Your browser is old and dusty. Try Google Chrome!

Details for sll0983

ORF sll0983
Accession NP_440497.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -88 -102 -0.885388 0.242
NP_440795.1_7 Forward -101 -94 8.8889 0.188
NP_441418.1_6 Forward -193 -174 -28.2215 0.203
NP_440897.1_6 Forward -369 -350 -0.984623 0.187
NP_441453.1_4 Reverse -93 -101 11.6225 0.0403
NP_441453.1_4 Reverse -360 -368 6.80426 0.121
NP_441623.1_1 Reverse -336 -354 -1.75081 0.241
NP_441623.1_1 Reverse -316 -334 -2.73412 0.247
NP_442151.1_6 Reverse -379 -393 6.58777 0.228
NP_442151.1_6 Forward -388 -374 6.19444 0.244
NP_441818.1_9 Forward -195 -176 -10.9153 0.299
NP_440226.1_1 Reverse -360 -379 10.6192 0.061
NP_440226.1_1 Reverse -3 -22 3.83436 0.212
NP_441630.1_3 Reverse -352 -371 4.42435 0.164
NP_442173.1_1 Forward -368 -360 5.72262 0.203
NP_442752.1_4 Reverse -360 -367 13.8055 0.0199
NP_443027.1_4 Reverse -358 -368 9.41981 0.163
NP_443027.1_4 Forward -377 -367 6.37155 0.283
NP_443027.1_4 Reverse -154 -164 5.87989 0.294
NP_441745.1_5 Forward -209 -190 6.4893 0.27
NP_442975.1_10 Forward -373 -359 2.75226 0.269
NP_440784.1_7 Reverse -361 -368 6.23397 0.241
NP_440784.1_7 Forward -368 -361 6.13563 0.241
NP_441054.1_2 Reverse -156 -175 9.73422 0.284
NP_442062.1_8 Reverse -93 -103 3.71661 0.256
NP_441802.1_1 Reverse -262 -281 15.5357 0.174
NP_440304.1_4 Forward -354 -344 5.09324 0.229
NP_440304.1_4 Reverse -341 -351 3.51995 0.296
NP_442242.1_4 Forward -368 -361 10.8555 0.127
NP_441200.1_4 Reverse -260 -279 13.3725 0.156
NP_441208.1_9 Reverse -340 -354 5.50613 0.267
NP_442726.1_7 Reverse -63 -81 -0.669169 0.262
NP_441083.1_5 Forward -369 -359 0.668351 0.22
NP_442827.1_8 Forward -377 -358 -0.492971 0.228
NP_441149.1_7 Reverse -333 -352 1.76941 0.271
NP_441738.1_2 Forward -367 -360 15.28 0.0102
NP_440209.1_1 Forward -369 -361 11.9175 0.0184
NP_440209.1_1 Reverse -360 -368 8.57422 0.0425
NP_440447.1_1 Reverse -88 -106 2.77242 0.278
NP_441770.1_4 Reverse -202 -221 -9.83364 0.262
NP_441770.1_5 Forward -360 -341 4.62101 0.213
NP_440178.1_7 Reverse -359 -378 -22.5183 0.267
NP_441327.1_1 Forward -131 -112 6.90443 0.245
NP_442111.1_3 Reverse -286 -299 16.9638 0.144
NP_442111.1_4 Forward -370 -356 8.84938 0.0677
NP_442111.1_4 Reverse -359 -373 2.94952 0.259
NP_441387.1_8 Forward -125 -106 16.9494 0.18
NP_440906.1_5 Reverse -361 -368 6.23397 0.234
NP_440906.1_5 Forward -368 -361 6.13563 0.241
NP_440747.1_10 Reverse -357 -369 -12.1541 0.227
NP_440747.1_10 Forward -158 -146 -12.4491 0.282
NP_441130.1_8 Forward -75 -56 15.8307 0.128
NP_442973.1_5 Forward -111 -92 14.1591 0.15
NP_442973.1_7 Forward -186 -167 16.3224 0.209
NP_442634.1_4 Reverse -358 -372 -0.983719 0.149
NP_441265.1_1 Forward -374 -355 -0.983855 0.0488
NP_441014.1_10 Forward -166 -147 14.0599 0.0847
NP_442848.1_1 Forward -375 -361 2.75286 0.159
NP_442848.1_5 Reverse -86 -104 8.47561 0.232
NP_442848.1_9 Forward -96 -77 9.43923 0.182
NP_443018.1_3 Reverse -361 -368 12.6255 0.0471
NP_443018.1_3 Forward -44 -37 7.6106 0.156
NP_443018.1_3 Forward -368 -361 5.25066 0.214
NP_443018.1_3 Reverse -94 -101 4.56234 0.241
NP_443018.1_3 Forward -101 -94 4.46401 0.244
NP_443018.1_3 Forward -387 -380 4.26735 0.267
NP_443018.1_3 Reverse -380 -387 4.16902 0.278
NP_441634.1_9 Forward -101 -82 8.16011 0.294
NP_440376.1_1 Reverse -360 -369 0.0980582 0.285
NP_440376.1_1 Forward -332 -323 -0.000272808 0.285
NP_440376.1_1 Forward -369 -360 -0.196935 0.285
NP_442798.2_1 Reverse -54 -73 10.6192 0.24
NP_441588.1_4 Forward -304 -294 6.46988 0.193
NP_442687.1_7 Forward -219 -209 4.50326 0.245
NP_442687.1_7 Reverse -69 -79 4.3066 0.255
NP_442687.1_7 Reverse -145 -155 4.0116 0.271
NP_442485.1_3 Reverse -173 -192 6.19431 0.165
NP_442946.1_4 Reverse -114 -132 14.2771 0.273
NP_441846.1_10 Forward -196 -177 -20.5517 0.256
NP_440533.1_9 Reverse -178 -197 4.42435 0.225
NP_441855.2_4 Reverse -314 -333 11.2584 0.221
NP_440662.1_2 Reverse -39 -58 1.57275 0.201
NP_442782.1_2 Forward -102 -88 7.07942 0.211
NP_442782.1_2 Reverse -360 -374 1.47456 0.281
NP_442205.1_9 Forward -375 -359 4.97508 0.143
NP_442544.1_2 Reverse -193 -207 -1.08205 0.271
NP_441414.1_9 Forward -369 -350 5.30933 0.048
NP_441414.1_9 Reverse -36 -55 -7.76869 0.225
NP_441414.1_9 Reverse -280 -299 -9.73531 0.266
NP_442937.1_5 Reverse -338 -357 6.58763 0.275
NP_442321.1_4 Reverse -313 -332 -2.26216 0.27
NP_441958.1_5 Reverse -359 -369 2.63497 0.0388
NP_441958.1_5 Forward -370 -360 1.55333 0.095
NP_441127.1_1 Forward -187 -173 8.16106 0.3
NP_441127.1_1 Reverse -137 -151 7.57108 0.3
NP_442911.1_2 Forward -379 -360 -2.95047 0.105
NP_440858.1_1 Reverse -277 -296 -4.03212 0.27
NP_443055.1_6 Reverse -74 -92 -2.24319 0.291
NP_440993.1_2 Forward -357 -341 3.10679 0.262
NP_440993.1_4 Reverse -88 -105 5.25038 0.263
NP_440138.1_1 Reverse -93 -111 6.99988 0.231
NP_442002.1_9 Reverse -226 -233 12.8221 0.185
NP_440484.1_3 Reverse -91 -105 10.816 0.242
NP_441550.1_8 Reverse -358 -368 6.56775 0.201
NP_441916.1_7 Forward -369 -359 7.45319 0.0656
NP_441916.1_7 Forward -79 -69 3.91327 0.198
NP_442004.1_6 Reverse -205 -219 2.65453 0.26
NP_441725.1_5 Reverse -361 -371 -0.511621 0.26
NP_439966.1_7 Forward -371 -361 13.2542 0.0297
NP_439966.1_7 Reverse -358 -368 4.60114 0.265
NP_439966.1_9 Reverse -198 -207 4.12963 0.253
NP_442941.1_3 Forward -368 -358 9.41981 0.0319
NP_442941.1_3 Reverse -361 -371 0.766681 0.171
NP_440260.1_8 Reverse -307 -325 -4.60241 0.273
NP_441514.1_6 Forward -334 -327 12.8221 0.252
NP_442281.1_1 Reverse -88 -102 1.76896 0.29
NP_441334.1_7 Forward -371 -352 -12.6852 0.166
NP_440177.1_9 Forward -396 -377 15.4374 0.19
NP_442500.1_9 Reverse -132 -151 15.0441 0.215
NP_440498.1_1 Forward -378 -360 2.77242 0.172
NP_440375.1_8 Forward -368 -349 6.39097 0.168
NP_440375.1_8 Reverse -350 -369 5.01433 0.193
NP_441644.1_6 Forward -45 -35 8.73102 0.0944
NP_441644.1_6 Reverse -379 -389 7.84605 0.115
NP_441644.1_6 Forward -369 -359 7.45273 0.124
NP_441644.1_6 Reverse -360 -370 5.68278 0.18
NP_443049.1_6 Reverse -359 -369 14.3735 0.114
NP_442501.1_2 Forward -73 -54 -4.22878 0.278
NP_442029.1_6 Reverse -259 -278 4.22769 0.271
NP_442029.1_8 Reverse -71 -90 10.4225 0.252
NP_442029.1_10 Forward -153 -134 14.4541 0.145
NP_442029.1_10 Forward -273 -254 10.3242 0.204
NP_440469.1_10 Reverse -97 -116 20.5498 0.104
NP_442933.1_10 Forward -369 -360 6.48957 0.119
NP_441751.2_8 Forward -368 -354 -4.4253 0.173
NP_442554.1_8 Forward -368 -358 7.45319 0.092
NP_442142.1_4 Forward -48 -35 4.54195 0.217
NP_442292.1_1 Forward -368 -359 7.66954 0.0634
NP_442292.1_1 Reverse -380 -389 5.50626 0.143
NP_441264.1_3 Forward -374 -355 -2.75381 0.293
NP_442381.1_10 Forward -230 -218 20.2946 0.177
NP_441715.1_4 Forward -368 -358 6.96153 0.121
NP_440730.1_4 Forward -332 -313 -5.21209 0.298
NP_440379.1_5 Forward -196 -177 5.60432 0.133
NP_441468.1_1 Reverse -361 -368 6.13563 0.209
NP_441468.1_1 Forward -368 -361 6.0373 0.223
NP_441468.1_1 Forward -387 -380 4.26735 0.246
NP_441468.1_1 Forward -101 -94 3.97235 0.277
NP_441015.1_10 Forward -197 -178 -10.1286 0.283
NP_441015.1_10 Forward -192 -173 -10.522 0.284
NP_441673.1_1 Reverse -360 -369 1.37636 0.114
NP_441673.1_1 Forward -369 -360 1.1797 0.163
NP_441876.1_9 Forward -232 -222 15.4175 0.267
NP_442490.1_9 Forward -102 -83 -5.01543 0.273
NP_442868.1_6 Reverse -358 -368 0.668351 0.213
NP_443058.1_7 Forward -46 -27 9.73422 0.206
NP_443058.1_7 Forward -205 -186 5.99764 0.233
NP_442427.1_3 Forward -357 -339 0.412472 0.26
NP_441911.1_10 Reverse -146 -165 7.69133 0.274
NP_442808.1_1 Forward -370 -360 7.84605 0.0668
NP_441101.1_4 Forward -168 -149 10.0292 0.191
NP_440145.1_3 Reverse -83 -102 -2.95047 0.184
NP_440145.1_3 Reverse -26 -45 -5.70374 0.275
NP_442820.1_3 Forward -286 -276 12.2709 0.293
NP_442542.1_2 Reverse -34 -47 7.49244 0.179
NP_442542.1_2 Reverse -321 -334 5.52582 0.262
NP_442050.1_5 Forward -371 -361 13.0576 0.0461
NP_440558.1_2 Reverse -340 -359 -2.45882 0.227
NP_440558.1_2 Reverse -84 -103 -2.45882 0.227
NP_440558.1_2 Reverse -61 -80 -7.67036 0.298
NP_441878.1_6 Forward -332 -322 -6.60814 0.193
NP_441557.1_5 Reverse -360 -369 1.08137 0.0794
NP_441557.1_5 Forward -369 -360 0.589713 0.134
NP_441557.1_8 Reverse -247 -257 12.4676 0.236
NP_441445.1_1 Reverse -27 -46 2.16274 0.24
NP_441590.1_4 Reverse -89 -108 2.26028 0.296
NP_442066.2_9 Reverse -356 -369 7.00078 0.253
NP_441433.1_8 Forward -29 -10 -3.93378 0.285
NP_440101.1_3 Forward -198 -179 0.786102 0.292
NP_440101.1_3 Forward -107 -88 0.392778 0.299
NP_441458.1_10 Reverse -370 -389 7.57094 0.195
NP_441458.1_10 Reverse -84 -103 6.98095 0.196
NP_441458.1_10 Reverse -175 -194 3.93269 0.239
NP_441564.1_10 Reverse -59 -78 8.94757 0.161
NP_442183.1_1 Reverse -360 -374 4.12949 0.277
NP_442347.1_2 Forward -50 -41 8.06287 0.116
NP_442347.1_2 Forward -368 -359 3.14632 0.286
NP_442645.1_2 Forward -377 -358 -15.1435 0.19
NP_442645.1_2 Reverse -85 -104 -22.8133 0.296
NP_441037.1_4 Forward -195 -185 11.3134 0.156
NP_441037.1_4 Forward -104 -94 8.09735 0.237
NP_442317.1_6 Reverse -317 -336 9.43923 0.211
NP_442317.1_6 Forward -357 -338 4.42435 0.247
NP_440136.1_2 Reverse -361 -368 6.23397 0.171
NP_440136.1_2 Forward -368 -361 6.13563 0.193
NP_442590.1_10 Forward -262 -243 7.7676 0.219
NP_442998.1_10 Forward -367 -360 15.5754 0.0102
NP_440899.1_8 Forward -245 -226 -6.09707 0.231
NP_440299.1_1 Forward -245 -232 2.28034 0.292
NP_441799.1_1 Forward -373 -359 4.32555 0.255
NP_441449.1_8 Forward -138 -119 16.2121 0.21
NP_440256.1_1 Forward -372 -353 -4.6221 0.161
NP_440256.1_1 Reverse -357 -376 -8.94866 0.27
NP_440256.1_1 Forward -86 -67 -9.93197 0.291
NP_440456.1_7 Forward -221 -207 9.93102 0.294
NP_441559.1_8 Forward -160 -146 -5.50694 0.264
NP_441559.1_8 Forward -357 -343 -7.67023 0.297
NP_440915.1_6 Reverse -356 -370 6.29277 0.0828
NP_441296.1_9 Reverse -324 -337 9.45847 0.277
NP_440748.1_5 Reverse -325 -344 5.211 0.195
NP_441464.1_1 Reverse -187 -206 8.94757 0.246
NP_440026.1_8 Reverse -141 -159 9.36059 0.271
NP_441939.1_3 Reverse -311 -330 6.88262 0.22
NP_442993.1_1 Forward -283 -267 -13.3145 0.291
NP_442386.1_9 Reverse -378 -387 4.91586 0.276
NP_441340.1_5 Reverse -94 -101 11.0522 0.0749
NP_441340.1_5 Reverse -361 -368 6.23397 0.132
NP_441340.1_5 Forward -368 -361 5.84064 0.208
NP_441340.1_5 Reverse -380 -387 4.07068 0.239
NP_440327.1_6 Reverse -25 -44 2.75272 0.29
NP_442240.1_2 Forward -101 -82 -19.6667 0.295
NP_442714.1_5 Forward -387 -368 1.96607 0.238
NP_440586.1_8 Reverse -361 -368 14.69 0.026
NP_442251.1_6 Forward -368 -361 12.0355 0.0627
NP_441262.1_3 Reverse -360 -367 14.7888 0.0223
NP_443051.1_1 Reverse -359 -368 10.0295 0.0139
NP_443051.1_1 Forward -370 -361 0.29472 0.195
NP_439937.1_8 Forward -192 -173 -4.52377 0.286
NP_439937.1_9 Forward -147 -130 -12.8431 0.276
NP_440439.1_1 Forward -372 -359 -1.16069 0.255
NP_442239.1_8 Reverse -64 -83 7.96426 0.255
NP_440372.1_2 Reverse -361 -368 6.82395 0.0854
NP_440372.1_2 Forward -368 -361 6.52896 0.188
NP_440316.1_10 Reverse -35 -45 7.84651 0.245
NP_440316.1_10 Forward -188 -178 5.38824 0.299
NP_439977.1_5 Reverse -81 -100 0.196116 0.212
NP_440267.1_2 Forward -215 -201 11.1104 0.125
NP_441980.1_4 Reverse -350 -369 3.53937 0.278
NP_441018.1_7 Forward -106 -87 11.2092 0.19
NP_442262.1_2 Reverse -322 -341 14.5672 0.284
NP_442262.1_10 Reverse -361 -368 12.9205 0.0422
NP_442262.1_10 Forward -44 -37 8.8889 0.219
NP_442262.1_10 Reverse -56 -63 8.49558 0.226
NP_442262.1_10 Reverse -94 -101 7.90559 0.266
NP_441689.1_5 Forward -371 -361 8.23937 0.142
NP_440163.1_10 Forward -82 -72 13.648 0.118
NP_441640.1_8 Forward -44 -25 -5.21209 0.278
NP_440297.1_9 Forward -78 -68 -0.118297 0.282
NP_442187.1_3 Reverse -359 -369 15.123 0.12
NP_442280.1_1 Forward -369 -350 8.65258 0.162
NP_442280.1_10 Forward -106 -88 7.69463 0.268
NP_441896.1_5 Forward -97 -90 12.2322 0.273
NP_441565.1_3 Reverse -7 -26 17.2065 0.0815
NP_440999.1_9 Forward -74 -60 2.16287 0.154
NP_440999.1_9 Reverse -174 -188 -1.96703 0.254
NP_440888.1_2 Reverse -178 -192 11.1104 0.0757
NP_440888.1_2 Forward -45 -31 8.55376 0.156
NP_440888.1_2 Forward -369 -355 6.29216 0.241
NP_440600.1_4 Reverse -352 -370 -8.24065 0.3
NP_441268.1_6 Forward -296 -278 14.5721 0.285
NP_440575.1_1 Reverse -166 -185 -1.67294 0.29
NP_441759.1_2 Forward -377 -358 2.16274 0.186
NP_441543.1_2 Forward -368 -359 6.09625 0.153
NP_441543.1_2 Reverse -361 -370 4.52295 0.234
NP_441304.1_10 Forward -335 -326 15.1427 0.164
NP_441918.1_7 Forward -290 -271 -0.590531 0.297
NP_441469.1_8 Forward -103 -94 6.19458 0.231
NP_442578.1_7 Reverse -361 -368 14.6904 0.026
NP_440710.1_1 Reverse -352 -370 -6.27403 0.224
NP_441462.1_2 Reverse -360 -370 8.63316 0.0339
NP_441462.1_2 Forward -369 -359 0.57002 0.144
NP_443062.1_1 Forward -369 -351 17.6141 0.0251
NP_440519.1_6 Forward -50 -36 12.3893 0.29
NP_440519.1_8 Reverse -274 -290 5.95839 0.21
NP_442204.1_1 Forward -266 -255 8.81013 0.0852
NP_442204.1_1 Reverse -356 -367 1.92696 0.266
NP_440516.1_2 Forward -108 -90 3.55906 0.147
NP_440516.1_8 Reverse -360 -369 10.5211 0.00816
NP_440516.1_8 Reverse -36 -45 -0.491928 0.262
NP_442428.1_5 Reverse -361 -368 6.13563 0.209
NP_442428.1_5 Forward -368 -361 6.0373 0.212
NP_442428.1_5 Forward -387 -380 4.66067 0.244
NP_442428.1_5 Forward -101 -94 4.36568 0.271
NP_442859.1_2 Reverse -361 -380 5.11266 0.212
NP_442120.1_10 Reverse -337 -356 -1.27885 0.168
NP_440673.1_2 Reverse -60 -79 10.4871 0.207
NP_440673.1_3 Forward -367 -360 12.4288 0.0426
NP_440673.1_3 Forward -43 -36 8.98723 0.203
NP_441052.1_2 Forward -369 -359 1.16001 0.25
NP_440992.1_2 Reverse -88 -107 9.0459 0.273
NP_442864.1_3 Forward -209 -190 6.68596 0.298
NP_442907.1_9 Forward -374 -355 5.30933 0.171
NP_441719.1_4 Reverse -361 -368 13.5105 0.026
NP_441719.1_4 Forward -368 -361 6.52896 0.188
NP_441004.1_1 Forward -199 -180 -11.8986 0.243
NP_441004.1_1 Reverse -140 -159 -15.7335 0.277
NP_441004.1_1 Forward -337 -318 -16.6185 0.286
NP_441004.1_2 Forward -228 -209 -4.42544 0.291
NP_441004.1_3 Forward -259 -240 4.71934 0.224
NP_442366.1_3 Reverse -69 -87 -4.70074 0.275
NP_439949.1_7 Forward -302 -288 14.5526 0.225
NP_442854.1_6 Reverse -360 -379 0.58944 0.292
NP_441851.1_10 Forward -103 -93 4.3066 0.277
NP_442208.1_5 Reverse -131 -150 1.37609 0.248
NP_441668.1_4 Reverse -45 -64 14.9458 0.0528
NP_440593.1_3 Reverse -374 -393 -0.000545616 0.198
NP_441982.1_6 Reverse -285 -294 15.2546 0.274
NP_441046.1_2 Forward -56 -37 0.294447 0.271
NP_441409.1_10 Forward -372 -359 20.0782 0.251
NP_440432.1_9 Forward -368 -353 -4.15 0.198
NP_442843.1_1 Reverse -210 -229 -12.0953 0.298
NP_439960.1_10 Forward -269 -251 1.98577 0.189
NP_442450.1_5 Forward -371 -361 7.64985 0.13
NP_442006.1_2 Forward -193 -176 2.98877 0.0877
NP_442006.1_2 Reverse -192 -209 -16.8741 0.265
NP_442006.1_2 Forward -388 -371 -18.644 0.294
NP_442006.1_2 Forward -382 -365 -18.939 0.296
NP_442243.1_1 Forward -364 -346 3.16499 0.204
NP_442243.1_1 Forward -313 -295 -0.6699 0.256
NP_441570.1_1 Reverse -360 -378 -6.66736 0.0813
NP_441570.1_1 Forward -369 -351 -17.6804 0.287
NP_441078.1_4 Reverse -360 -369 0.196389 0.205
NP_441078.1_4 Forward -369 -360 -0.000272808 0.205
NP_442348.1_2 Forward -332 -323 10.6195 0.259
NP_442443.1_1 Forward -360 -341 -6.29373 0.294
NP_441432.1_8 Reverse -35 -44 12.2911 0.0444
NP_441432.1_8 Reverse -359 -368 7.27622 0.101
NP_442344.1_7 Reverse -380 -399 -7.96535 0.198
NP_441732.1_2 Forward -356 -340 3.69678 0.0141
NP_440313.1_1 Forward -147 -128 14.3558 0.294
NP_440497.1_7 Forward -395 -376 27.3355 0.00277
NP_440913.1_1 Reverse -358 -376 9.45892 0.178
NP_442489.1_7 Forward -369 -360 7.47288 0.0613
NP_442489.1_7 Reverse -360 -369 0.688044 0.152
NP_442489.1_7 Forward -352 -343 -1.86856 0.259
NP_442489.1_7 Reverse -343 -352 -1.96689 0.28
NP_440941.1_7 Reverse -122 -136 19.2055 0.107
NP_441659.2_8 Reverse -360 -370 1.84832 0.224
NP_441659.2_8 Forward -369 -359 1.74999 0.227
NP_442008.1_2 Forward -372 -353 8.84924 0.194
NP_440545.1_3 Reverse -168 -185 -2.22277 0.181
NP_440545.1_3 Reverse -339 -356 -3.20608 0.201
NP_440025.1_3 Reverse -319 -333 13.2247 0.247
NP_440459.1_2 Reverse -192 -209 9.97027 0.212
NP_440459.1_2 Forward -334 -317 8.7903 0.249
NP_440847.1_4 Reverse -67 -86 16.7157 0.285
NP_441888.1_9 Reverse -93 -112 13.6774 0.3
NP_440449.1_6 Reverse -315 -333 7.86678 0.208
NP_441833.1_4 Forward -368 -361 6.52896 0.0924
NP_441833.1_4 Reverse -361 -368 6.23397 0.163
NP_441329.1_6 Reverse -147 -166 0.811258 0.245
NP_441112.1_7 Reverse -45 -64 9.43923 0.27
NP_442162.1_9 Reverse -361 -368 6.62729 0.142
NP_442162.1_9 Forward -368 -361 6.52896 0.178
NP_442140.1_3 Reverse -94 -104 9.81313 0.0992
NP_442140.1_3 Forward -387 -377 3.51995 0.294
NP_442723.1_1 Reverse -167 -186 18.2882 0.107
NP_440875.1_9 Forward -367 -357 7.69067 0.255
NP_441813.1_5 Reverse -358 -368 8.4365 0.0432
NP_441813.1_5 Forward -371 -361 6.27322 0.0971
NP_440594.1_8 Forward -368 -355 8.86849 0.21
NP_440567.1_1 Forward -368 -354 5.30946 0.104
NP_440567.1_1 Reverse -361 -375 2.65453 0.167
NP_440567.1_1 Reverse -173 -187 1.67122 0.196
NP_442497.1_10 Forward -368 -359 7.76787 0.0731
NP_442497.1_10 Reverse -361 -370 -1.18024 0.256
NP_441239.1_9 Reverse -53 -65 2.98891 0.3
NP_441892.1_2 Reverse -60 -79 -1.96717 0.191
NP_440833.1_6 Reverse -321 -335 12.2903 0.198
NP_442216.1_4 Reverse -325 -333 8.08217 0.255
NP_440354.1_5 Reverse -340 -359 6.88262 0.174
NP_442052.1_7 Forward -197 -183 14.6509 0.204
NP_440546.1_4 Forward -64 -54 10.5308 0.109
NP_440546.1_4 Reverse -360 -370 6.65249 0.288
NP_440462.1_6 Reverse -358 -368 15.5163 0.0142
NP_440462.1_6 Forward -371 -361 6.27322 0.121
NP_441184.1_5 Reverse -134 -153 11.3075 0.146
NP_440868.1_4 Forward -373 -361 15.4769 0.0164
NP_442499.1_3 Forward -97 -79 9.75391 0.252
NP_442499.1_3 Reverse -177 -195 3.85406 0.289
NP_440374.1_1 Forward -308 -289 13.6675 0.214
NP_440905.1_1 Forward -281 -263 3.85406 0.229
NP_442402.1_4 Forward -161 -142 -0.00131823 0.186
NP_442402.1_6 Forward -222 -213 13.4711 0.284
NP_440696.1_3 Forward -106 -88 1.49411 0.217
NP_440696.1_3 Forward -197 -179 -1.65248 0.264
NP_440696.1_6 Forward -267 -248 3.53937 0.288
NP_442039.1_7 Forward -143 -133 11.9764 0.257
NP_442380.1_5 Reverse -119 -138 16.0348 0.279
NP_442409.1_10 Reverse -174 -188 15.8302 0.287
NP_442837.1_3 Forward -368 -361 12.1338 0.0702
NP_442837.1_3 Reverse -361 -368 6.0373 0.25
NP_442837.1_4 Forward -380 -361 10.5209 0.233
NP_442053.1_1 Forward -369 -360 14.1594 0.0136
NP_442053.1_1 Reverse -360 -369 7.86621 0.0863
NP_440505.1_3 Reverse -358 -368 8.33817 0.145
NP_440505.1_3 Reverse -34 -44 4.3066 0.3
NP_440505.1_7 Reverse -123 -142 3.83436 0.207
NP_441701.1_3 Forward -202 -185 8.59364 0.247
NP_441252.1_6 Reverse -143 -150 11.9372 0.25
NP_441252.1_6 Forward -221 -214 11.6422 0.288
NP_442471.1_10 Forward -88 -69 16.1257 0.0858
NP_441408.2_7 Reverse -85 -104 -4.52377 0.281
NP_441408.2_7 Reverse -144 -163 -5.11376 0.291
NP_440914.1_1 Reverse -36 -46 9.00547 0.186
NP_440914.1_1 Forward -12 -2 8.12715 0.207
NP_441699.1_4 Forward -334 -315 16.6174 0.246
NP_441011.1_8 Forward -101 -92 11.6028 0.0754
NP_441011.1_8 Forward -368 -359 6.78456 0.184
NP_441011.1_8 Forward -192 -183 5.50626 0.256
NP_441011.1_8 Reverse -361 -370 5.40793 0.263
NP_442533.1_6 Reverse -70 -79 3.44131 0.212
NP_442541.1_10 Reverse -322 -336 4.52221 0.252
NP_440263.1_9 Forward -324 -305 8.25926 0.269
NP_442232.1_3 Forward -201 -182 -15.2418 0.289
NP_441482.1_7 Reverse -87 -101 -3.44199 0.124
NP_441482.1_7 Forward -375 -361 -11.2101 0.245
NP_441028.1_6 Forward -152 -142 7.74772 0.218
NP_441028.1_6 Reverse -347 -357 5.48612 0.255
NP_441028.1_6 Forward -50 -40 5.48612 0.255
NP_441028.1_6 Forward -272 -262 3.8145 0.281
NP_440116.1_8 Reverse -247 -266 -9.53865 0.281
NP_441527.1_4 Reverse -231 -250 -11.6982 0.284
NP_440115.1_6 Reverse -33 -43 7.15819 0.158
NP_440115.1_6 Reverse -357 -367 4.79825 0.282
NP_441106.1_1 Reverse -359 -368 8.75118 0.0469
NP_441815.1_6 Reverse -167 -186 -0.29631 0.291
NP_441286.1_1 Reverse -359 -371 -5.46756 0.203
NP_440670.1_8 Forward -12 -3 3.44131 0.267
NP_441930.1_2 Forward -332 -322 14.9263 0.19
NP_440886.1_7 Reverse -177 -187 6.96107 0.112
NP_442382.1_9 Forward -159 -140 10.7167 0.281
NP_442072.1_9 Reverse -359 -377 -23.0886 0.277
NP_441403.1_4 Forward -152 -134 14.2771 0.282
NP_440028.1_6 Reverse -258 -276 10.5406 0.277
NP_441021.1_1 Reverse -173 -192 -7.76869 0.189
NP_441463.1_3 Forward -398 -379 -7.96535 0.262
NP_441463.1_6 Forward -354 -340 8.54187 0.25
NP_441626.1_2 Reverse -361 -368 6.13563 0.177
NP_441626.1_2 Forward -368 -361 5.93897 0.231
NP_441589.1_5 Forward -103 -84 17.1451 0.262
NP_442794.1_1 Reverse -333 -345 5.54551 0.216
NP_441962.1_4 Reverse -62 -81 -9.83364 0.222
NP_441962.1_4 Forward -78 -59 -12.5869 0.26
NP_440387.1_1 Reverse -360 -376 10.9733 0.0191
NP_440855.1_3 Reverse -317 -336 6.68515 0.267
NP_440855.1_5 Forward -98 -79 2.26028 0.295
NP_441431.1_2 Reverse -90 -104 10.2254 0.166
NP_440634.1_8 Reverse -178 -197 2.85027 0.285
NP_441174.1_4 Reverse -40 -50 10.4031 0.288
NP_440114.1_10 Reverse -360 -374 6.98109 0.25
NP_442698.1_10 Forward -188 -169 10.6192 0.233
NP_439988.1_3 Forward -101 -87 6.88276 0.278
NP_439988.1_7 Forward -367 -353 12.6836 0.292
NP_442867.1_8 Reverse -56 -75 5.11266 0.277
NP_442867.1_8 Forward -232 -213 4.81767 0.277
NP_440457.1_1 Reverse -356 -368 8.6921 0.101
NP_441981.1_3 Reverse -145 -159 16.6453 0.268
NP_441801.1_4 Forward -271 -261 2.53664 0.292
NP_442680.1_5 Reverse -225 -244 4.85906 0.227
NP_440801.1_10 Reverse -57 -76 4.52268 0.291
NP_440942.1_6 Forward -148 -129 4.52188 0.289
NP_442509.1_9 Forward -318 -308 7.64939 0.21
NP_442936.1_10 Forward -175 -161 9.64668 0.268
NP_440554.1_4 Forward -368 -358 8.33817 0.0773
NP_440554.1_4 Reverse -4 -14 2.14332 0.276
NP_442862.1_3 Forward -107 -90 4.3654 0.29
NP_440478.1_9 Forward -94 -75 12.3892 0.255
NP_440478.1_10 Forward -104 -90 12.0943 0.169
NP_442341.1_9 Reverse -358 -372 8.16044 0.178
NP_441173.1_9 Reverse -213 -221 12.507 0.206
NP_441173.1_9 Reverse -11 -19 12.1137 0.21
NP_442534.1_1 Reverse -149 -168 8.35759 0.251
NP_440423.1_6 Forward -381 -362 -21.24 0.284
NP_443000.1_7 Reverse -358 -368 10.5998 0.0345
NP_441842.1_10 Reverse -353 -367 9.04604 0.2
NP_440275.1_3 Reverse -358 -368 6.56821 0.101
NP_440679.1_10 Reverse -57 -76 -21.83 0.3
NP_441122.1_1 Forward -122 -107 8.04304 0.28
NP_439962.1_4 Reverse -176 -195 -9.047 0.298
NP_439962.1_4 Forward -154 -135 -9.047 0.298
NP_440804.1_4 Reverse -289 -298 15.1427 0.267
NP_440149.1_10 Reverse -343 -362 -9.53865 0.263
NP_441105.1_3 Forward -363 -344 -3.24547 0.175
NP_442373.1_2 Reverse -67 -86 -2.26216 0.198
NP_440216.1_1 Forward -369 -355 6.58777 0.0145
NP_440216.1_1 Reverse -360 -374 -11.8985 0.228
NP_440172.1_1 Reverse -343 -353 9.41981 0.0586
NP_440172.1_1 Reverse -360 -370 8.82982 0.0586
NP_441045.1_2 Reverse -277 -296 14.2574 0.168
NP_441226.1_7 Reverse -380 -387 11.5435 0.0757
NP_441111.1_7 Forward -368 -360 8.86921 0.0589
NP_441766.1_2 Forward -369 -360 8.55452 0.054
NP_442564.1_10 Reverse -137 -151 11.7993 0.244
NP_440988.1_10 Forward -47 -33 17.6781 0.099
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CATCATCGATTTTGCGACGGCGAAAAGGGAACTCGATCGCCTGACGGAGGAAATTGCCACCTTGAAAGGGGAATTGGCCCAGGATAAACCGGGAACGGAGGGCTAATTTTTGACCAGTGCGGCCCCTTTTACTCCCCAGTTGACGGCGGATGGTTCTTTTACGTTCTATTCGCCCCAATTTGGGGAAACGTTCCATTCCCAGCGGGGTGCTAAGGCGGAGGCGGACGAAAAGTTTGTTCATCCCTGTCTTTTGCCCCAGTTGGCGGCCAAAAAATCCAGGTTAACTATTATTGATGTCTGCTATGGCTTGGGCTACAACACAGCGGCGGCCCTAACAGCCATCTGGCAAATTAATCCCCATTGCCACGTAACTCTGTACAGTTTGGAAAACGATCTGCAA

CDS

GTGCCCCGCCAGGCGATCGCCAATGGCTTGCTCCAGGGTTGGCCGGATTTGGTGCAGGAGATTTTGCAGGATCTAGCTCAAAGAGAAATGGTTGCCAGGGAATTTTTAACTGCCCATCTGGCGATCGGGGATGCCCGGCAAACATTACTATCCGTTGTGCCCCGAGATATTAAGGTCGATGCTATTTTCCTCGATCCCTTCTCACCGCCCAAATGTCCCCAACTGTGGACAGTGGAATTTCTCTGTCATTTAGGCGATCGTCTAGCCCCAACAGGCCGTTTAGCCACCTATTGCAGTGCGGCGGCGGTGCGTCATGGTTTACAACTGGCCGGACTGTCCATTGCCACCATGGGAGACGGTCAACCGCCCCATCCCCGTCGTCGGCCCCTGGGTACCCTGGCTAGCCACCAGCCATCACCCCCATCAATATTTGCCCCCTGGGAAATGGAACATCTGCAAACTAAGGCGGCCATCCCCTACCGTGATCCTTCAGGAACAGATCCAGCGGAAGTAATTCTGGCCCGTCGTCGAGCGGAACAGAGCAAAAGTACATTGGAGCCCACCAGCCGCTGGAAAAAACGTTGGCTCGACCAGGAGATTAACCATACCCCTAACTCTGAATCTTTCTAA

Protein

MPRQAIANGLLQGWPDLVQEILQDLAQREMVAREFLTAHLAIGDARQTLLSVVPRDIKVDAIFLDPFSPPKCPQLWTVEFLCHLGDRLAPTGRLATYCSAAAVRHGLQLAGLSIATMGDGQPPHPRRRPLGTLASHQPSPPSIFAPWEMEHLQTKAAIPYRDPSGTDPAEVILARRRAEQSKSTLEPTSRWKKRWLDQEINHTPNSESF