Your browser is old and dusty. Try Google Chrome!

Details for sll0944

ORF sll0944
Accession NP_441948.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_442711.1_1 Reverse -10 -24 11.8976 0.23
NP_441061.1_2 Reverse -137 -151 8.35772 0.0913
NP_440557.1_1 Reverse -143 -162 -0.4922 0.27
NP_440795.1_7 Forward -249 -242 13.6088 0.0364
NP_441418.1_6 Forward -158 -139 -20.1584 0.106
NP_441418.1_6 Reverse -241 -260 -22.0267 0.166
NP_441418.1_6 Reverse -380 -399 -29.4998 0.228
NP_440897.1_6 Forward -227 -208 -2.8529 0.225
NP_441453.1_1 Reverse -177 -195 2.96833 0.281
NP_441453.1_4 Reverse -149 -157 7.19758 0.0757
NP_441453.1_4 Forward -250 -242 7.09925 0.0962
NP_441453.1_4 Reverse -241 -249 7.00092 0.107
NP_441453.1_4 Forward -158 -150 6.80426 0.121
NP_442151.1_6 Forward -124 -110 6.88276 0.217
NP_442182.1_3 Forward -116 -97 2.55606 0.264
NP_441818.1_1 Forward -400 -389 9.00628 0.267
NP_441818.1_9 Forward -145 -126 0.982764 0.191
NP_440226.1_1 Reverse -149 -168 7.7676 0.1
NP_440226.1_1 Forward -250 -231 6.09597 0.137
NP_442169.1_1 Reverse -370 -389 -1.96717 0.271
NP_440150.1_6 Forward -253 -234 5.01433 0.231
NP_442655.1_1 Forward -163 -144 2.26107 0.238
NP_442173.1_1 Forward -249 -241 12.3108 0.0316
NP_442173.1_1 Forward -157 -149 7.68924 0.142
NP_442173.1_1 Reverse -242 -250 5.91928 0.2
NP_442173.1_1 Reverse -150 -158 5.72262 0.203
NP_442173.1_1 Forward -68 -60 5.13263 0.226
NP_442752.1_4 Forward -158 -151 13.8055 0.0199
NP_442752.1_4 Reverse -241 -248 4.46401 0.269
NP_442752.1_4 Forward -250 -243 4.36568 0.273
NP_443027.1_4 Forward -160 -150 12.3697 0.079
NP_441812.1_9 Forward -169 -155 16.3225 0.291
NP_440784.1_7 Reverse -242 -249 6.62729 0.168
NP_440784.1_7 Forward -249 -242 6.52896 0.176
NP_440784.1_7 Forward -157 -150 6.23397 0.241
NP_440784.1_7 Reverse -150 -157 6.13563 0.241
NP_442861.1_1 Forward -199 -180 14.7491 0.26
NP_440061.1_6 Reverse -63 -81 11.8181 0.268
NP_440061.1_9 Reverse -239 -253 8.65209 0.167
NP_440878.1_9 Reverse -231 -250 5.211 0.174
NP_442062.1_8 Forward -158 -148 14.9263 0.0108
NP_442062.1_8 Forward -250 -240 10.1081 0.0508
NP_442062.1_8 Reverse -241 -251 8.1415 0.0801
NP_442062.1_8 Forward -69 -59 3.51995 0.267
NP_441859.1_3 Forward -159 -140 4.12856 0.228
NP_440304.1_4 Forward -160 -150 10.2065 0.051
NP_442242.1_4 Reverse -150 -157 10.8555 0.127
NP_440044.1_8 Forward -400 -381 -2.45882 0.264
NP_441781.1_7 Reverse -96 -115 0.982764 0.239
NP_439918.1_3 Reverse -377 -396 3.53937 0.266
NP_441208.1_9 Forward -253 -239 6.78443 0.229
NP_441594.1_6 Forward -114 -95 5.99764 0.198
NP_442196.1_10 Forward -160 -141 9.93088 0.278
NP_442110.1_7 Reverse -149 -163 2.5562 0.222
NP_441925.1_4 Forward -395 -376 -15.7342 0.273
NP_441925.1_4 Forward -399 -380 -15.9309 0.275
NP_441083.1_5 Reverse -241 -251 9.81313 0.0224
NP_441083.1_5 Forward -124 -114 3.02829 0.182
NP_441083.1_5 Forward -250 -240 1.94665 0.197
NP_441083.1_5 Forward -158 -148 -0.0199663 0.251
NP_442827.1_8 Reverse -141 -160 -2.36125 0.274
NP_441434.1_1 Reverse -71 -85 7.07802 0.288
NP_441738.1_2 Reverse -151 -158 15.28 0.0102
NP_441558.1_5 Forward -160 -141 8.55425 0.147
NP_441558.1_5 Reverse -140 -159 4.03102 0.293
NP_440209.1_1 Forward -250 -242 8.67255 0.0333
NP_440209.1_1 Reverse -241 -249 8.57422 0.0425
NP_440209.1_1 Forward -158 -150 8.57422 0.0425
NP_440209.1_1 Reverse -149 -157 5.32929 0.139
NP_442136.1_1 Reverse -64 -83 14.4541 0.114
NP_442136.1_4 Forward -152 -133 5.50519 0.295
NP_442889.1_8 Forward -161 -147 5.50552 0.226
NP_442889.1_8 Reverse -238 -252 3.63724 0.273
NP_441713.1_1 Reverse -235 -254 -14.0619 0.257
NP_441770.1_4 Reverse -332 -351 -7.67036 0.234
NP_440178.1_7 Reverse -148 -167 4.03102 0.0199
NP_440178.1_7 Reverse -3 -22 -15.5368 0.162
NP_442570.1_3 Reverse -337 -356 -3.24547 0.217
NP_441716.1_1 Forward -227 -213 5.70279 0.22
NP_441624.1_7 Reverse -123 -137 9.93102 0.217
NP_440906.1_5 Forward -249 -242 6.43063 0.223
NP_440906.1_5 Reverse -242 -249 6.3323 0.234
NP_440906.1_5 Forward -157 -150 6.23397 0.234
NP_440906.1_5 Reverse -150 -157 6.13563 0.241
NP_440438.2_8 Forward -83 -64 24.4839 0.00624
NP_440747.1_10 Forward -253 -241 5.84051 0.0121
NP_440747.1_10 Reverse -238 -250 -2.32097 0.0331
NP_441486.1_1 Forward -161 -147 6.09611 0.0344
NP_441486.1_1 Reverse -238 -252 -3.83532 0.183
NP_441194.1_1 Reverse -63 -82 12.2703 0.238
NP_441265.1_3 Forward -256 -242 4.81781 0.181
NP_442760.1_7 Forward -129 -110 14.6508 0.127
NP_440403.1_10 Forward -126 -107 2.26107 0.279
NP_441014.1_8 Reverse -129 -148 -8.26035 0.283
NP_441014.1_8 Reverse -123 -142 -8.94866 0.288
NP_441012.1_4 Reverse -138 -151 10.2457 0.263
NP_443018.1_3 Forward -157 -150 12.6255 0.0471
NP_443018.1_3 Forward -249 -242 5.44732 0.193
NP_443018.1_3 Reverse -242 -249 5.34899 0.212
NP_443018.1_3 Reverse -150 -157 5.25066 0.214
NP_441634.1_8 Reverse -42 -56 11.701 0.0553
NP_440376.1_1 Reverse -241 -250 17.2076 0.00278
NP_440376.1_1 Forward -250 -241 10.3245 0.0293
NP_440376.1_1 Forward -145 -136 0.884706 0.259
NP_440376.1_1 Forward -158 -149 -0.000272808 0.285
NP_440376.1_1 Reverse -149 -158 -0.0986038 0.285
NP_441857.1_5 Reverse -142 -160 7.39397 0.189
NP_441588.1_4 Reverse -151 -161 6.66654 0.185
NP_442687.1_1 Forward -347 -334 14.08 0.247
NP_442687.1_7 Reverse -240 -250 13.5497 0.0466
NP_442687.1_7 Forward -251 -241 9.12481 0.0994
NP_442687.1_7 Reverse -59 -69 6.56821 0.159
NP_441846.1_10 Reverse -375 -394 -22.3217 0.259
NP_441013.1_3 Reverse -380 -399 7.27595 0.268
NP_441388.1_3 Forward -22 -3 7.4718 0.245
NP_440887.1_5 Forward -47 -28 21.1903 0.0519
NP_442658.1_1 Reverse -239 -249 7.64939 0.213
NP_442658.1_1 Forward -252 -242 5.58445 0.262
NP_442198.1_7 Reverse -238 -257 9.34008 0.273
NP_441855.2_4 Forward -219 -200 9.23384 0.286
NP_440662.1_2 Forward -277 -258 -2.85214 0.276
NP_442782.1_7 Forward -166 -147 -0.000545616 0.255
NP_441414.1_9 Forward -250 -231 -6.88371 0.206
NP_440184.1_1 Forward -82 -63 5.07734 0.22
NP_441256.1_1 Forward -53 -34 -5.80207 0.236
NP_441256.1_8 Reverse -375 -394 2.16274 0.285
NP_439959.1_4 Reverse -376 -395 16.6174 0.283
NP_441317.1_4 Reverse -333 -347 11.5648 0.249
NP_441958.1_5 Forward -251 -241 11.0914 0.00794
NP_441958.1_5 Forward -159 -149 10.5014 0.0119
NP_441958.1_5 Reverse -240 -250 2.7333 0.0378
NP_441958.1_5 Reverse -148 -158 0.963343 0.12
NP_440203.1_5 Reverse -139 -149 14.0409 0.103
NP_439905.1_1 Forward -249 -236 8.47575 0.234
NP_443001.1_7 Forward -157 -138 26.6471 0.00622
NP_440984.1_7 Reverse -236 -250 9.5377 0.127
NP_442690.1_1 Reverse -67 -86 -10.522 0.215
NP_442911.1_2 Forward -260 -241 5.11266 0.0351
NP_442911.1_2 Reverse -231 -250 -6.1954 0.178
NP_441580.1_6 Reverse -138 -157 -8.35868 0.258
NP_440153.1_5 Reverse -150 -164 1.47456 0.253
NP_440153.1_8 Forward -59 -46 -2.83231 0.266
NP_442064.1_1 Reverse -159 -178 -12.9802 0.283
NP_443055.1_6 Reverse -115 -133 1.78836 0.224
NP_443055.1_6 Forward -69 -51 -1.06322 0.271
NP_440602.1_8 Reverse -149 -163 16.4209 0.115
NP_442210.1_9 Reverse -6 -24 9.55725 0.259
NP_442002.1_9 Reverse -59 -66 9.97054 0.246
NP_441294.1_7 Reverse -132 -146 11.7463 0.129
NP_442438.1_10 Forward -255 -241 2.06454 0.188
NP_441000.1_5 Reverse -178 -197 15.9282 0.114
NP_441000.1_6 Forward -251 -237 -2.65535 0.22
NP_442771.1_1 Forward -400 -382 -10.0106 0.239
NP_440147.1_4 Forward -252 -239 10.1474 0.0355
NP_440147.1_4 Reverse -239 -252 0.805932 0.244
NP_440147.1_4 Reverse -147 -160 0.707601 0.247
NP_441175.1_7 Reverse -241 -260 8.84924 0.197
NP_441550.1_8 Forward -252 -242 8.3377 0.124
NP_441916.1_7 Reverse -149 -159 16.4013 0.00539
NP_441916.1_7 Reverse -241 -251 15.418 0.00933
NP_441916.1_7 Forward -250 -240 9.02648 0.0398
NP_441916.1_7 Forward -158 -148 5.09324 0.146
NP_441916.1_10 Forward -26 -7 5.30933 0.213
NP_441041.1_4 Reverse -4 -23 -6.88371 0.176
NP_441041.1_7 Forward -253 -241 15.7749 0.0222
NP_441041.1_7 Reverse -146 -158 10.7216 0.0888
NP_441725.1_5 Reverse -242 -252 2.24165 0.115
NP_441725.1_5 Reverse -150 -160 1.35667 0.137
NP_439966.1_7 Reverse -239 -249 8.53436 0.135
NP_439966.1_7 Forward -160 -150 5.09279 0.243
NP_442941.1_3 Reverse -150 -160 10.1081 0.024
NP_442941.1_3 Forward -249 -239 1.35667 0.15
NP_440289.1_2 Reverse -238 -251 4.44418 0.0668
NP_440289.1_2 Forward -161 -148 -2.83231 0.262
NP_441076.1_3 Reverse -329 -348 12.3883 0.185
NP_442281.1_1 Reverse -144 -158 12.0937 0.0409
NP_442281.1_1 Forward -163 -149 9.14375 0.0736
NP_442281.1_1 Forward -255 -241 3.63724 0.224
NP_442281.1_1 Reverse -55 -69 3.44058 0.231
NP_442256.1_2 Forward -126 -108 -9.12563 0.249
NP_440437.1_1 Reverse -143 -162 2.94938 0.127
NP_442049.1_6 Reverse -185 -204 3.14605 0.281
NP_440498.1_1 Forward -167 -149 -3.52077 0.265
NP_442982.1_5 Reverse -132 -151 -1.47551 0.266
NP_441644.1_6 Reverse -149 -159 7.74772 0.117
NP_441644.1_6 Forward -250 -240 7.45273 0.124
NP_441644.1_6 Reverse -241 -251 6.17443 0.165
NP_441644.1_6 Reverse -136 -146 3.22451 0.293
NP_443049.1_6 Forward -146 -136 11.7385 0.24
NP_442501.1_2 Reverse -269 -288 6.4893 0.157
NP_442215.1_2 Reverse -239 -255 13.0382 0.0255
NP_442215.1_2 Reverse -215 -231 -4.56302 0.235
NP_442215.1_2 Reverse -8 -24 -6.7263 0.278
NP_442177.1_5 Reverse -377 -391 8.84938 0.267
NP_440253.1_2 Forward -250 -232 -0.7675 0.223
NP_440929.1_8 Forward -250 -241 10.2261 0.0218
NP_440929.1_8 Reverse -241 -250 9.93116 0.0249
NP_442933.1_10 Reverse -149 -158 15.1427 0.00958
NP_442933.1_10 Forward -250 -241 8.45619 0.0741
NP_442933.1_10 Reverse -241 -250 8.06287 0.0885
NP_442933.1_10 Forward -158 -149 7.96454 0.0937
NP_442933.1_10 Reverse -60 -69 4.22796 0.267
NP_440382.1_2 Forward -348 -329 15.3382 0.114
NP_441751.2_8 Reverse -137 -151 -3.93365 0.157
NP_441751.2_8 Reverse -150 -164 -5.50694 0.214
NP_442554.1_8 Reverse -150 -160 7.15819 0.0975
NP_442554.1_8 Forward -249 -239 4.69992 0.176
NP_442554.1_8 Reverse -242 -252 4.69992 0.176
NP_442075.1_10 Reverse -381 -400 14.8474 0.282
NP_441762.1_7 Forward -251 -239 2.10393 0.0692
NP_441762.1_7 Reverse -240 -252 -0.0593532 0.0758
NP_441762.1_7 Forward -155 -143 -4.58258 0.179
NP_441762.1_7 Reverse -148 -160 -6.45087 0.284
NP_442142.1_4 Forward -16 -3 7.88518 0.127
NP_442142.1_4 Forward -253 -240 5.0336 0.204
NP_442142.1_4 Reverse -139 -152 4.83694 0.209
NP_442292.1_1 Reverse -150 -159 7.66954 0.0634
NP_442292.1_1 Forward -249 -240 0.196389 0.234
NP_442292.1_1 Reverse -242 -251 -0.000272808 0.239
NP_440511.1_1 Reverse -376 -394 7.98396 0.228
NP_442476.1_6 Forward -249 -235 4.32615 0.144
NP_443009.1_5 Forward -251 -240 11.1696 0.066
NP_443009.1_5 Forward -159 -148 6.25303 0.169
NP_443009.1_5 Forward -70 -59 3.69644 0.282
NP_442301.1_2 Forward -218 -199 3.73524 0.288
NP_441715.1_4 Forward -249 -239 9.41981 0.097
NP_441715.1_4 Reverse -150 -160 4.40493 0.281
NP_440881.1_5 Reverse -88 -107 15.0441 0.299
NP_440881.1_10 Reverse -61 -74 10.7374 0.274
NP_440730.1_4 Reverse -340 -359 -5.31042 0.298
NP_440183.1_9 Forward -225 -206 -15.0452 0.273
NP_440464.1_10 Forward -29 -19 12.2442 0.242
NP_441468.1_1 Forward -249 -242 6.52896 0.135
NP_441468.1_1 Reverse -242 -249 6.3323 0.202
NP_441468.1_1 Forward -157 -150 6.13563 0.209
NP_441468.1_1 Reverse -150 -157 6.0373 0.223
NP_441015.1_8 Forward -308 -289 17.699 0.105
NP_441015.1_10 Reverse -371 -390 -4.13045 0.199
NP_441015.1_10 Reverse -5 -24 -9.34199 0.282
NP_441673.1_1 Forward -250 -241 11.4061 0.00254
NP_441673.1_1 Reverse -241 -250 11.3078 0.00437
NP_441673.1_1 Forward -158 -149 1.27803 0.155
NP_441673.1_1 Reverse -149 -158 1.27803 0.155
NP_441826.1_2 Reverse -143 -157 -3.63866 0.286
NP_441826.1_2 Forward -164 -150 -4.62196 0.298
NP_441330.1_1 Forward -24 -5 -15.7335 0.294
NP_441764.1_4 Reverse -64 -81 18.0029 0.0604
NP_442868.1_6 Reverse -239 -249 10.8948 0.038
NP_442868.1_6 Reverse -390 -400 1.455 0.205
NP_442868.1_6 Forward -252 -242 -0.314959 0.284
NP_441612.1_2 Forward -349 -339 7.19391 0.26
NP_442227.1_2 Forward -390 -371 8.75091 0.171
NP_442227.1_2 Forward -393 -374 3.93269 0.209
NP_442227.1_2 Forward -54 -35 1.67108 0.243
NP_443058.1_7 Reverse -192 -211 1.76941 0.294
NP_442808.1_1 Reverse -240 -250 9.41933 0.0481
NP_442808.1_1 Reverse -135 -145 5.87944 0.137
NP_442808.1_1 Forward -14 -4 3.91283 0.218
NP_442718.1_2 Forward -280 -261 -5.70374 0.295
NP_442050.1_5 Forward -160 -150 8.3377 0.234
NP_442789.1_4 Forward -128 -109 -6.1954 0.285
NP_441878.1_6 Forward -251 -241 11.3864 0.0176
NP_441878.1_6 Reverse -240 -250 0.865012 0.132
NP_441878.1_6 Reverse -217 -227 0.668351 0.139
NP_441878.1_6 Reverse -148 -158 0.668351 0.139
NP_441036.1_3 Reverse -21 -40 -0.39387 0.181
NP_441036.1_8 Forward -159 -149 10.6981 0.158
NP_441036.1_8 Reverse -240 -250 8.53483 0.174
NP_441036.1_8 Forward -251 -241 6.96153 0.213
NP_442721.1_3 Reverse -237 -256 21.6323 0.112
NP_441557.1_5 Forward -250 -241 10.5211 0.00695
NP_441557.1_5 Reverse -241 -250 10.4228 0.00915
NP_441557.1_5 Forward -158 -149 8.94785 0.0289
NP_441557.1_5 Reverse -149 -158 0.688044 0.128
NP_441557.1_8 Forward -389 -379 12.9592 0.23
NP_441520.1_9 Forward -240 -221 12.5858 0.161
NP_441445.1_1 Forward -259 -240 5.30933 0.172
NP_441590.1_4 Reverse -121 -140 8.75009 0.249
NP_441590.1_4 Forward -389 -370 2.16195 0.297
NP_442066.2_9 Reverse -237 -250 19.2922 0.00895
NP_441433.1_8 Forward -207 -188 -4.03212 0.286
NP_440101.1_10 Reverse -4 -23 8.84924 0.171
NP_442397.1_9 Reverse -136 -155 8.65258 0.246
NP_440440.1_5 Forward -195 -176 8.45592 0.208
NP_441549.1_9 Reverse -237 -255 -4.11075 0.198
NP_442347.1_2 Reverse -150 -159 3.14632 0.286
NP_442645.1_2 Forward -21 -2 -17.0118 0.246
NP_441037.1_4 Forward -252 -242 7.90244 0.237
NP_442594.1_8 Reverse -374 -393 3.6377 0.279
NP_442508.1_8 Reverse -373 -390 10.7569 0.267
NP_441633.1_3 Reverse -239 -252 5.62415 0.0481
NP_440136.1_2 Forward -249 -242 6.52896 0.116
NP_440136.1_2 Reverse -242 -249 6.43063 0.154
NP_440136.1_2 Forward -157 -150 6.23397 0.171
NP_440136.1_2 Reverse -150 -157 6.13563 0.193
NP_441728.2_4 Reverse -63 -82 12.4613 0.273
NP_442998.1_5 Forward -196 -186 15.713 0.149
NP_442998.1_5 Forward -350 -340 8.92815 0.26
NP_442998.1_10 Reverse -151 -158 15.5754 0.0102
NP_442998.1_10 Forward -248 -241 6.13563 0.181
NP_442998.1_10 Reverse -243 -250 6.0373 0.205
NP_440299.1_1 Forward -254 -241 5.91857 0.158
NP_440299.1_1 Reverse -237 -250 5.32859 0.18
NP_441799.1_1 Forward -254 -240 10.9137 0.0648
NP_441799.1_1 Reverse -56 -70 3.63724 0.289
NP_440640.1_6 Reverse -35 -54 6.58763 0.18
NP_441007.1_10 Forward -255 -242 -0.964025 0.296
NP_442333.2_5 Reverse -138 -157 -6.29373 0.227
NP_440256.1_1 Reverse -146 -165 1.47442 0.0744
NP_440256.1_1 Forward -161 -142 -8.94866 0.27
NP_442283.1_6 Reverse -109 -128 23.9922 0.0128
NP_441559.1_8 Reverse -280 -294 -5.11362 0.248
NP_441559.1_8 Reverse -236 -250 -6.19526 0.275
NP_441559.1_8 Forward -24 -10 -7.17857 0.287
NP_440915.1_6 Reverse -145 -159 3.63784 0.101
NP_440915.1_6 Reverse -237 -251 0.786239 0.153
NP_440915.1_6 Reverse -377 -391 -2.75368 0.28
NP_441866.1_4 Reverse -334 -347 12.8558 0.28
NP_441866.1_6 Forward -322 -303 7.76679 0.265
NP_442069.1_1 Forward -390 -371 16.7149 0.266
NP_442069.1_8 Forward -205 -186 6.4893 0.235
NP_440026.1_4 Reverse -377 -396 11.8975 0.239
NP_441199.1_3 Reverse -369 -387 0.314141 0.231
NP_439985.1_7 Forward -130 -111 5.211 0.224
NP_442993.1_1 Forward -250 -234 -9.28291 0.181
NP_442386.1_9 Reverse -240 -249 6.48915 0.219
NP_441340.1_5 Forward -249 -242 6.23397 0.132
NP_441340.1_5 Forward -157 -150 6.23397 0.132
NP_441340.1_5 Reverse -242 -249 6.13563 0.175
NP_441340.1_5 Reverse -150 -157 5.84064 0.208
NP_442484.1_2 Reverse -138 -157 0.196116 0.25
NP_440327.1_6 Forward -157 -138 5.30933 0.264
NP_442714.1_7 Forward -400 -381 -2.26216 0.295
NP_440586.1_8 Forward -157 -150 14.69 0.026
NP_442251.1_6 Reverse -150 -157 12.0355 0.0627
NP_442251.1_6 Forward -68 -61 8.69224 0.199
NP_440192.1_5 Reverse -3 -22 3.04771 0.293
NP_441262.1_3 Forward -158 -151 14.7888 0.0223
NP_441262.1_3 Forward -250 -243 5.34899 0.181
NP_441262.1_3 Reverse -241 -248 5.25066 0.215
NP_443051.1_1 Forward -159 -150 10.0295 0.0139
NP_443051.1_1 Forward -251 -242 8.65285 0.029
NP_443051.1_1 Reverse -240 -249 0.884706 0.125
NP_443051.1_1 Reverse -148 -157 -1.08191 0.281
NP_439937.1_9 Forward -282 -265 -11.7615 0.264
NP_439937.1_9 Forward -251 -234 -16.383 0.287
NP_439937.1_9 Reverse -240 -257 -16.4814 0.287
NP_440371.1_4 Reverse -272 -291 25.5646 0.0112
NP_440439.1_1 Reverse -238 -251 3.16588 0.119
NP_440439.1_1 Forward -161 -148 2.2809 0.136
NP_439943.1_4 Forward -144 -125 4.71934 0.287
NP_440372.1_2 Forward -249 -242 6.92228 0.0492
NP_440372.1_2 Reverse -242 -249 6.82395 0.0854
NP_440372.1_2 Forward -157 -150 6.82395 0.0854
NP_440372.1_2 Reverse -150 -157 6.52896 0.188
NP_440819.1_5 Forward -351 -343 8.08256 0.185
NP_441803.1_2 Forward -163 -144 9.83255 0.0936
NP_440210.1_9 Forward -82 -63 8.73051 0.245
NP_441572.1_7 Reverse -235 -254 -4.81876 0.244
NP_441572.1_7 Forward -25 -6 -5.9004 0.276
NP_440267.1_2 Forward -163 -149 6.39049 0.229
NP_442384.1_10 Forward -250 -237 8.18076 0.0685
NP_442384.1_10 Reverse -241 -254 7.59077 0.0784
NP_442384.1_10 Forward -19 -6 4.44418 0.157
NP_441877.1_9 Forward -84 -67 4.75873 0.284
NP_442790.1_4 Reverse -232 -251 0.58944 0.0876
NP_442262.1_10 Forward -157 -150 12.9205 0.0422
NP_441689.1_5 Forward -160 -150 8.3377 0.132
NP_440344.1_10 Forward -60 -43 -12.0559 0.239
NP_440344.1_10 Forward -257 -240 -12.9408 0.269
NP_440531.1_6 Forward -153 -134 -3.14714 0.262
NP_442910.1_1 Forward -257 -238 -7.08038 0.254
NP_441898.1_2 Forward -302 -283 14.8466 0.236
NP_442556.1_1 Forward -204 -185 11.3075 0.299
NP_440297.1_9 Reverse -242 -252 0.176696 0.282
NP_440297.1_9 Reverse -150 -160 -0.609952 0.292
NP_441896.1_3 Reverse -232 -251 1.86774 0.209
NP_441103.1_9 Reverse -277 -287 13.2708 0.27
NP_440894.1_10 Forward -393 -374 2.45773 0.29
NP_440999.1_9 Reverse -237 -251 7.07942 0.0912
NP_440999.1_9 Forward -23 -9 0.687908 0.177
NP_440888.1_2 Forward -250 -236 5.30886 0.284
NP_440600.1_1 Forward -82 -63 13.2252 0.286
NP_440491.1_1 Forward -127 -108 11.0102 0.178
NP_439969.1_3 Reverse -144 -163 -0.688862 0.271
NP_442277.1_4 Reverse -140 -159 9.43841 0.113
NP_442033.1_10 Reverse -48 -67 -11.2103 0.251
NP_441949.1_5 Reverse -64 -83 23.9841 0.00335
NP_441543.1_2 Forward -249 -240 9.04618 0.0874
NP_441543.1_2 Reverse -150 -159 6.09625 0.153
NP_441543.1_2 Forward -157 -148 4.42462 0.246
NP_442845.1_2 Forward -151 -137 7.17775 0.198
NP_442336.1_1 Reverse -190 -209 12.5858 0.164
NP_441469.1_8 Forward -251 -242 11.6028 0.158
NP_441469.1_8 Reverse -240 -249 6.5879 0.227
NP_442578.1_7 Forward -157 -150 14.6904 0.026
NP_442578.1_7 Forward -249 -242 11.9372 0.0739
NP_440710.1_2 Forward -345 -326 23.0089 0.0212
NP_440071.1_6 Reverse -377 -391 14.8714 0.241
NP_442286.1_8 Reverse -7 -25 16.2485 0.294
NP_441462.1_2 Reverse -241 -251 18.6629 0.00281
NP_441462.1_2 Forward -158 -148 9.81313 0.0143
NP_441462.1_2 Forward -250 -240 2.14332 0.0801
NP_441462.1_2 Reverse -149 -159 0.668351 0.135
NP_441621.1_7 Reverse -239 -253 -4.62196 0.238
NP_443062.1_1 Reverse -149 -167 20.1493 0.0208
NP_443062.1_6 Forward -258 -239 11.9958 0.0996
NP_443062.1_6 Forward -77 -58 3.34271 0.239
NP_443062.1_6 Reverse -39 -58 2.3594 0.256
NP_440889.1_5 Forward -329 -310 9.43923 0.277
NP_441410.1_4 Reverse -336 -355 7.07848 0.297
NP_442204.1_1 Forward -162 -151 0.157002 0.283
NP_442204.1_2 Forward -267 -248 5.89931 0.292
NP_442780.1_1 Reverse -68 -87 10.0292 0.195
NP_440516.1_8 Forward -250 -241 7.47288 0.0581
NP_440516.1_8 Reverse -241 -250 7.37455 0.0648
NP_440516.1_8 Forward -158 -149 0.983037 0.13
NP_440516.1_8 Forward -145 -136 -0.295266 0.232
NP_442428.1_5 Forward -249 -242 6.43063 0.148
NP_442428.1_5 Reverse -242 -249 6.3323 0.193
NP_442428.1_5 Forward -157 -150 6.13563 0.209
NP_442428.1_5 Reverse -150 -157 6.0373 0.212
NP_440783.1_5 Reverse -370 -389 1.67108 0.19
NP_440673.1_3 Reverse -151 -158 12.4288 0.0426
NP_440673.1_3 Forward -67 -60 11.3472 0.085
NP_440673.1_3 Forward -248 -241 9.67555 0.179
NP_440673.1_3 Reverse -110 -117 7.80726 0.244
NP_440673.1_7 Reverse -138 -157 2.26107 0.232
NP_441052.1_2 Forward -250 -240 1.06167 0.252
NP_441052.1_2 Reverse -241 -251 0.865012 0.256
NP_440436.1_4 Forward -249 -240 8.94741 0.0924
NP_440436.1_4 Forward -68 -59 8.16077 0.111
NP_440436.1_4 Reverse -242 -251 6.39082 0.162
NP_440436.1_4 Forward -157 -148 5.11253 0.222
NP_442907.1_9 Forward -117 -98 0.491109 0.207
NP_441719.1_4 Forward -157 -150 13.5105 0.026
NP_441719.1_4 Forward -249 -242 6.92228 0.0565
NP_441719.1_4 Reverse -242 -249 6.82395 0.0855
NP_441719.1_4 Reverse -150 -157 6.52896 0.188
NP_441733.1_10 Forward -161 -148 5.03416 0.231
NP_441004.1_1 Forward -143 -124 -7.86702 0.2
NP_441004.1_2 Forward -148 -129 -2.75381 0.265
NP_441004.1_4 Forward -140 -130 10.3048 0.254
NP_442366.1_3 Reverse -148 -166 -3.12744 0.242
NP_439949.1_7 Reverse -199 -213 10.4227 0.293
NP_442873.1_3 Reverse -107 -126 10.52 0.169
NP_441115.1_4 Forward -159 -141 8.57317 0.244
NP_441115.1_4 Reverse -240 -258 8.08151 0.263
NP_440328.1_4 Reverse -109 -128 7.27595 0.124
NP_441851.1_10 Forward -251 -241 8.04317 0.124
NP_441851.1_10 Reverse -240 -250 6.66654 0.159
NP_441851.1_10 Forward -159 -149 5.78156 0.2
NP_441195.1_1 Forward -204 -185 -2.85214 0.242
NP_442011.1_1 Forward -70 -51 0.884433 0.268
NP_441668.1_4 Forward -260 -241 -0.4922 0.255
NP_442515.1_1 Forward -251 -237 4.12949 0.108
NP_441396.1_5 Reverse -374 -383 7.57121 0.241
NP_440463.1_8 Reverse -43 -62 8.85527 0.252
NP_441349.1_10 Forward -168 -149 -7.67036 0.258
NP_440432.1_9 Reverse -150 -165 -4.15 0.198
NP_442843.1_1 Forward -201 -182 -4.03212 0.232
NP_442843.1_1 Forward -116 -97 -9.93197 0.272
NP_442843.1_1 Reverse -374 -393 -12.0953 0.298
NP_442450.1_5 Forward -252 -242 7.94484 0.13
NP_442450.1_5 Reverse -147 -157 6.76487 0.155
NP_442450.1_5 Forward -160 -150 6.17489 0.197
NP_440588.1_2 Reverse -232 -251 -2.85214 0.174
NP_441031.1_1 Reverse -71 -90 8.17242 0.25
NP_442006.1_2 Forward -308 -291 -18.1524 0.288
NP_441003.1_9 Forward -154 -135 5.11266 0.268
NP_441570.1_1 Reverse -149 -167 -10.5023 0.171
NP_441570.1_1 Reverse -4 -22 -16.7954 0.254
NP_441078.1_4 Forward -250 -241 10.2261 0.0136
NP_441078.1_4 Reverse -241 -250 10.1278 0.016
NP_441078.1_4 Reverse -149 -158 0.0980582 0.205
NP_441078.1_4 Forward -158 -149 0.0980582 0.205
NP_442729.1_5 Reverse -3 -13 8.63316 0.248
NP_442729.1_8 Reverse -237 -250 7.88576 0.132
NP_441663.1_8 Reverse -54 -73 2.0644 0.206
NP_441094.1_1 Forward -394 -380 18.0918 0.256
NP_441094.1_6 Forward -112 -95 8.69123 0.261
NP_441432.1_8 Forward -146 -137 8.55452 0.0755
NP_441432.1_8 Forward -159 -150 7.27622 0.101
NP_442320.1_8 Forward -164 -150 -5.60527 0.236
NP_440497.1_2 Reverse -36 -55 8.84924 0.208
NP_440760.1_1 Forward -250 -231 -21.7317 0.243
NP_442797.1_6 Reverse -151 -170 10.3581 0.238
NP_440199.1_10 Forward -161 -151 14.238 0.0861
NP_440461.1_3 Reverse -237 -256 13.8641 0.297
NP_441805.1_1 Forward -354 -335 -2.65548 0.199
NP_441057.1_4 Reverse -40 -58 -1.25915 0.272
NP_441072.1_2 Reverse -237 -256 7.27595 0.258
NP_442489.1_7 Forward -250 -241 10.7178 0.00742
NP_442489.1_7 Reverse -241 -250 10.6195 0.00984
NP_442489.1_7 Reverse -149 -158 7.57121 0.057
NP_442489.1_7 Forward -158 -149 0.589713 0.17
NP_440941.1_1 Reverse -379 -389 16.6963 0.241
NP_441452.1_1 Forward -393 -374 12.9791 0.292
NP_440559.1_1 Forward -157 -148 14.356 0.0209
NP_440559.1_1 Reverse -242 -251 7.76787 0.0918
NP_440559.1_1 Reverse -61 -70 4.81794 0.193
NP_440559.1_1 Forward -68 -59 4.32629 0.288
NP_441659.2_8 Reverse -241 -251 16.4013 0.00332
NP_441659.2_8 Reverse -149 -159 9.02648 0.037
NP_441659.2_8 Forward -250 -240 2.53664 0.198
NP_441659.2_8 Forward -158 -148 0.176696 0.271
NP_441968.1_1 Forward -351 -343 14.1787 0.286
NP_442346.1_5 Reverse -59 -69 11.1898 0.0735
NP_442346.1_5 Forward -251 -241 8.53483 0.133
NP_442346.1_5 Forward -159 -149 6.66654 0.195
NP_442346.1_5 Reverse -148 -158 5.97822 0.219
NP_442346.1_5 Reverse -141 -151 5.78156 0.229
NP_442346.1_5 Reverse -240 -250 5.19158 0.256
NP_440545.1_3 Forward -254 -237 3.18543 0.0875
NP_440831.1_5 Forward -112 -93 18.2961 0.223
NP_440847.1_3 Reverse -273 -287 16.5185 0.125
NP_440847.1_3 Forward -389 -375 11.897 0.254
NP_441948.1_3 Forward -83 -64 25.122 0.00338
NP_441948.1_4 Forward -257 -239 21.4553 0.0121
NP_441948.1_6 Forward -200 -183 24.1299 0.0316
NP_441948.1_10 Forward -180 -161 31.2687 0.000322
NP_441833.1_4 Forward -249 -242 6.52896 0.0924
NP_441833.1_4 Reverse -150 -157 6.52896 0.0924
NP_441833.1_4 Reverse -242 -249 6.43063 0.125
NP_441833.1_4 Forward -157 -150 6.23397 0.163
NP_443040.1_1 Forward -350 -336 10.8604 0.291
NP_441895.1_7 Reverse -184 -203 -8.26035 0.189
NP_442162.1_9 Forward -249 -242 6.82395 0.0927
NP_442162.1_9 Reverse -242 -249 6.72562 0.116
NP_442162.1_9 Forward -157 -150 6.62729 0.142
NP_442162.1_9 Reverse -150 -157 6.52896 0.178
NP_440671.1_4 Forward -164 -150 9.5377 0.18
NP_442199.1_5 Forward -265 -246 -2.85214 0.196
NP_442140.1_3 Forward -249 -239 4.79825 0.238
NP_442140.1_3 Forward -157 -147 4.0116 0.265
NP_442140.1_3 Reverse -242 -252 4.0116 0.265
NP_440875.1_9 Reverse -151 -161 7.59334 0.255
NP_441813.1_5 Reverse -239 -249 9.91146 0.021
NP_441813.1_5 Forward -160 -150 6.17489 0.1
NP_441813.1_5 Forward -252 -242 -0.609952 0.261
NP_441813.1_7 Forward -53 -39 13.9619 0.197
NP_442028.1_1 Reverse -334 -347 7.31916 0.292
NP_439901.1_8 Forward -254 -235 10.6192 0.288
NP_440590.1_4 Forward -249 -236 2.96921 0.0783
NP_440590.1_4 Forward -123 -110 0.117615 0.169
NP_440567.1_1 Reverse -242 -256 6.6861 0.0816
NP_440567.1_1 Forward -157 -143 2.5562 0.17
NP_442497.1_10 Reverse -242 -251 10.3245 0.0104
NP_442497.1_10 Forward -157 -148 8.25953 0.047
NP_442497.1_10 Reverse -150 -159 7.76787 0.0731
NP_442497.1_10 Forward -249 -240 0.983037 0.123
NP_440821.1_4 Forward -252 -242 1.55333 0.133
NP_440821.1_4 Forward -160 -150 1.35667 0.137
NP_440821.1_4 Reverse -239 -249 0.668351 0.159
NP_441239.1_9 Reverse -239 -251 8.20045 0.141
NP_441239.1_9 Forward -252 -240 4.36554 0.253
NP_441951.1_4 Reverse -374 -393 2.45773 0.283
NP_441892.1_1 Reverse -140 -157 6.62702 0.0946
NP_441892.1_1 Forward -167 -150 1.8088 0.147
NP_440665.1_1 Reverse -187 -206 -14.2585 0.261
NP_441017.1_6 Forward -162 -148 10.9137 0.294
NP_441769.1_3 Forward -326 -307 4.32522 0.159
NP_441541.1_1 Reverse -65 -83 2.58027 0.195
NP_442052.1_6 Forward -120 -102 19.6845 0.0923
NP_440546.1_4 Forward -158 -148 6.45857 0.296
NP_440462.1_6 Forward -160 -150 13.648 0.0266
NP_440462.1_6 Reverse -239 -249 7.74818 0.0699
NP_440868.1_4 Reverse -237 -249 2.98891 0.142
NP_441474.1_1 Forward -51 -32 -1.96793 0.267
NP_440653.1_10 Forward -157 -138 5.211 0.234
NP_442882.1_8 Reverse -200 -219 7.47261 0.267
NP_442039.1_7 Forward -200 -190 9.51814 0.257
NP_441811.1_8 Reverse -386 -400 8.65272 0.233
NP_441811.1_8 Reverse -4 -18 8.55439 0.235
NP_441053.1_3 Forward -207 -188 2.75272 0.242
NP_442817.1_1 Reverse -185 -204 11.7008 0.284
NP_442837.1_3 Reverse -150 -157 12.1338 0.0702
NP_442837.1_3 Forward -249 -242 6.43063 0.212
NP_442837.1_3 Reverse -242 -249 6.23397 0.244
NP_442837.1_3 Forward -157 -150 6.0373 0.25
NP_442053.1_1 Reverse -241 -250 9.34117 0.0666
NP_442053.1_1 Forward -250 -241 9.04618 0.0689
NP_442053.1_1 Reverse -149 -158 6.8829 0.111
NP_440505.1_3 Reverse -94 -104 10.0098 0.12
NP_440505.1_3 Reverse -239 -249 6.37155 0.183
NP_440505.1_3 Forward -160 -150 6.27322 0.187
NP_441701.1_3 Reverse -372 -389 7.61033 0.259
NP_441536.1_10 Reverse -371 -390 9.73422 0.298
NP_441408.2_7 Forward -21 -2 0.884433 0.215
NP_440914.1_4 Forward -110 -94 10.0876 0.274
NP_441011.1_8 Forward -249 -240 7.47288 0.171
NP_441011.1_8 Reverse -150 -159 6.78456 0.184
NP_441011.1_8 Forward -157 -148 5.99792 0.208
NP_441011.1_8 Reverse -242 -251 4.91628 0.296
NP_442533.1_1 Reverse -371 -390 -13.9635 0.239
NP_442533.1_1 Reverse -377 -396 -14.6519 0.247
NP_442533.1_1 Reverse -35 -54 -15.2418 0.253
NP_442533.1_1 Reverse -82 -101 -17.2085 0.281
NP_442533.1_6 Forward -250 -241 14.5527 0.0116
NP_442533.1_6 Reverse -241 -250 7.86621 0.0862
NP_442533.1_6 Forward -158 -149 5.40793 0.14
NP_442541.1_10 Forward -36 -22 2.75226 0.254
NP_442232.1_3 Forward -258 -239 -12.1936 0.282
NP_442322.1_4 Forward -393 -376 -7.63163 0.286
NP_442322.1_4 Forward -392 -375 -8.12328 0.286
NP_441482.1_7 Forward -164 -150 -11.1118 0.237
NP_439944.1_9 Reverse -150 -160 7.84651 0.127
NP_441028.1_6 Reverse -188 -198 7.45273 0.229
NP_440116.1_8 Forward -157 -138 -7.17871 0.223
NP_440115.1_6 Reverse -57 -67 12.9597 0.0846
NP_440007.1_9 Forward -149 -135 2.06454 0.281
NP_441972.1_5 Forward -123 -104 -7.27704 0.247
NP_441972.1_5 Reverse -118 -137 -10.0303 0.296
NP_441106.1_1 Reverse -240 -249 15.4377 0.0105
NP_441106.1_1 Forward -159 -150 8.75118 0.0469
NP_441106.1_3 Reverse -63 -82 21.1406 0.0238
NP_441420.1_1 Reverse -95 -114 -4.72043 0.292
NP_441420.1_1 Forward -159 -140 -5.99873 0.297
NP_440480.1_4 Forward -308 -294 18.9775 0.109
NP_439903.1_6 Forward -22 -3 -1.18128 0.293
NP_441286.1_1 Reverse -3 -15 -1.43599 0.145
NP_441286.1_1 Reverse -240 -252 -3.59927 0.145
NP_440670.1_8 Forward -250 -241 8.94785 0.0606
NP_440670.1_8 Reverse -241 -250 8.84951 0.0606
NP_440886.1_7 Reverse -240 -250 16.7941 0.0069
NP_440886.1_7 Forward -390 -380 12.2709 0.0805
NP_440886.1_7 Forward -54 -44 9.91099 0.0805
NP_442614.1_2 Reverse -241 -255 15.4376 0.0773
NP_442072.1_9 Forward -159 -141 -21.8103 0.212
NP_442072.1_9 Reverse -148 -166 -22.892 0.266
NP_439899.1_1 Forward -85 -67 5.16069 0.243
NP_440907.2_8 Forward -157 -147 10.1076 0.103
NP_440907.2_8 Reverse -242 -252 6.66608 0.157
NP_442264.1_2 Forward -147 -130 7.11867 0.247
NP_441463.1_3 Forward -48 -29 -7.86702 0.262
NP_441463.1_3 Forward -63 -44 -8.26035 0.267
NP_441463.1_6 Forward -229 -215 6.8991 0.267
NP_441626.1_2 Reverse -242 -249 12.6255 0.0468
NP_441626.1_2 Forward -249 -242 6.3323 0.155
NP_441626.1_2 Forward -157 -150 6.13563 0.177
NP_441626.1_2 Reverse -150 -157 5.93897 0.231
NP_442365.1_7 Forward -63 -44 -1.86883 0.196
NP_442209.1_8 Forward -217 -198 15.1424 0.176
NP_442615.1_1 Forward -259 -241 9.65558 0.0244
NP_442615.1_1 Reverse -232 -250 -6.96235 0.271
NP_440387.1_1 Forward -250 -234 -3.48138 0.16
NP_441431.1_2 Reverse -238 -252 10.6187 0.158
NP_441836.1_2 Reverse -370 -389 1.47442 0.193
NP_441836.1_2 Reverse -212 -231 -4.42544 0.255
NP_441993.1_1 Reverse -4 -23 10.6204 0.124
NP_440358.1_8 Forward -331 -312 -2.36049 0.3
NP_440114.1_10 Reverse -149 -163 9.5377 0.169
NP_442437.1_8 Reverse -104 -123 3.14605 0.291
NP_441510.2_7 Forward -208 -194 12.6836 0.28
NP_440287.1_6 Reverse -140 -159 3.6377 0.216
NP_440293.1_3 Reverse -374 -393 -2.85214 0.241
NP_440293.1_10 Reverse -87 -106 -2.45882 0.273
NP_440293.1_10 Reverse -380 -399 -2.55715 0.274
NP_441311.1_2 Forward -256 -242 12.782 0.23
NP_442867.1_8 Forward -388 -369 7.17762 0.244
NP_440457.1_1 Forward -254 -242 9.67541 0.092
NP_440457.1_1 Reverse -376 -388 0.432302 0.25
NP_440457.1_1 Forward -162 -150 -0.157684 0.254
NP_440798.1_6 Reverse -242 -255 11.7207 0.0564
NP_440798.1_6 Forward -388 -375 0.60927 0.254
NP_441332.1_6 Reverse -135 -145 12.6149 0.221
NP_441436.1_8 Forward -139 -120 7.47261 0.293
NP_442509.1_9 Reverse -241 -251 8.63269 0.192
NP_442509.1_9 Forward -250 -240 6.76441 0.254
NP_440554.1_4 Forward -249 -239 7.05986 0.106
NP_440554.1_4 Reverse -150 -160 6.46988 0.123
NP_441885.1_5 Forward -250 -240 2.04498 0.0868
NP_441885.1_5 Reverse -241 -251 1.84832 0.0957
NP_441885.1_5 Forward -158 -148 0.668351 0.133
NP_442341.1_9 Reverse -239 -253 11.4053 0.127
NP_441173.1_9 Reverse -189 -197 13.1954 0.184
NP_443000.1_7 Forward -160 -150 7.74818 0.0666
NP_443000.1_7 Forward -21 -11 4.20827 0.209
NP_443000.1_7 Reverse -239 -249 2.04498 0.226
NP_440076.1_5 Forward -203 -184 13.6666 0.252
NP_441842.1_10 Forward -165 -151 6.98109 0.27
NP_440275.1_3 Reverse -239 -249 14.4347 0.0216
NP_440091.1_1 Forward -162 -150 -0.74767 0.286
NP_440679.1_10 Reverse -40 -59 -12.7836 0.213
NP_443010.1_9 Reverse -248 -267 21.4356 0.103
NP_439962.1_4 Forward -390 -371 -5.80207 0.28
NP_439962.1_4 Forward -60 -41 -8.94866 0.298
NP_442495.1_4 Forward -258 -248 12.3697 0.229
NP_440216.1_1 Reverse -241 -255 7.27608 0.00942
NP_440216.1_1 Forward -250 -236 -2.06536 0.0458
NP_440216.1_1 Reverse -149 -163 -3.44199 0.082
NP_440216.1_1 Forward -158 -144 -11.2101 0.169
NP_440216.1_9 Forward -353 -344 9.93116 0.286
NP_440172.1_1 Forward -158 -148 8.82982 0.0586
NP_440172.1_1 Reverse -241 -251 6.76487 0.101
NP_440172.1_1 Reverse -10 -20 4.10993 0.205
NP_442015.1_10 Forward -254 -241 1.59258 0.204
NP_441226.1_7 Forward -249 -242 11.8385 0.0485
NP_441226.1_7 Reverse -137 -144 8.29857 0.205
NP_441757.1_3 Reverse -240 -259 3.44104 0.155
NP_441111.1_7 Forward -249 -241 9.26253 0.0107
NP_441111.1_7 Reverse -242 -250 9.1642 0.0184
NP_441111.1_7 Reverse -150 -158 8.86921 0.0589
NP_441766.1_2 Forward -250 -241 14.2577 0.0103
NP_441766.1_2 Forward -158 -149 8.1612 0.0645
NP_441766.1_2 Reverse -241 -250 7.96454 0.0694
NP_440416.1_9 Forward -257 -238 1.37609 0.0457
NP_443052.1_9 Forward -389 -370 -4.6221 0.259
NP_443052.1_9 Forward -392 -373 -5.40875 0.27
NP_442154.1_1 Reverse -200 -218 1.88744 0.0787
NP_442154.1_1 Reverse -36 -54 -7.55234 0.143
NP_442154.1_1 Forward -145 -127 -7.65067 0.146
NP_442154.1_1 Reverse -378 -396 -17.3854 0.254
NP_440261.1_5 Reverse -242 -255 -0.865694 0.0655
NP_440261.1_5 Forward -68 -55 -3.02898 0.108
NP_440261.1_5 Forward -249 -236 -4.40561 0.147
NP_440988.1_10 Reverse -48 -62 6.44783 0.232
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGGATTACCACCCCTACCCCCCACCGGAGCATAGATTTGAATGTCCCGCCAGGAAAAAACCAAAATTGTCGGCTGAAATTCATCAATACATTCATCAAGGGCCCGGTTGAAATCCAGGGGAGGAATGGTGCCTAAATCGAAAATCCGCTGGGCGGTCGCCGGAAAACATTTATGGACATGGTCCGCCAGATAAATCACCCCAATGGGGAAAATCGGGTTACAGGGAAGACGAACGTACAAAAGGCGATCGATCATGGCGTTGGGGCACTGGTAGGGTGAGATCAGCAACGGGAGGGACTACCCCCACTTACTCACAATTGTAATATATCTTAACGATTGCTCGGAGCCGCCACCCTCAGCATTCTGACCGTTCTAGCCCCAAGTAATCACCAACGCCAAA

CDS

GTGCAATGCCTCGGAAAAATTTTCTTGAGTCCAGGGACAAAGCCAGAGTCAAAAAATTTGATTGTAATTATCTTTACAGCGGATCGGGATCAGCGGGTGTTAGCTTTGTCCAGAATAGTTAAAAGACCTTTTTTTAATAAAAATCCCATGCCTGCCATGTCCCAAATTCTTGATCCCATCCCCAACAACCAGCCATCAGCCTTATTCTGTTGCTACGTCAATGCCACCAATCAAATCCAAGTGGCCCGCATTACCAATGTCCCTAATTGGTATTTTGAAAGAGTTGTGTTCCCTGGTCAACGGTTAGTATTTGAGGCAGTGCCCAGCGCTCAGTTAGAAATTCATACTGGCATGATGGCCAGCTCGATTATTTCGGACACCATTCCCTGCGAACAACTGAGTATTGATCCCGACGGATTAGCAGCGGGCGGTTTCATCTCTCCAGAAAAAGAACACGAGTCCGAGGATATGACTTCCCAATCCTTAGTGGCTTAG

Protein

MQCLGKIFLSPGTKPESKNLIVIIFTADRDQRVLALSRIVKRPFFNKNPMPAMSQILDPIPNNQPSALFCCYVNATNQIQVARITNVPNWYFERVVFPGQRLVFEAVPSAQLEIHTGMMASSIISDTIPCEQLSIDPDGLAAGGFISPEKEHESEDMTSQSLVA