 0.207
NP_440372.1_2 Forward -273 -266 4.07068 0.262
NP_441789.1_7 Reverse -238 -257 1.27698 0.245
NP_441572.1_7 Reverse -174 -193 -1.67217 0.19
NP_440267.1_2 Forward -29 -15 10.0287 0.153
NP_440267.1_2 Forward -68 -54 8.45543 0.162
NP_442384.1_10 Reverse -180 -193 5.32916 0.131
NP_440364.1_6 Reverse -317 -330 15.7516 0.275
NP_441877.1_7 Forward -343 -324 1.76863 0.241
NP_441018.1_7 Forward -180 -161 6.09597 0.299
NP_442262.1_10 Reverse -266 -273 11.4455 0.102
NP_440344.1_2 Forward -253 -234 13.5691 0.229
NP_440531.1_6 Forward -256 -237 -3.93378 0.273
NP_440531.1_8 Forward -138 -119 1.96607 0.298
NP_441965.1_10 Forward -251 -235 15.0048 0.0695
NP_441965.1_10 Reverse -38 -54 4.3851 0.242
NP_440297.1_9 Forward -89 -79 -0.118297 0.282
NP_440990.1_10 Forward -132 -113 16.5191 0.261
NP_440894.1_10 Forward -217 -198 2.16274 0.294
NP_440888.1_2 Forward -189 -175 8.55376 0.156
NP_440888.1_2 Reverse -239 -253 7.66879 0.186
NP_440888.1_2 Reverse -360 -374 7.47213 0.194
NP_439969.1_1 Reverse -272 -291 -5.9004 0.288
NP_442845.1_2 Reverse -174 -188 3.24451 0.298
NP_440208.1_1 Reverse -236 -255 -3.83545 0.253
NP_441304.1_4 Forward -182 -163 11.5042 0.278
NP_443064.1_3 Reverse -271 -290 13.2741 0.159
NP_442337.1_8 Forward -343 -324 -1.67217 0.288
NP_441306.1_10 Reverse -256 -270 15.2402 0.247
NP_440220.1_4 Forward -244 -225 -2.06626 0.266
NP_441462.1_2 Forward -274 -264 -0.904945 0.265
NP_442204.1_2 Forward -220 -201 9.63589 0.225
NP_440516.1_8 Forward -274 -265 -0.295266 0.232
NP_441867.1_2 Forward -284 -265 -14.1602 0.277
NP_440673.1_3 Reverse -267 -274 9.77388 0.167
NP_441336.1_3 Reverse -379 -393 14.3559 0.298
NP_440314.1_9 Reverse -266 -285 2.16274 0.0862
NP_441004.1_1 Reverse -87 -106 -3.44213 0.159
NP_442813.1_4 Forward -191 -172 -8.16202 0.299
NP_442366.1_5 Reverse -12 -22 12.1726 0.143
NP_442176.1_1 Forward -281 -262 5.211 0.294
NP_442206.1_7 Reverse -237 -256 16.8141 0.254
NP_440328.1_4 Reverse -351 -370 -1.27885 0.299
NP_442308.1_4 Forward -303 -284 5.11266 0.267
NP_441851.1_10 Reverse -153 -163 6.46988 0.167
NP_440593.1_3 Reverse -163 -182 -5.21209 0.259
NP_440463.1_7 Reverse -271 -285 18.6825 0.0903
NP_440389.1_3 Reverse -188 -207 16.0274 0.176
NP_442843.1_1 Forward -325 -306 -11.0136 0.285
NP_441477.1_5 Reverse -240 -259 13.7658 0.268
NP_440431.1_3 Forward -250 -231 -10.817 0.278
NP_442450.1_5 Forward -165 -155 5.78156 0.227
NP_440943.1_4 Forward -390 -378 15.3786 0.189
NP_440483.1_1 Forward -288 -269 25.4672 0.00467
NP_440483.1_2 Forward -338 -319 30.4821 0.000017
NP_440483.1_3 Forward -314 -295 25.8605 0.00682
NP_440483.1_4 Forward -254 -235 31.5637 0.000204
NP_440483.1_5 Forward -221 -202 30.3837 0.000309
NP_440483.1_6 Forward -59 -40 18.9238 0.202
NP_440483.1_7 Forward -194 -175 26.5488 0.0062
NP_440483.1_8 Forward -164 -145 28.0238 0.00145
NP_440483.1_9 Forward -362 -343 24.0905 0.00293
NP_440483.1_10 Forward -79 -60 28.3188 0.000497
NP_441078.1_4 Reverse -239 -248 -1.6719 0.266
NP_441078.1_4 Forward -248 -239 -1.86856 0.272
NP_442729.1_8 Reverse -107 -120 7.78743 0.136
NP_442443.1_1 Forward -304 -285 -5.9004 0.287
NP_441432.1_8 Forward -275 -266 6.5879 0.112
NP_442003.1_4 Forward -205 -186 9.14423 0.3
NP_442797.1_6 Forward -60 -41 9.00069 0.25
NP_440199.1_10 Forward -78 -68 13.353 0.108
NP_440913.1_1 Reverse -25 -43 11.0322 0.168
NP_442400.1_1 Reverse -255 -274 4.81767 0.126
NP_440713.1_4 Forward -288 -269 3.53937 0.242
NP_442489.1_7 Forward -248 -239 -1.37691 0.195
NP_442489.1_7 Reverse -265 -274 -1.77023 0.247
NP_440559.1_1 Forward -273 -264 11.5045 0.051
NP_441659.2_8 Reverse -265 -275 4.10993 0.144
NP_441659.2_8 Reverse -239 -249 -0.314959 0.298
NP_440426.1_7 Forward -73 -54 9.93088 0.139
NP_442849.1_1 Reverse -90 -104 21.3374 0.046
NP_442776.1_1 Reverse -346 -365 4.52268 0.274
NP_442346.1_5 Forward -275 -265 5.5849 0.238
NP_440010.1_3 Forward -295 -276 -8.65367 0.299
NP_440010.1_10 Forward -302 -283 3.44104 0.257
NP_440946.1_6 Forward -285 -266 1.76941 0.294
NP_442162.1_9 Reverse -266 -273 9.28223 0.0694
NP_440671.1_4 Forward -290 -276 8.35772 0.201
NP_442140.1_3 Reverse -266 -276 3.61828 0.288
NP_441671.1_10 Forward -259 -240 5.30933 0.217
NP_440590.1_4 Forward -194 -181 0.314277 0.16
NP_442497.1_10 Reverse -266 -275 0.196389 0.208
NP_440821.1_4 Forward -276 -266 0.0783647 0.205
NP_441239.1_9 Forward -250 -238 7.70879 0.15
NP_441951.1_4 Forward -296 -277 0.982764 0.29
NP_441892.1_1 Reverse -171 -188 -0.649475 0.188
NP_442044.1_1 Reverse -301 -320 -13.8652 0.28
NP_442643.1_3 Forward -205 -186 -5.70374 0.261
NP_441526.1_6 Reverse -88 -107 3.24438 0.271
NP_440462.1_6 Reverse -299 -309 5.28991 0.161
NP_440705.1_4 Forward -44 -25 6.98095 0.296
NP_440868.1_4 Forward -278 -266 0.0389777 0.234
NP_440374.1_1 Reverse -380 -399 13.1758 0.214
NP_441269.1_4 Forward -122 -103 15.7324 0.249
NP_441474.1_1 Forward -205 -186 -2.45958 0.277
NP_441474.1_1 Reverse -347 -366 -2.8529 0.29
NP_442402.1_4 Forward -108 -89 -9.73604 0.292
NP_442402.1_10 Forward -234 -224 12.0743 0.224
NP_441848.1_7 Reverse -175 -194 -3.04956 0.274
NP_440696.1_3 Forward -293 -275 -3.52077 0.287
NP_440160.1_3 Forward -398 -379 7.17681 0.299
NP_440160.1_9 Reverse -26 -45 10.1275 0.235
NP_440505.1_3 Forward -276 -266 4.60159 0.277
NP_440914.1_1 Forward -326 -316 6.56569 0.273
NP_442533.1_6 Reverse -239 -248 14.1594 0.0149
NP_442533.1_6 Reverse -180 -189 3.14632 0.224
NP_442533.1_6 Reverse -186 -195 2.06468 0.275
NP_442322.1_4 Reverse -172 -189 -9.99156 0.297
NP_442229.1_3 Forward -357 -340 11.7402 0.291
NP_440116.1_8 Forward -273 -254 -0.39387 0.107
NP_440116.1_8 Forward -309 -290 -7.76869 0.237
NP_440115.1_6 Forward -277 -267 16.2046 0.0325
NP_440115.1_6 Forward -123 -113 6.96153 0.166
NP_440007.1_9 Forward -167 -153 0.786239 0.29
NP_441680.1_4 Reverse -273 -292 -0.39387 0.253
NP_441059.1_2 Forward -394 -375 -2.75381 0.242
NP_441059.1_2 Forward -382 -363 -6.88371 0.268
NP_442673.1_5 Forward -339 -321 18.0137 0.15
NP_441972.1_5 Forward -309 -290 -9.73531 0.293
NP_440429.1_9 Forward -292 -273 0.491109 0.297
NP_439903.1_1 Forward -206 -187 -1.96717 0.264
NP_439903.1_6 Forward -66 -47 0.981987 0.255
NP_442928.1_3 Reverse -272 -291 15.7055 0.205
NP_441286.1_1 Reverse -264 -276 -4.58258 0.165
NP_441286.1_1 Reverse -153 -165 -5.95921 0.235
NP_440886.1_7 Reverse -274 -284 9.02601 0.0805
NP_440886.1_7 Reverse -273 -283 4.60114 0.227
NP_440828.1_1 Reverse -273 -292 7.86512 0.197
NP_440205.1_3 Forward -155 -136 8.06259 0.242
NP_442072.1_9 Forward -311 -293 -23.482 0.297
NP_440907.2_8 Reverse -266 -276 7.84605 0.117
NP_440841.1_1 Reverse -103 -122 16.1257 0.274
NP_441463.1_6 Forward -197 -183 6.02939 0.283
NP_442467.1_4 Reverse -186 -205 6.19431 0.287
NP_440855.1_5 Reverse -159 -178 3.73524 0.287
NP_441431.1_2 Reverse -240 -254 8.84875 0.204
NP_441431.1_2 Forward -277 -263 5.99717 0.281
NP_441993.1_1 Forward -369 -350 4.48058 0.22
NP_440114.1_10 Reverse -265 -279 6.09611 0.285
NP_441858.1_10 Reverse -327 -346 3.14605 0.292
NP_441510.2_7 Forward -47 -33 13.5686 0.28
NP_442743.1_1 Forward -105 -86 6.09517 0.268
NP_442743.1_1 Reverse -245 -264 4.42355 0.292
NP_440457.1_1 Forward -278 -266 2.49725 0.21
NP_440457.1_1 Forward -124 -112 -0.0593532 0.25
NP_441801.1_4 Reverse -348 -358 2.53664 0.292
NP_440801.1_8 Reverse -280 -299 6.39097 0.166
NP_441984.1_1 Forward -188 -170 11.2289 0.196
NP_441984.1_4 Forward -182 -168 11.7993 0.299
NP_441332.1_3 Reverse -360 -379 12.5858 0.173
NP_441332.1_6 Reverse -273 -283 15.3256 0.121
NP_440473.1_1 Forward -93 -74 10.8718 0.289
NP_440473.1_9 Forward -285 -266 -5.60541 0.22
NP_442439.1_8 Reverse -193 -212 10.0292 0.246
NP_442514.1_5 Reverse -159 -178 -8.55607 0.285
NP_440734.1_9 Reverse -271 -290 12.3892 0.24
NP_441885.1_5 Forward -274 -264 8.23984 0.0352
NP_440478.1_9 Reverse -269 -288 16.5191 0.195
NP_442341.1_9 Forward -250 -236 8.06211 0.179
NP_442395.2_4 Forward -201 -182 0.785326 0.26
NP_441842.1_1 Reverse -267 -280 16.9316 0.0405
NP_441842.1_1 Reverse -113 -126 15.9483 0.0521
NP_440275.1_3 Forward -276 -266 7.25653 0.0823
NP_443010.1_10 Forward -277 -260 4.02703 0.242
NP_439962.1_4 Forward -292 -273 -7.37537 0.288
NP_442495.1_2 Forward -192 -173 11.9958 0.266
NP_440149.1_8 Forward -369 -350 -4.6221 0.211
NP_442373.1_2 Forward -191 -172 -11.3086 0.293
NP_440216.1_1 Forward -369 -355 -12.6851 0.296
NP_440172.1_1 Forward -274 -264 4.3066 0.194
NP_440172.1_1 Reverse -228 -238 1.94665 0.29
NP_442371.1_1 Reverse -223 -233 13.5492 0.206
NP_441226.1_7 Reverse -275 -282 5.34865 0.289
NP_442417.1_5 Reverse -275 -289 5.50613 0.258
NP_440416.1_9 Forward -217 -198 -17.1101 0.231
NP_443052.1_9 Reverse -163 -182 -0.0988766 0.204
NP_441974.1_3 Reverse -220 -237 15.1936 0.257
NP_440591.1_9 Reverse -104 -122 8.08229 0.187
NP_440261.1_5 Reverse -266 -279 4.8375 0.0516
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

ACCATGACCAACCCATTCAGCAAGTCATAGTGGAAATGACCGGCTGGGGAGTGGACCACTCCTTTGAATGCATCGGCAATGTGGAAGTAATGCGCTCCGCTCTGGAATGTGCCCACCGGGGTTGGGGGCAATCGGTAATCATTGGCGTAGCAGGGGCTGGCCAAGAAATTTCCACCAGACCATTCCAGCTTGTTACCGGCCGCAAATGGATGGGCACCGCTTTTGGCGGTGTGAAAGGTCGTTCCCAATTACCAGGTATGGTGGAACAATCCATGCGGGGGGAGATCCAACTAGCCCCCTTTGTTACCCACACCATGGAACTAAAGGATATCAACCAAGCCTTTGACCTCATGCATGACGGCAAATCGATTCGCAGTGTGATCCACTACTAATACAACCC

CDS

ATGGAACGATTAGAACACCACGCCAGCTTTGGGGGTTGGCAAAGCGTTTATAGCCATCACAGCGCTGTGCTTAATTGCACCATGAACGTTGGCGTTTACCTGCCTCCCCAGGCTACTAACCAACATTGCCCAGTTTTGTACTGGCTGTCTGGCCTCACCTGTACTGAACAAAATGCCATCACTAAATCGGGTCTACAGCAGCACGCAGCAAAGCATGGACTAATTATGGTGACGCCAGACACTAGCCCCCGGGGTGAAGGCGTAACTGATTCTGAAGATTATGACCTCGGTATGGGAGCCGGTTTCTATCTCAACGCCACCCAACCTCCCTGGGCAGCCCACTATCAAATGCATGATTACATTGTGCAAGAGCTGCCTACGTGGATTGAGGCTAATTTTGCCGCCACCGATGCCCGGAGTATTTTTGGCCATTCCATGGGGGGCCATGGGGCCCTAGTCATTGCCCTGCGTAATCCCGGTCGTTATCGCAGTGTTTCCACCTTCTCTCCCATTGTTGCCCCCACTCAAGTTCCCTGGGGACAAAAGGCCTTCCAAGCTTATTTAGGGGATAACCAGTTAAGCTGGCAAGCTTGGGATACCTGTGCTCTGATTAAATCGGCTCCAGAGCGGCTACCATTTTTCGTGGACTATGGCGACGCTGATCCATTCCTCCCTACCCAATTGCGGCCAGAGTTACTCCAAGCGGCCTGCACGGCGGCTAACCATCCCCTCACCCTCCGTATGCAACCGGGCTATGACCATAGCTATTACTTTATTGCTAGTTTCATCGGTGATCACATGGATTGGCATGGAGCGGCGCTGCTAAACTAG

Protein

MERLEHHASFGGWQSVYSHHSAVLNCTMNVGVYLPPQATNQHCPVLYWLSGLTCTEQNAITKSGLQQHAAKHGLIMVTPDTSPRGEGVTDSEDYDLGMGAGFYLNATQPPWAAHYQMHDYIVQELPTWIEANFAATDARSIFGHSMGGHGALVIALRNPGRYRSVSTFSPIVAPTQVPWGQKAFQAYLGDNQLSWQAWDTCALIKSAPERLPFFVDYGDADPFLPTQLRPELLQAACTAANHPLTLRMQPGYDHSYYFIASFIGDHMDWHGAALLN