Your browser is old and dusty. Try Google Chrome!

Details for sll0984

ORF sll0984
Accession NP_440495.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441418.1_6 Forward -360 -341 -10.6203 0.0375
NP_441418.1_6 Reverse -365 -384 -30.0898 0.256
NP_442220.1_4 Reverse -340 -359 15.2408 0.243
NP_442272.1_1 Forward -35 -17 14.8032 0.238
NP_441453.1_1 Reverse -344 -362 4.63995 0.258
NP_441453.1_4 Forward -360 -352 6.80426 0.121
NP_441623.1_1 Forward -380 -362 0.510803 0.224
NP_440226.1_1 Reverse -351 -370 5.30933 0.161
NP_441630.1_3 Reverse -208 -227 1.37609 0.248
NP_442623.1_3 Reverse -366 -385 -17.5035 0.263
NP_440348.1_8 Reverse -198 -217 11.8975 0.295
NP_442744.1_8 Reverse -329 -348 -3.63879 0.297
NP_443002.1_5 Forward -217 -199 12.998 0.212
NP_442173.1_1 Reverse -352 -360 5.72262 0.203
NP_442173.1_1 Forward -359 -351 4.54265 0.27
NP_442752.1_4 Forward -360 -353 13.8055 0.0199
NP_442752.1_4 Forward -111 -104 5.54565 0.194
NP_443027.1_4 Forward -362 -352 7.25653 0.24
NP_441812.1_3 Reverse -44 -58 11.111 0.215
NP_441812.1_3 Forward -361 -347 9.04604 0.245
NP_440784.1_7 Forward -359 -352 6.23397 0.241
NP_440784.1_7 Reverse -352 -359 6.13563 0.241
NP_440061.1_9 Reverse -349 -363 7.27547 0.213
NP_442062.1_3 Reverse -20 -39 -2.75381 0.272
NP_442062.1_8 Forward -360 -350 14.533 0.0128
NP_442062.1_8 Forward -111 -101 3.22496 0.279
NP_441900.1_2 Forward -27 -9 0.116744 0.258
NP_441859.1_3 Forward -361 -342 6.68515 0.171
NP_442242.1_4 Reverse -352 -359 10.8555 0.127
NP_439918.1_2 Reverse -197 -216 -0.0988766 0.227
NP_441619.1_8 Forward -317 -303 13.5686 0.114
NP_440132.1_1 Forward -362 -344 13.5888 0.165
NP_441083.1_5 Reverse -351 -361 1.65166 0.2
NP_441083.1_5 Forward -360 -350 0.0783647 0.245
NP_441083.1_5 Reverse -102 -112 -0.609952 0.272
NP_441738.1_2 Reverse -353 -360 15.28 0.0102
NP_441955.1_8 Reverse -173 -190 8.39697 0.259
NP_440209.1_1 Forward -360 -352 8.57422 0.0425
NP_440209.1_1 Reverse -351 -359 5.23096 0.145
NP_442889.1_8 Reverse -299 -313 3.44058 0.278
NP_441770.1_4 Reverse -315 -334 -10.522 0.272
NP_440178.1_7 Reverse -335 -354 -22.715 0.272
NP_441716.1_1 Reverse -351 -365 7.47274 0.169
NP_441598.1_3 Reverse -329 -348 11.9948 0.279
NP_442111.1_4 Forward -361 -347 7.47274 0.0949
NP_441163.1_1 Reverse -94 -111 14.0011 0.179
NP_441163.1_1 Reverse -184 -201 6.13464 0.267
NP_440906.1_5 Forward -359 -352 6.23397 0.234
NP_440906.1_5 Reverse -352 -359 6.13563 0.241
NP_441209.1_8 Forward -71 -53 13.8206 0.12
NP_440747.1_10 Forward -363 -351 7.11881 0.00789
NP_440747.1_10 Reverse -348 -360 -11.8591 0.161
NP_442634.1_4 Forward -362 -348 -2.36035 0.149
NP_441265.1_3 Reverse -345 -359 4.91614 0.181
NP_441265.1_3 Forward -366 -352 2.65453 0.189
NP_440842.1_6 Reverse -340 -359 11.995 0.253
NP_440842.1_10 Reverse -333 -347 4.91614 0.251
NP_441014.1_8 Forward -379 -360 -3.14714 0.242
NP_443018.1_3 Forward -359 -352 12.6255 0.0471
NP_443018.1_3 Reverse -180 -187 10.2655 0.107
NP_443018.1_3 Reverse -352 -359 5.25066 0.214
NP_440376.1_1 Forward -111 -102 5.3096 0.137
NP_440376.1_1 Reverse -365 -374 3.44131 0.203
NP_440376.1_1 Forward -360 -351 0.0980582 0.285
NP_440376.1_1 Reverse -351 -360 -0.196935 0.285
NP_442687.1_7 Reverse -190 -200 4.0116 0.271
NP_440066.1_5 Forward -381 -362 10.2251 0.251
NP_442485.1_3 Reverse -340 -359 1.76941 0.217
NP_441846.1_10 Reverse -366 -385 -21.24 0.256
NP_440642.1_10 Forward -30 -16 1.5723 0.29
NP_441013.1_2 Forward -193 -175 6.31233 0.208
NP_441013.1_3 Forward -376 -357 7.17762 0.268
NP_442658.1_1 Reverse -100 -110 5.19112 0.28
NP_441855.2_4 Reverse -343 -362 11.4512 0.213
NP_440656.1_2 Forward -41 -22 -0.885524 0.258
NP_440656.1_8 Reverse -340 -359 -7.08038 0.249
NP_441256.1_1 Reverse -348 -367 -7.4737 0.239
NP_439959.1_6 Reverse -180 -199 10.9142 0.192
NP_442937.1_5 Forward -116 -97 6.68596 0.272
NP_442321.1_4 Forward -209 -190 -8.94866 0.292
NP_441958.1_5 Reverse -350 -360 0.865012 0.12
NP_441958.1_5 Forward -361 -351 -6.31315 0.28
NP_440318.1_1 Forward -198 -179 7.47261 0.2
NP_441097.1_2 Reverse -256 -273 3.97208 0.291
NP_439990.1_5 Forward -365 -352 10.7374 0.128
NP_442690.1_1 Forward -161 -142 -17.3068 0.299
NP_442911.1_2 Reverse -341 -360 -8.35868 0.233
NP_442911.1_2 Reverse -92 -111 -10.227 0.273
NP_441580.1_6 Forward -217 -198 -1.47551 0.191
NP_441580.1_6 Forward -385 -366 -7.76869 0.246
NP_443055.1_6 Forward -352 -334 1.88669 0.224
NP_443055.1_6 Forward -374 -356 -2.34152 0.294
NP_440602.1_2 Forward -365 -346 2.85105 0.263
NP_443044.1_1 Forward -44 -25 11.0125 0.212
NP_441348.1_3 Forward -350 -331 6.68596 0.277
NP_441424.1_6 Reverse -357 -376 10.8459 0.296
NP_441292.1_2 Forward -371 -352 -11.9969 0.296
NP_441000.1_6 Reverse -350 -364 -3.04867 0.221
NP_440484.1_1 Reverse -343 -362 9.63507 0.244
NP_441550.1_8 Forward -362 -352 5.87944 0.224
NP_440703.1_9 Reverse -336 -349 22.7331 0.0323
NP_441725.1_5 Forward -359 -349 10.0098 0.0381
NP_439966.1_7 Forward -362 -352 5.58445 0.216
NP_439966.1_7 Reverse -349 -359 4.30615 0.279
NP_442941.1_3 Reverse -352 -362 9.41981 0.0319
NP_440983.1_5 Reverse -323 -342 -3.54046 0.239
NP_441678.1_9 Reverse -191 -210 1.37609 0.223
NP_442281.1_1 Reverse -63 -77 9.93039 0.0648
NP_442281.1_1 Reverse -346 -360 3.63724 0.224
NP_441334.1_7 Reverse -349 -368 -12.4886 0.157
NP_441334.1_7 Reverse -363 -382 -13.6686 0.223
NP_440177.1_9 Reverse -153 -172 11.3075 0.277
NP_442012.1_1 Forward -380 -361 1.27776 0.22
NP_442982.1_5 Reverse -71 -90 -2.75381 0.289
NP_441644.1_6 Forward -360 -350 3.61784 0.272
NP_443049.1_6 Forward -361 -351 13.8856 0.139
NP_442215.1_2 Reverse -327 -343 2.8118 0.108
NP_442215.1_2 Forward -197 -181 -4.1697 0.228
NP_442215.1_2 Forward -347 -331 -4.36636 0.232
NP_442215.1_2 Forward -79 -63 -6.7263 0.278
NP_442215.1_2 Reverse -326 -342 -6.82463 0.28
NP_440929.1_8 Reverse -351 -360 7.76787 0.0533
NP_440929.1_8 Forward -360 -351 7.66954 0.0624
NP_442933.1_10 Reverse -351 -360 6.48957 0.119
NP_441751.2_8 Reverse -352 -366 12.1926 0.0206
NP_442554.1_8 Reverse -352 -362 6.37155 0.12
NP_442554.1_8 Forward -359 -349 2.04498 0.285
NP_441762.1_7 Reverse -364 -376 -5.66422 0.228
NP_442142.1_4 Reverse -176 -189 6.11523 0.173
NP_442142.1_4 Reverse -371 -384 3.95196 0.239
NP_442292.1_1 Reverse -352 -361 8.65285 0.0335
NP_442292.1_1 Forward -359 -350 -0.786921 0.287
NP_443009.1_5 Forward -361 -350 4.97473 0.222
NP_441715.1_4 Reverse -352 -362 7.55152 0.108
NP_440015.1_9 Forward -178 -160 0.805796 0.248
NP_441448.1_2 Reverse -331 -350 1.86696 0.195
NP_442076.1_8 Forward -265 -246 7.37428 0.262
NP_441468.1_1 Forward -359 -352 6.13563 0.209
NP_441468.1_1 Reverse -352 -359 6.0373 0.223
NP_441020.2_6 Forward -362 -345 7.31533 0.235
NP_441673.1_1 Forward -360 -351 1.37636 0.114
NP_441673.1_1 Reverse -351 -360 1.1797 0.163
NP_441826.1_2 Reverse -375 -389 -1.08205 0.234
NP_441826.1_2 Reverse -336 -350 -4.81863 0.3
NP_442868.1_6 Forward -362 -352 9.51814 0.0447
NP_442808.1_1 Reverse -101 -111 13.3526 0.0481
NP_442050.1_5 Reverse -349 -359 11.1893 0.105
NP_440558.1_2 Reverse -342 -361 -0.295539 0.2
NP_441518.1_3 Reverse -341 -360 -8.45701 0.186
NP_441878.1_6 Forward -345 -335 1.455 0.0979
NP_441878.1_6 Reverse -350 -360 0.57002 0.14
NP_441878.1_6 Reverse -335 -345 -7.19813 0.21
NP_441557.1_5 Reverse -351 -360 7.57121 0.049
NP_441557.1_5 Forward -360 -351 1.08137 0.0794
NP_441433.1_8 Forward -343 -324 7.17762 0.174
NP_442419.1_2 Forward -193 -174 -5.01543 0.295
NP_442183.1_1 Forward -360 -346 12.9793 0.05
NP_442183.1_9 Reverse -11 -21 11.0914 0.229
NP_442347.1_2 Reverse -352 -361 12.2911 0.056
NP_442347.1_2 Reverse -174 -183 5.11294 0.238
NP_442347.1_2 Reverse -103 -112 2.94966 0.292
NP_441037.1_4 Forward -376 -366 8.77956 0.237
NP_442594.1_8 Reverse -360 -379 7.07928 0.215
NP_442594.1_8 Reverse -8 -27 1.96607 0.295
NP_441633.1_3 Forward -362 -349 -6.66722 0.265
NP_440136.1_2 Forward -359 -352 6.23397 0.171
NP_440136.1_2 Reverse -352 -359 6.13563 0.193
NP_442590.1_10 Forward -351 -332 15.7324 0.113
NP_442590.1_10 Reverse -173 -192 3.93269 0.283
NP_442998.1_5 Reverse -189 -199 11.0914 0.196
NP_442998.1_10 Reverse -353 -360 15.5754 0.0102
NP_440899.1_8 Forward -33 -14 -7.4737 0.246
NP_440299.1_1 Forward -364 -351 4.14862 0.217
NP_440256.1_1 Reverse -194 -213 -1.86883 0.109
NP_440915.1_6 Forward -364 -350 -2.45868 0.272
NP_440915.1_6 Forward -394 -380 -2.75368 0.28
NP_441261.1_1 Forward -382 -363 -4.32711 0.26
NP_441704.1_8 Forward -193 -174 9.93006 0.168
NP_441464.1_8 Forward -256 -242 7.47274 0.206
NP_440695.1_5 Reverse -320 -339 -2.36049 0.299
NP_442993.1_1 Forward -206 -190 -1.71142 0.0986
NP_441340.1_5 Forward -359 -352 6.23397 0.132
NP_441340.1_5 Reverse -352 -359 5.84064 0.208
NP_440586.1_8 Forward -359 -352 14.69 0.026
NP_440586.1_8 Reverse -180 -187 9.08521 0.178
NP_442251.1_6 Reverse -352 -359 12.0355 0.0627
NP_442959.1_7 Forward -381 -362 0.0977854 0.235
NP_441262.1_3 Forward -360 -353 14.7888 0.0223
NP_440027.1_3 Forward -390 -372 8.86816 0.188
NP_443051.1_1 Reverse -350 -359 6.19458 0.0849
NP_443051.1_1 Forward -361 -352 0.884706 0.125
NP_439937.1_8 Forward -337 -318 -5.11376 0.286
NP_441595.1_5 Reverse -358 -376 12.6055 0.17
NP_439943.1_4 Forward -352 -333 4.52268 0.287
NP_440372.1_2 Forward -359 -352 6.82395 0.0854
NP_440372.1_2 Reverse -352 -359 6.52896 0.188
NP_440819.1_5 Reverse -189 -197 7.68924 0.266
NP_441803.1_2 Forward -382 -363 -0.688862 0.284
NP_440267.1_2 Reverse -346 -360 13.2736 0.125
NP_442384.1_10 Reverse -351 -364 1.39592 0.26
NP_440364.1_2 Forward -199 -180 13.7395 0.297
NP_442262.1_10 Forward -359 -352 12.9205 0.0422
NP_442262.1_10 Reverse -180 -187 9.18389 0.211
NP_441814.1_5 Reverse -201 -220 13.6675 0.149
NP_440163.1_10 Reverse -332 -342 9.51814 0.232
NP_440163.1_10 Forward -185 -175 8.73149 0.262
NP_440344.1_10 Reverse -344 -361 -13.0392 0.273
NP_441965.1_10 Reverse -176 -192 2.32015 0.288
NP_442750.1_3 Reverse -24 -43 -12.2919 0.276
NP_440297.1_9 Forward -359 -349 9.61647 0.0917
NP_440179.1_6 Reverse -336 -355 9.73422 0.19
NP_439969.1_1 Forward -194 -175 1.27776 0.204
NP_441543.1_2 Reverse -352 -361 7.07956 0.131
NP_442845.1_2 Forward -212 -198 5.30946 0.237
NP_442845.1_2 Reverse -191 -205 4.81781 0.251
NP_441304.1_10 Reverse -24 -33 14.7494 0.164
NP_441319.1_8 Forward -366 -348 8.86894 0.227
NP_443064.1_6 Reverse -102 -112 8.6886 0.276
NP_443064.1_7 Forward -211 -192 16.3714 0.262
NP_442578.1_7 Forward -359 -352 14.6904 0.026
NP_442578.1_7 Forward -181 -174 9.97054 0.112
NP_441462.1_2 Forward -360 -350 1.94665 0.0807
NP_441621.1_7 Reverse -363 -377 -3.24533 0.188
NP_441621.1_7 Forward -385 -371 -4.81863 0.246
NP_441929.1_3 Forward -36 -17 4.916 0.266
NP_442204.1_1 Forward -364 -353 1.82863 0.266
NP_442204.1_6 Reverse -170 -189 8.25926 0.228
NP_441560.1_10 Reverse -343 -362 11.7992 0.166
NP_440516.1_6 Forward -344 -330 10.3237 0.226
NP_440516.1_8 Forward -360 -351 1.08137 0.129
NP_442428.1_5 Forward -359 -352 6.13563 0.209
NP_442428.1_5 Reverse -352 -359 6.0373 0.212
NP_440618.1_1 Reverse -185 -204 -6.49039 0.247
NP_442120.1_10 Reverse -302 -321 -13.8652 0.288
NP_442120.1_10 Reverse -185 -204 -14.7502 0.289
NP_440673.1_3 Reverse -353 -360 12.4288 0.0426
NP_441052.1_2 Reverse -351 -361 1.55333 0.238
NP_441052.1_2 Forward -105 -95 -0.609952 0.288
NP_442219.1_9 Reverse -352 -361 7.96454 0.0696
NP_440436.1_4 Reverse -352 -361 7.57079 0.124
NP_441719.1_4 Forward -359 -352 13.5105 0.026
NP_441719.1_4 Reverse -352 -359 6.52896 0.188
NP_441004.1_1 Reverse -362 -381 -6.1954 0.183
NP_441004.1_1 Reverse -185 -204 -7.4737 0.198
NP_441004.1_1 Reverse -323 -342 -13.4719 0.257
NP_441004.1_2 Reverse -180 -199 -3.24547 0.274
NP_443054.1_2 Reverse -334 -348 -0.590395 0.299
NP_441966.1_7 Forward -135 -116 0.883656 0.224
NP_441851.1_10 Forward -361 -351 11.6814 0.0659
NP_441851.1_10 Reverse -350 -360 6.07655 0.187
NP_441851.1_10 Reverse -380 -390 5.87989 0.196
NP_442208.1_5 Reverse -366 -385 0.196116 0.248
NP_442814.1_2 Forward -366 -347 9.73422 0.209
NP_441545.1_1 Reverse -318 -337 5.211 0.187
NP_440347.1_9 Reverse -186 -205 19.5673 0.105
NP_442011.1_1 Forward -391 -372 -0.4922 0.268
NP_442515.1_1 Forward -361 -347 1.08123 0.172
NP_441982.1_6 Reverse -188 -197 12.4854 0.275
NP_441409.1_6 Forward -131 -112 -9.14533 0.18
NP_440432.1_9 Reverse -103 -118 -3.95334 0.194
NP_442450.1_5 Reverse -349 -359 8.4365 0.13
NP_440588.1_2 Reverse -326 -345 -5.21209 0.243
NP_441003.1_9 Reverse -326 -345 13.8641 0.213
NP_441003.1_9 Forward -347 -328 11.0125 0.213
NP_442243.1_1 Forward -344 -326 4.04996 0.2
NP_441570.1_1 Forward -360 -342 -1.65248 0.0583
NP_441570.1_1 Reverse -173 -191 -9.51896 0.139
NP_441570.1_1 Reverse -351 -369 -17.3854 0.273
NP_441078.1_4 Forward -360 -351 0.196389 0.205
NP_441078.1_4 Reverse -351 -360 -0.000272808 0.205
NP_441078.1_4 Reverse -102 -111 -2.06522 0.295
NP_440539.1_9 Reverse -181 -200 -3.24547 0.286
NP_440707.1_9 Reverse -123 -142 7.7676 0.219
NP_442443.1_1 Reverse -123 -142 -4.22878 0.268
NP_441432.1_8 Forward -361 -352 7.27622 0.101
NP_441432.1_8 Reverse -202 -211 3.24465 0.252
NP_441732.1_2 Forward -393 -377 -17.4444 0.258
NP_440760.1_1 Reverse -247 -266 -16.7168 0.184
NP_442797.1_6 Forward -204 -185 10.1642 0.24
NP_442797.1_7 Forward -367 -349 0.412472 0.274
NP_441945.1_10 Reverse -196 -215 7.57094 0.284
NP_441057.1_4 Forward -361 -343 4.34571 0.231
NP_442353.1_4 Reverse -330 -349 4.32522 0.205
NP_440913.1_1 Forward -362 -344 7.98396 0.195
NP_440713.1_4 Forward -192 -173 11.7992 0.113
NP_442489.1_7 Reverse -351 -360 7.47288 0.0613
NP_442489.1_7 Forward -360 -351 0.688044 0.152
NP_440386.1_1 Forward -117 -98 -9.047 0.28
NP_440559.1_1 Forward -359 -350 13.3727 0.0401
NP_440559.1_1 Reverse -352 -361 7.76787 0.0918
NP_441659.2_8 Forward -360 -350 6.46988 0.0744
NP_442346.1_5 Forward -361 -351 6.27322 0.208
NP_440545.1_3 Reverse -199 -216 -3.10775 0.199
NP_440545.1_3 Forward -364 -347 -4.38605 0.224
NP_440545.1_5 Reverse -367 -384 7.512 0.21
NP_440831.1_1 Reverse -191 -210 13.3725 0.261
NP_442934.1_8 Reverse -279 -298 8.84924 0.266
NP_440010.1_10 Forward -363 -344 1.47442 0.299
NP_442603.1_7 Reverse -173 -187 7.07881 0.216
NP_441948.1_4 Reverse -344 -362 -4.60241 0.235
NP_441833.1_4 Reverse -352 -359 6.52896 0.0924
NP_441833.1_4 Forward -359 -352 6.23397 0.163
NP_442699.1_8 Forward -340 -321 -12.4886 0.253
NP_442162.1_8 Reverse -359 -378 4.03102 0.187
NP_442162.1_9 Forward -359 -352 6.62729 0.142
NP_442162.1_9 Reverse -352 -359 6.52896 0.178
NP_441973.1_1 Forward -31 -16 -0.118434 0.269
NP_440204.1_1 Reverse -198 -217 3.34271 0.278
NP_442723.1_1 Forward -394 -375 1.96529 0.292
NP_440875.1_9 Reverse -353 -363 8.37203 0.233
NP_441813.1_5 Forward -362 -352 8.4365 0.0432
NP_441813.1_5 Reverse -349 -359 5.68323 0.113
NP_440590.1_4 Reverse -352 -365 -4.7006 0.265
NP_442497.1_10 Forward -359 -350 8.25953 0.047
NP_442497.1_10 Reverse -352 -361 0.589713 0.153
NP_440821.1_4 Reverse -349 -359 9.41981 0.0286
NP_440821.1_4 Forward -362 -352 -0.314959 0.251
NP_441239.1_9 Forward -346 -334 3.08724 0.296
NP_441951.1_4 Reverse -365 -384 0.884433 0.293
NP_441951.1_9 Forward -384 -365 -1.08219 0.283
NP_441892.1_1 Forward -369 -352 -5.07437 0.273
NP_441017.1_6 Reverse -332 -346 10.8154 0.298
NP_442772.1_6 Reverse -261 -280 20.9955 0.101
NP_442216.1_4 Forward -23 -15 8.08217 0.255
NP_440412.1_2 Reverse -1 -20 6.39097 0.281
NP_440462.1_6 Forward -362 -352 6.37155 0.118
NP_442340.1_3 Reverse -181 -200 -10.817 0.293
NP_440868.1_4 Forward -364 -352 5.54551 0.0954
NP_440401.1_9 Reverse -223 -230 14.5917 0.287
NP_440341.1_7 Reverse -248 -262 11.111 0.269
NP_442402.1_10 Reverse -35 -45 10.206 0.299
NP_442039.1_4 Reverse -303 -310 6.13563 0.297
NP_442891.1_5 Reverse -138 -148 15.8718 0.293
NP_441053.1_1 Forward -109 -90 7.47261 0.1
NP_442837.1_3 Reverse -352 -359 12.1338 0.0702
NP_442837.1_3 Forward -359 -352 6.0373 0.25
NP_442053.1_1 Reverse -351 -360 6.78456 0.115
NP_440505.1_3 Forward -362 -352 9.51814 0.122
NP_440505.1_3 Forward -113 -103 5.09324 0.246
NP_440351.1_1 Reverse -249 -268 14.0608 0.0114
NP_441701.1_3 Reverse -10 -27 12.2319 0.207
NP_440520.1_6 Reverse -339 -358 8.35759 0.137
NP_441252.1_6 Forward -259 -252 14.3954 0.168
NP_440914.1_1 Reverse -102 -112 12.3236 0.0614
NP_441011.1_8 Forward -373 -364 8.35786 0.144
NP_442533.1_1 Reverse -8 -27 -12.7836 0.236
NP_442533.1_1 Reverse -364 -383 -16.1268 0.263
NP_442533.1_6 Forward -344 -335 4.22796 0.186
NP_442533.1_6 Reverse -336 -345 2.06468 0.275
NP_442533.1_6 Forward -338 -329 1.57302 0.294
NP_441482.1_7 Reverse -345 -359 -11.4068 0.262
NP_441482.1_7 Forward -206 -192 -11.8985 0.286
NP_439944.1_9 Forward -359 -349 5.78156 0.221
NP_441028.1_6 Forward -197 -187 16.5975 0.137
NP_441028.1_6 Reverse -174 -184 5.78111 0.243
NP_440116.1_5 Forward -363 -346 5.64371 0.176
NP_440115.1_6 Forward -363 -353 16.008 0.0325
NP_440115.1_6 Forward -393 -383 14.0414 0.0615
NP_441815.1_6 Forward -199 -180 0.981987 0.254
NP_439903.1_6 Forward -354 -335 -0.886293 0.287
NP_001035870.1_3 Forward -371 -352 -5.21209 0.278
NP_441286.1_1 Forward -361 -349 5.34885 0.0259
NP_442674.1_2 Reverse -252 -271 8.94757 0.236
NP_440670.1_8 Forward -360 -351 7.47288 0.0773
NP_440670.1_8 Reverse -351 -360 5.89959 0.131
NP_442463.1_1 Reverse -366 -385 18.584 0.157
NP_441930.1_1 Forward -348 -329 7.96426 0.235
NP_440886.1_7 Forward -384 -374 5.68278 0.168
NP_440083.1_1 Reverse -257 -276 10.8159 0.0634
NP_442717.1_4 Reverse -234 -253 6.58763 0.186
NP_442717.1_4 Reverse -120 -139 1.37609 0.296
NP_440223.1_7 Reverse -186 -200 16.5192 0.218
NP_440907.2_8 Forward -359 -349 4.69947 0.25
NP_442264.1_2 Reverse -169 -186 6.82368 0.25
NP_441626.1_2 Forward -359 -352 6.13563 0.177
NP_441626.1_2 Reverse -352 -359 5.93897 0.231
NP_442221.1_4 Reverse -364 -383 11.9958 0.272
NP_441174.1_4 Reverse -187 -197 10.2065 0.288
NP_440114.1_10 Reverse -226 -240 6.48943 0.269
NP_441510.2_7 Reverse -329 -343 12.9786 0.28
NP_440293.1_3 Reverse -195 -214 -6.1954 0.287
NP_439988.1_7 Reverse -70 -84 12.2903 0.292
NP_440457.1_1 Forward -364 -352 9.87208 0.092
NP_440213.1_5 Reverse -192 -211 9.14423 0.275
NP_440798.1_6 Forward -389 -376 1.29759 0.224
NP_441801.1_4 Forward -22 -12 3.12662 0.231
NP_442509.1_9 Reverse -102 -112 6.96107 0.244
NP_442439.1_8 Reverse -178 -197 8.55425 0.253
NP_442862.1_3 Reverse -248 -265 4.26707 0.29
NP_441885.1_5 Reverse -351 -361 1.25834 0.11
NP_441885.1_5 Reverse -102 -112 -0.511621 0.202
NP_441173.1_9 Forward -196 -188 13.1954 0.184
NP_440423.1_6 Reverse -343 -362 -15.6352 0.229
NP_443000.1_7 Forward -362 -352 10.2065 0.0355
NP_440275.1_3 Forward -362 -352 5.5849 0.14
NP_441122.1_1 Forward -81 -66 2.73316 0.298
NP_439962.1_4 Forward -385 -366 -5.9004 0.28
NP_440149.1_8 Reverse -173 -192 -3.54046 0.192
NP_440216.1_1 Reverse -351 -365 -10.7185 0.146
NP_442015.1_10 Reverse -347 -360 2.67422 0.187
NP_442015.1_10 Forward -216 -203 -0.472371 0.268
NP_441757.1_3 Forward -361 -342 3.24438 0.155
NP_441111.1_7 Reverse -352 -360 8.86921 0.0589
NP_441766.1_2 Reverse -351 -360 6.48957 0.096
NP_440416.1_9 Forward -367 -348 -17.9951 0.25
NP_440416.1_9 Forward -381 -362 -18.0934 0.251
NP_440416.1_9 Reverse -344 -363 -21.83 0.297
NP_443052.1_8 Reverse -341 -360 -2.0655 0.0864
NP_443052.1_9 Forward -141 -122 3.6377 0.162
NP_443052.1_9 Forward -27 -8 -2.45882 0.238
NP_442116.1_2 Forward -186 -167 11.11 0.289
NP_442154.1_1 Reverse -366 -384 -13.4522 0.217
NP_442154.1_1 Reverse -132 -150 -17.9754 0.273
NP_440261.1_5 Reverse -352 -365 -4.9956 0.183
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TTAGTTACGTAGCAATCCGCCCCCGCGGCTAACCCTGCCTGGCGATCGAACTGTTGGCCCTTGGCCGTGAGCAAAATCACCGTGGTATTAGCTAGCTCAGGATTTTCTTTAATACGTTGACAAACTGCTAAACCACTAATCTTGGGCAACATCACATCTAAAATAACCAATTGGGGTTGATGTTCCACTGCTAAAGCCAAGGCTTTTTCCCCATCCATGGCGGTCAATAACTCCACCCCGTAATCTTCTTCTAAAAGCTCAAACACCTCTTCCAGCAGAATTACAATGTGGGGTTCGTCGTCAACAATTAGGATTTTCAGTTCGGACATTGGTAAGGTTGTAATAAATTGAGCACCGCTGAAAAGTTAATTTCCCCTTAACTCCCCCAGCATAAAGCATC

CDS

ATGCACCATGTTTCTATTCGTACTGCTAATATCCATCGGGCGATCGCCTTTTATGAGCTATTGGGTTTTACCGTGGGGGAAAGGTTCACCACTGGTTATACCTTAGCTTGCTGGTTGACTGGTCTGGGGGGACGCATTGAATTAATTCAAATTCCCCAACCCCAACCCGCCCCTGATGCCTTCAAAGATGAACATTACGTGGGCTACTATCATATCTCCTTTGATCTAACAGACCAGGTAGAAAGTTTACCGGAATGGTTGAATAATCTCAGCCAAAGTTTTAGCCAAGCCTATCAAACCAATCCAGAACAAATTGAGCCGTTAAAAATTCTTTTAAATCCCCAGCAACAACAAATTGGTGATCATATTTATGAAGTTTTATTCATTGCCGATAGTGATAACCTCCCTTTGGAATTTATTCGTTGTCAGAGTGCTCCCAACAAATAG

Protein

MHHVSIRTANIHRAIAFYELLGFTVGERFTTGYTLACWLTGLGGRIELIQIPQPQPAPDAFKDEHYVGYYHISFDLTDQVESLPEWLNNLSQSFSQAYQTNPEQIEPLKILLNPQQQQIGDHIYEVLFIADSDNLPLEFIRCQSAPNK