Your browser is old and dusty. Try Google Chrome!

Details for sll0939

ORF sll0939
Accession NP_440194.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441418.1_6 Forward -364 -345 -12.0953 0.0601
NP_440897.1_3 Reverse -69 -88 5.50599 0.123
NP_440897.1_6 Forward -364 -345 -2.26292 0.206
NP_441453.1_1 Reverse -348 -366 2.28001 0.299
NP_441453.1_4 Reverse -355 -363 7.09925 0.0962
NP_441453.1_4 Forward -364 -356 7.00092 0.107
NP_441623.1_1 Reverse -348 -366 -1.25915 0.24
NP_441623.1_1 Forward -371 -353 -1.45582 0.24
NP_442151.1_6 Reverse -355 -369 12.586 0.0718
NP_442151.1_10 Forward -380 -362 11.6222 0.289
NP_442838.1_7 Forward -369 -350 -10.227 0.232
NP_441818.1_1 Reverse -356 -367 10.4812 0.232
NP_441818.1_6 Reverse -348 -362 11.0127 0.253
NP_441818.1_9 Forward -132 -113 2.55606 0.185
NP_441818.1_9 Forward -138 -119 0.687771 0.191
NP_441630.1_3 Forward -372 -353 17.5024 0.0318
NP_440150.1_2 Reverse -282 -301 4.91521 0.281
NP_440996.1_4 Forward -76 -66 15.713 0.27
NP_442655.1_2 Reverse -287 -306 0.58944 0.291
NP_442173.1_1 Reverse -356 -364 12.9008 0.0296
NP_442173.1_1 Forward -363 -355 5.72262 0.203
NP_440784.1_7 Forward -363 -356 6.3323 0.228
NP_440784.1_7 Reverse -356 -363 6.13563 0.241
NP_442861.1_1 Forward -183 -164 12.5858 0.26
NP_442861.1_4 Reverse -3 -22 0.0970122 0.297
NP_440061.1_9 Forward -249 -235 11.602 0.107
NP_440110.1_8 Forward -366 -347 0.884433 0.211
NP_441054.1_4 Reverse -202 -220 -0.964162 0.191
NP_439979.1_9 Forward -354 -336 11.6222 0.227
NP_441499.1_5 Reverse -58 -72 13.9626 0.275
NP_442062.1_8 Reverse -355 -365 16.008 0.00535
NP_442062.1_8 Forward -364 -354 9.81313 0.0557
NP_441802.1_1 Reverse -31 -50 4.71934 0.29
NP_440304.1_4 Forward -366 -356 15.713 0.0318
NP_440304.1_4 Reverse -353 -363 8.04317 0.0867
NP_442268.1_3 Forward -246 -227 15.0432 0.284
NP_442242.1_4 Reverse -356 -363 11.8388 0.0776
NP_440044.1_8 Forward -363 -344 1.0811 0.183
NP_441781.1_7 Forward -156 -137 -3.44213 0.296
NP_441035.1_3 Forward -367 -348 8.25926 0.171
NP_439918.1_2 Forward -138 -119 7.96426 0.149
NP_440307.1_10 Forward -232 -213 14.8474 0.224
NP_441208.1_9 Reverse -366 -380 4.91614 0.282
NP_441208.1_9 Forward -367 -353 4.81781 0.285
NP_441594.1_6 Forward -373 -354 0.294447 0.289
NP_442110.1_7 Forward -139 -125 5.21113 0.178
NP_440769.1_8 Reverse -168 -187 6.58763 0.296
NP_441083.1_5 Reverse -355 -365 9.51814 0.026
NP_441083.1_5 Forward -364 -354 1.65166 0.2
NP_442827.1_8 Reverse -347 -366 -2.65624 0.286
NP_441149.1_7 Reverse -345 -364 5.60432 0.267
NP_441434.1_3 Forward -367 -348 0.786102 0.198
NP_441738.1_2 Forward -362 -355 13.8051 0.0221
NP_440209.1_1 Forward -364 -356 8.37755 0.0576
NP_440209.1_1 Reverse -355 -363 8.27922 0.0687
NP_442889.1_1 Reverse -183 -202 -13.0786 0.247
NP_442570.1_3 Forward -262 -243 -0.39387 0.211
NP_442570.1_3 Forward -141 -122 -3.83545 0.225
NP_442570.1_3 Forward -206 -187 -5.99873 0.253
NP_442570.1_3 Forward -134 -115 -6.78538 0.259
NP_442111.1_3 Reverse -303 -316 13.7171 0.259
NP_442111.1_4 Forward -365 -351 5.30946 0.169
NP_440906.1_5 Forward -363 -356 6.13563 0.241
NP_440906.1_5 Reverse -356 -363 6.13563 0.241
NP_442596.1_10 Forward -137 -118 8.55425 0.281
NP_440747.1_10 Reverse -366 -378 -4.28759 0.0903
NP_440747.1_10 Forward -367 -355 -11.6624 0.131
NP_440747.1_10 Reverse -352 -364 -11.8591 0.161
NP_440747.1_10 Reverse -294 -306 -11.9574 0.178
NP_441130.1_10 Reverse -353 -367 10.226 0.117
NP_441130.1_10 Forward -366 -352 7.9644 0.144
NP_441486.1_1 Reverse -352 -366 -4.7203 0.205
NP_442634.1_4 Forward -140 -126 -3.24533 0.161
NP_441265.1_3 Forward -370 -356 1.76955 0.2
NP_440403.1_4 Reverse -346 -365 -9.53865 0.278
NP_440403.1_4 Reverse -148 -167 -9.53865 0.278
NP_441014.1_8 Reverse -116 -135 -9.44032 0.295
NP_442848.1_1 Reverse -349 -363 -4.62196 0.298
NP_442848.1_4 Forward -152 -138 5.30946 0.299
NP_442848.1_5 Reverse -243 -261 2.77242 0.276
NP_441012.1_4 Reverse -348 -361 7.29578 0.272
NP_441012.1_4 Forward -362 -349 6.01747 0.286
NP_441012.1_4 Forward -141 -128 5.62415 0.291
NP_443018.1_3 Reverse -356 -363 12.0355 0.0639
NP_443018.1_3 Forward -363 -356 5.64398 0.181
NP_441634.1_8 Reverse -193 -207 -2.16369 0.295
NP_441634.1_8 Forward -72 -58 -2.85201 0.295
NP_441634.1_8 Forward -366 -352 -2.95034 0.295
NP_440376.1_1 Reverse -355 -364 16.0277 0.00493
NP_440376.1_1 Reverse -297 -306 10.6195 0.0281
NP_440376.1_1 Forward -364 -355 9.73449 0.0365
NP_441857.1_6 Forward -139 -129 14.4347 0.244
NP_442687.1_7 Forward -365 -355 18.6629 0.0028
NP_442687.1_7 Reverse -354 -364 6.17489 0.178
NP_442191.1_4 Reverse -358 -372 13.0292 0.17
NP_440066.1_5 Forward -356 -337 14.9449 0.194
NP_442485.1_3 Forward -366 -347 -0.787193 0.253
NP_442485.1_3 Forward -168 -149 -4.03212 0.277
NP_442485.1_3 Reverse -239 -258 -5.9004 0.296
NP_441846.1_10 Forward -126 -107 -22.125 0.257
NP_440642.1_10 Forward -152 -138 1.76896 0.289
NP_441013.1_3 Forward -82 -63 5.89931 0.281
NP_441422.1_7 Reverse -152 -169 -8.12263 0.266
NP_440360.1_10 Reverse -357 -371 1.76955 0.289
NP_442658.1_1 Forward -366 -356 16.1058 0.00966
NP_442658.1_1 Reverse -353 -363 9.51767 0.151
NP_442198.1_3 Reverse -49 -68 2.65439 0.297
NP_440528.1_1 Forward -395 -382 16.2665 0.259
NP_441855.2_4 Reverse -347 -366 10.1979 0.261
NP_440656.1_8 Reverse -344 -363 -4.6221 0.207
NP_442544.1_2 Reverse -362 -376 -1.27871 0.272
NP_441414.1_9 Reverse -297 -316 2.94938 0.0612
NP_442937.1_5 Reverse -239 -258 7.86593 0.241
NP_442321.1_4 Reverse -330 -349 -0.197208 0.255
NP_441958.1_5 Forward -365 -355 10.7964 0.0099
NP_441958.1_5 Reverse -354 -364 2.43831 0.0422
NP_441127.1_1 Forward -70 -56 10.226 0.255
NP_443001.1_7 Forward -150 -131 3.93269 0.279
NP_440984.1_7 Forward -369 -355 6.58777 0.209
NP_442376.1_2 Reverse -352 -371 -12.3902 0.286
NP_442911.1_2 Reverse -345 -364 -10.1286 0.27
NP_440153.1_5 Forward -363 -349 0.786239 0.289
NP_442064.1_4 Reverse -345 -364 11.7983 0.174
NP_443055.1_6 Reverse -355 -373 12.3097 0.111
NP_440993.1_2 Forward -369 -353 10.0883 0.106
NP_440993.1_2 Reverse -350 -366 1.5335 0.279
NP_442002.1_9 Forward -365 -358 12.4288 0.185
NP_442002.1_9 Reverse -354 -361 9.67555 0.27
NP_441646.1_1 Forward -260 -241 1.76941 0.228
NP_442438.1_10 Reverse -350 -364 4.81781 0.142
NP_441000.1_6 Forward -365 -351 4.12949 0.0992
NP_442771.1_1 Forward -366 -348 -4.70074 0.166
NP_440147.1_4 Forward -366 -353 9.55739 0.0392
NP_440147.1_4 Reverse -353 -366 3.26421 0.191
NP_441550.1_8 Forward -366 -356 10.3043 0.0709
NP_441916.1_7 Forward -364 -354 8.73149 0.042
NP_441916.1_7 Reverse -355 -365 7.45319 0.0656
NP_441916.1_10 Reverse -243 -262 1.17943 0.27
NP_440206.1_4 Reverse -252 -271 -2.06626 0.293
NP_440206.1_9 Forward -373 -354 7.96426 0.279
NP_440345.1_3 Reverse -26 -40 9.94278 0.297
NP_440465.1_4 Reverse -354 -373 10.3242 0.264
NP_441041.1_7 Forward -367 -355 18.01 0.00663
NP_441041.1_7 Reverse -352 -364 8.2922 0.139
NP_441041.1_7 Forward -274 -262 7.4176 0.167
NP_440569.1_10 Reverse -169 -188 3.67602 0.278
NP_443063.1_2 Forward -337 -318 6.39097 0.283
NP_440703.1_9 Forward -247 -234 4.83694 0.293
NP_441725.1_5 Reverse -356 -366 17.188 0.0247
NP_441725.1_5 Forward -363 -353 -0.511621 0.26
NP_439966.1_7 Reverse -353 -363 7.64939 0.15
NP_439966.1_7 Forward -366 -356 4.30615 0.279
NP_439966.1_9 Reverse -353 -362 7.86621 0.253
NP_440289.1_2 Forward -367 -354 4.54251 0.066
NP_440289.1_2 Reverse -352 -365 3.46087 0.078
NP_442281.1_1 Forward -369 -355 15.7319 0.011
NP_441334.1_7 Forward -366 -347 -20.5517 0.277
NP_441079.1_7 Reverse -178 -197 -7.3761 0.292
NP_440018.1_3 Reverse -245 -264 11.7992 0.13
NP_001035871.2_7 Forward -141 -131 14.1397 0.218
NP_442012.1_1 Reverse -349 -368 9.14423 0.0974
NP_441457.1_7 Forward -366 -347 4.12936 0.223
NP_441556.1_10 Reverse -56 -70 14.018 0.178
NP_440498.1_5 Forward -287 -269 13.2494 0.185
NP_442982.1_5 Reverse -137 -156 13.9625 0.0761
NP_442068.1_4 Forward -253 -234 6.78348 0.23
NP_442068.1_4 Reverse -108 -127 5.80018 0.246
NP_441644.1_6 Reverse -355 -365 11.7793 0.0432
NP_442215.1_2 Reverse -353 -369 5.76173 0.0769
NP_442029.1_6 Forward -203 -184 4.916 0.259
NP_440253.1_2 Forward -364 -346 -1.06249 0.23
NP_440929.1_8 Forward -364 -355 9.53783 0.0296
NP_440929.1_8 Reverse -355 -364 9.4395 0.0326
NP_440929.1_8 Forward -306 -297 3.93297 0.197
NP_440780.1_1 Forward -327 -308 12.1748 0.242
NP_442933.1_10 Reverse -355 -364 7.86621 0.103
NP_442933.1_10 Forward -364 -355 7.86621 0.103
NP_442554.1_8 Reverse -356 -366 7.74818 0.0846
NP_442554.1_8 Forward -363 -353 6.8632 0.103
NP_442554.1_8 Reverse -298 -308 2.33998 0.274
NP_441762.1_7 Forward -365 -353 11.2487 0.0142
NP_441762.1_7 Reverse -354 -366 1.90727 0.0721
NP_442142.1_4 Forward -367 -354 5.62358 0.187
NP_442292.1_1 Forward -363 -354 0.0980582 0.239
NP_442292.1_1 Reverse -356 -365 -0.295266 0.24
NP_442476.1_6 Forward -363 -349 1.96621 0.199
NP_443009.1_5 Forward -365 -354 19.626 0.00102
NP_443009.1_5 Forward -199 -188 7.03967 0.141
NP_443009.1_5 Reverse -354 -365 5.07306 0.218
NP_440357.1_3 Reverse -353 -372 2.26107 0.264
NP_440730.1_4 Forward -364 -345 0.196116 0.248
NP_440183.1_9 Reverse -110 -129 -19.4701 0.279
NP_441198.1_8 Forward -366 -356 15.6152 0.0427
NP_440379.1_5 Forward -364 -345 -9.93197 0.27
NP_441468.1_1 Reverse -356 -363 6.3323 0.202
NP_441468.1_1 Forward -363 -356 6.13563 0.209
NP_441020.2_6 Reverse -353 -370 16.1651 0.0313
NP_441015.1_10 Reverse -233 -252 6.09597 0.112
NP_441015.1_10 Forward -128 -109 -4.32711 0.202
NP_441673.1_1 Forward -364 -355 11.1111 0.0121
NP_441673.1_1 Reverse -355 -364 11.0128 0.018
NP_440672.1_1 Reverse -239 -257 17.4237 0.215
NP_442253.1_5 Reverse -241 -258 -3.40274 0.287
NP_441426.1_3 Reverse -363 -382 8.25844 0.259
NP_441826.1_2 Reverse -349 -363 4.62115 0.101
NP_441826.1_2 Forward -370 -356 -3.147 0.283
NP_442490.1_9 Forward -76 -57 -0.885524 0.179
NP_442868.1_6 Forward -366 -356 13.5497 0.038
NP_442719.1_2 Reverse -170 -188 7.98318 0.107
NP_442719.1_2 Forward -230 -212 -11.1913 0.29
NP_442559.1_3 Forward -374 -355 8.16093 0.287
NP_443058.1_7 Forward -307 -288 4.12936 0.26
NP_442361.1_3 Reverse -363 -376 9.75405 0.272
NP_442808.1_1 Reverse -354 -364 9.12434 0.0481
NP_442808.1_1 Forward -307 -297 5.38779 0.155
NP_442808.1_1 Reverse -60 -70 5.28945 0.162
NP_442808.1_1 Reverse -122 -132 2.43787 0.266
NP_442808.1_1 Forward -352 -342 2.33954 0.27
NP_442542.1_2 Reverse -353 -366 10.049 0.131
NP_442542.1_2 Reverse -236 -249 7.00078 0.197
NP_442113.1_10 Forward -368 -349 5.11266 0.12
NP_442050.1_5 Forward -366 -356 12.4676 0.0617
NP_442342.1_9 Reverse -355 -371 2.22182 0.29
NP_440342.1_1 Reverse -235 -254 14.3558 0.192
NP_440342.1_1 Reverse -241 -260 10.3242 0.287
NP_440558.1_2 Forward -263 -244 -6.29373 0.273
NP_440558.1_2 Reverse -186 -205 -6.29373 0.273
NP_441048.1_4 Forward -355 -336 12.6841 0.252
NP_441048.1_7 Reverse -30 -44 17.3052 0.272
NP_440923.1_5 Reverse -114 -133 18.1898 0.267
NP_441878.1_6 Forward -365 -355 11.0914 0.0176
NP_441878.1_6 Reverse -354 -364 2.14332 0.0501
NP_441878.1_6 Reverse -296 -306 -7.29646 0.217
NP_441036.1_8 Reverse -354 -364 7.94484 0.181
NP_440614.1_8 Reverse -227 -246 14.4541 0.194
NP_441557.1_5 Forward -364 -355 10.2261 0.0144
NP_441557.1_5 Reverse -355 -364 10.1278 0.0188
NP_441557.1_8 Forward -148 -138 13.8442 0.204
NP_441557.1_8 Reverse -109 -119 12.4676 0.236
NP_442066.2_4 Reverse -355 -374 8.75091 0.0828
NP_442183.1_1 Reverse -355 -369 5.70279 0.206
NP_441819.1_5 Reverse -167 -186 12.1748 0.247
NP_441037.1_4 Forward -366 -356 9.26684 0.225
NP_441037.1_4 Reverse -353 -363 6.92787 0.237
NP_441037.1_4 Forward -119 -109 5.95329 0.289
NP_442594.1_8 Forward -134 -115 6.88262 0.217
NP_440151.1_2 Forward -254 -236 18.2096 0.163
NP_440151.1_5 Forward -144 -125 20.944 0.0376
NP_442317.1_6 Reverse -350 -369 9.0459 0.211
NP_441633.1_3 Reverse -353 -366 5.62415 0.0481
NP_441633.1_3 Forward -366 -353 3.06754 0.0764
NP_440136.1_2 Reverse -356 -363 13.4121 0.0388
NP_440136.1_2 Forward -363 -356 6.23397 0.171
NP_442998.1_5 Reverse -303 -313 9.51814 0.238
NP_442998.1_5 Forward -167 -157 7.84651 0.28
NP_442998.1_10 Reverse -357 -364 12.5271 0.0457
NP_442998.1_10 Forward -362 -355 6.23397 0.157
NP_440899.1_8 Reverse -331 -350 -5.9004 0.231
NP_440899.1_8 Reverse -42 -61 -5.99873 0.231
NP_440299.1_1 Reverse -351 -364 3.95196 0.224
NP_441799.1_1 Forward -368 -354 12.5853 0.0421
NP_441799.1_1 Forward -310 -296 5.30886 0.214
NP_441007.1_10 Forward -369 -356 1.10092 0.209
NP_440256.1_1 Reverse -366 -385 -7.4737 0.238
NP_440256.1_1 Reverse -144 -163 -9.14533 0.275
NP_440256.1_1 Forward -367 -348 -9.53865 0.281
NP_441229.1_10 Reverse -346 -365 -0.295539 0.288
NP_442007.1_3 Forward -59 -40 13.7649 0.259
NP_440456.1_7 Forward -227 -213 9.5377 0.297
NP_441559.1_8 Reverse -292 -306 9.14437 0.067
NP_441559.1_8 Forward -383 -369 5.40779 0.0923
NP_441559.1_8 Reverse -184 -198 0.392915 0.167
NP_441559.1_8 Reverse -350 -364 -0.590395 0.178
NP_441559.1_8 Reverse -185 -199 -5.40861 0.261
NP_441559.1_8 Forward -161 -147 -6.09693 0.274
NP_441559.1_8 Reverse -351 -365 -7.17857 0.287
NP_442302.1_4 Reverse -257 -276 22.713 0.0317
NP_442302.1_9 Forward -399 -380 23.3513 0.0356
NP_440915.1_6 Reverse -351 -365 3.34284 0.103
NP_440915.1_6 Reverse -293 -307 -0.492064 0.197
NP_440915.1_6 Forward -368 -354 -3.34366 0.293
NP_440717.1_1 Reverse -356 -375 7.7676 0.265
NP_440717.1_3 Reverse -111 -125 9.6354 0.25
NP_441866.1_6 Forward -50 -31 10.9134 0.216
NP_442069.1_7 Reverse -112 -131 9.7334 0.291
NP_440134.1_2 Forward -189 -170 1.57275 0.298
NP_442866.1_1 Reverse -350 -369 2.0644 0.158
NP_441464.1_8 Forward -364 -350 6.29277 0.241
NP_441464.1_10 Forward -128 -114 9.43936 0.262
NP_440702.1_2 Reverse -233 -252 -4.13045 0.257
NP_440702.1_2 Forward -134 -115 -5.40875 0.257
NP_440787.1_2 Forward -129 -110 12.9791 0.128
NP_439985.1_10 Reverse -28 -41 17.5222 0.268
NP_442386.1_9 Forward -307 -298 6.48915 0.219
NP_442386.1_9 Reverse -354 -363 6.19416 0.23
NP_440570.1_5 Reverse -130 -149 -1.86883 0.277
NP_441750.1_4 Reverse -351 -370 3.44104 0.233
NP_441340.1_5 Forward -363 -356 6.23397 0.132
NP_441340.1_5 Reverse -356 -363 6.13563 0.175
NP_440168.1_8 Forward -384 -365 1.76941 0.284
NP_440168.1_9 Forward -366 -347 -4.03212 0.296
NP_440194.1_4 Forward -201 -182 22.3197 0.0645
NP_442240.1_1 Reverse -347 -366 3.44025 0.29
NP_441160.1_1 Reverse -134 -153 -11.7019 0.295
NP_441160.1_1 Forward -357 -338 -11.9969 0.295
NP_441134.1_6 Forward -308 -290 10.0481 0.256
NP_442251.1_6 Reverse -356 -363 11.9372 0.0749
NP_441262.1_3 Reverse -355 -362 11.5438 0.0584
NP_440027.1_3 Reverse -246 -264 3.36165 0.273
NP_443051.1_1 Forward -365 -356 8.35786 0.0371
NP_443051.1_1 Reverse -354 -363 0.589713 0.143
NP_439937.1_9 Forward -365 -348 -6.35334 0.157
NP_439937.1_9 Reverse -354 -371 -8.61494 0.176
NP_440439.1_1 Reverse -352 -365 11.229 0.0339
NP_440372.1_2 Forward -363 -356 6.62729 0.151
NP_440372.1_2 Reverse -356 -363 6.52896 0.188
NP_441789.1_7 Reverse -115 -134 -4.62285 0.284
NP_442384.1_10 Reverse -287 -300 3.46087 0.19
NP_442384.1_10 Forward -306 -293 1.88757 0.243
NP_442384.1_10 Forward -364 -351 0.510939 0.289
NP_441877.1_5 Reverse -304 -323 11.2092 0.124
NP_441018.1_7 Reverse -234 -253 10.8159 0.194
NP_442262.1_10 Reverse -356 -363 12.4288 0.0538
NP_440163.1_10 Forward -67 -57 9.61647 0.229
NP_440344.1_10 Forward -371 -354 -3.50107 0.0833
NP_440344.1_10 Reverse -348 -365 -12.9408 0.269
NP_442123.1_3 Reverse -355 -374 14.9458 0.13
NP_442065.1_5 Forward -148 -129 -2.65548 0.197
NP_442693.1_6 Reverse -123 -142 1.86774 0.278
NP_442556.1_1 Forward -174 -155 23.5006 0.0258
NP_440297.1_9 Reverse -356 -366 6.96153 0.161
NP_441896.1_3 Forward -280 -261 0.982764 0.222
NP_441896.1_5 Forward -204 -197 12.2322 0.273
NP_442078.1_3 Forward -338 -319 3.53858 0.192
NP_440999.1_9 Reverse -351 -365 0.0979218 0.193
NP_440999.1_9 Reverse -57 -71 -2.75368 0.276
NP_440888.1_2 Forward -364 -350 8.25877 0.167
NP_440888.1_2 Reverse -355 -369 8.16044 0.171
NP_440888.1_2 Forward -260 -246 7.86545 0.179
NP_440888.1_2 Forward -247 -233 7.76712 0.184
NP_440491.1_1 Reverse -287 -306 8.57379 0.236
NP_442277.1_4 Reverse -346 -365 13.6666 0.0519
NP_441543.1_2 Forward -363 -354 9.4395 0.0818
NP_441304.1_10 Forward -367 -358 13.1761 0.255
NP_441551.1_5 Reverse -351 -367 7.92432 0.241
NP_441469.1_8 Forward -365 -356 10.8161 0.195
NP_441469.1_8 Reverse -354 -363 6.78456 0.227
NP_443064.1_6 Reverse -355 -365 10.2399 0.166
NP_443064.1_6 Reverse -249 -259 9.56122 0.211
NP_440710.1_1 Reverse -347 -365 -8.24065 0.261
NP_441462.1_2 Reverse -355 -365 10.3048 0.0123
NP_441462.1_2 Forward -364 -354 1.84832 0.081
NP_441462.1_5 Forward -127 -108 7.27595 0.213
NP_441462.1_5 Forward -128 -109 3.14605 0.29
NP_441621.1_7 Forward -366 -352 4.91614 0.0934
NP_441621.1_7 Reverse -353 -367 -3.04867 0.188
NP_443062.1_6 Reverse -347 -366 9.83255 0.12
NP_440504.1_7 Reverse -189 -208 2.16274 0.238
NP_441351.1_8 Forward -357 -338 9.3409 0.178
NP_440516.1_8 Forward -364 -355 7.17789 0.0754
NP_440516.1_8 Reverse -355 -364 7.07956 0.0867
NP_442428.1_4 Reverse -296 -315 2.94938 0.247
NP_442428.1_5 Reverse -356 -363 6.43063 0.148
NP_442428.1_5 Forward -363 -356 6.13563 0.209
NP_440673.1_2 Reverse -345 -364 13.4137 0.117
NP_440673.1_2 Forward -80 -61 8.82876 0.263
NP_440673.1_2 Forward -284 -265 7.75569 0.292
NP_440673.1_3 Reverse -357 -364 9.77388 0.167
NP_441052.1_2 Forward -364 -354 1.06167 0.252
NP_441052.1_2 Reverse -355 -365 0.766681 0.256
NP_442219.1_8 Reverse -234 -253 9.71324 0.222
NP_440436.1_4 Reverse -356 -365 12.684 0.034
NP_440436.1_4 Forward -363 -354 8.65242 0.0997
NP_441884.1_9 Forward -367 -348 4.52268 0.0236
NP_441884.1_9 Reverse -352 -371 -22.42 0.278
NP_442864.1_3 Reverse -363 -382 9.63589 0.195
NP_440314.1_9 Reverse -62 -81 5.30933 0.0722
NP_439982.1_8 Reverse -295 -314 13.6675 0.244
NP_442907.1_9 Reverse -245 -264 2.26107 0.174
NP_442907.1_9 Reverse -118 -137 1.37609 0.189
NP_441719.1_4 Forward -363 -356 6.62729 0.151
NP_441719.1_4 Reverse -356 -363 6.52896 0.188
NP_441733.1_10 Forward -367 -354 9.65572 0.112
NP_441004.1_1 Forward -132 -113 -14.0619 0.263
NP_441004.1_2 Reverse -131 -150 -1.96717 0.263
NP_442813.1_4 Reverse -333 -352 -7.96535 0.299
NP_442813.1_5 Forward -264 -245 3.34271 0.27
NP_442366.1_3 Reverse -354 -372 -5.19239 0.284
NP_441115.1_4 Reverse -354 -372 11.3264 0.145
NP_440094.1_7 Reverse -324 -343 9.53756 0.208
NP_440728.1_9 Forward -109 -91 15.4599 0.294
NP_443054.1_2 Reverse -353 -367 9.34103 0.0995
NP_443054.1_2 Forward -366 -352 5.60446 0.227
NP_443054.1_2 Reverse -260 -274 0.0979218 0.278
NP_441851.1_10 Reverse -354 -364 14.3364 0.0179
NP_441851.1_10 Forward -365 -355 7.74818 0.132
NP_442208.1_5 Reverse -236 -255 -7.96535 0.275
NP_441555.1_2 Forward -191 -172 16.1855 0.188
NP_441542.1_4 Reverse -173 -187 11.996 0.239
NP_442515.1_1 Forward -365 -351 1.67122 0.152
NP_442515.1_1 Reverse -354 -368 -2.95034 0.284
NP_440593.1_3 Forward -258 -239 -6.78538 0.28
NP_441982.1_6 Forward -181 -172 14.3952 0.274
NP_441982.1_6 Reverse -302 -311 13.5358 0.274
NP_442709.1_3 Forward -313 -294 2.85105 0.288
NP_441046.1_2 Forward -317 -298 3.34271 0.235
NP_441046.1_2 Forward -177 -158 3.34271 0.235
NP_441409.1_8 Forward -21 -2 9.90869 0.229
NP_440432.1_9 Reverse -356 -371 8.63302 0.0427
NP_440474.1_8 Forward -363 -349 12.8803 0.0782
NP_441124.1_5 Forward -180 -170 10.6209 0.286
NP_440588.1_2 Reverse -138 -157 -4.91709 0.233
NP_440195.1_5 Forward -370 -351 0.294447 0.299
NP_440943.1_5 Forward -288 -274 15.8309 0.22
NP_442006.1_2 Forward -126 -109 -15.7924 0.228
NP_442006.1_2 Reverse -346 -363 -16.2841 0.247
NP_442038.1_1 Forward -185 -166 -0.295539 0.278
NP_441570.1_1 Forward -364 -346 -16.2055 0.24
NP_441078.1_4 Forward -364 -355 10.4228 0.0105
NP_441078.1_4 Reverse -355 -364 10.3245 0.0119
NP_441078.1_4 Reverse -297 -306 -1.86856 0.272
NP_440539.1_9 Forward -338 -319 -2.45882 0.286
NP_440526.1_3 Reverse -356 -367 10.8746 0.0646
NP_440526.1_3 Forward -363 -352 0.54986 0.275
NP_441432.1_8 Forward -365 -356 9.34117 0.0755
NP_441432.1_8 Forward -379 -370 5.40793 0.158
NP_441432.1_8 Forward -71 -62 3.24465 0.252
NP_441432.1_8 Reverse -237 -246 3.04799 0.268
NP_441432.1_9 Reverse -19 -32 10.0527 0.256
NP_442320.1_8 Forward -370 -356 -4.4253 0.168
NP_442320.1_9 Forward -136 -122 20.6491 0.0889
NP_442320.1_9 Forward -74 -60 15.4376 0.246
NP_441732.1_2 Reverse -365 -381 -16.3627 0.165
NP_440629.1_4 Reverse -293 -312 17.0107 0.134
NP_440290.1_1 Reverse -176 -185 17.3727 0.21
NP_442157.1_9 Reverse -116 -135 17.2074 0.209
NP_440760.1_1 Reverse -297 -316 -23.4033 0.297
NP_441057.1_3 Reverse -18 -37 -12.9802 0.265
NP_442010.1_9 Reverse -107 -121 16.2235 0.175
NP_442489.1_7 Reverse -355 -364 17.601 0.00221
NP_442489.1_7 Forward -364 -355 10.4228 0.0151
NP_442489.1_7 Reverse -297 -306 -1.37691 0.195
NP_442489.1_7 Reverse -369 -378 -1.57357 0.213
NP_441706.1_1 Reverse -12 -31 -2.36049 0.24
NP_441706.1_10 Reverse -55 -74 7.27595 0.292
NP_440559.1_1 Reverse -356 -365 7.47288 0.108
NP_440559.1_1 Forward -363 -354 5.50626 0.14
NP_441659.2_8 Reverse -355 -365 9.51814 0.0293
NP_441659.2_8 Forward -364 -354 2.53664 0.198
NP_441659.2_8 Forward -247 -237 0.176696 0.271
NP_441022.1_1 Reverse -306 -315 13.7524 0.188
NP_440779.1_5 Reverse -355 -372 3.87375 0.0577
NP_440779.1_5 Forward -364 -347 -14.4158 0.246
NP_442346.1_5 Forward -365 -355 15.2213 0.00761
NP_442346.1_10 Forward -366 -347 6.09597 0.168
NP_440545.1_3 Forward -368 -351 5.64371 0.0607
NP_440545.1_3 Reverse -351 -368 -6.15601 0.27
NP_440545.1_3 Reverse -365 -382 -7.04099 0.295
NP_440545.1_5 Forward -264 -247 9.28195 0.21
NP_441856.1_7 Forward -138 -119 11.7992 0.246
NP_440486.1_9 Reverse -130 -144 12.7826 0.274
NP_440459.1_2 Reverse -236 -253 10.7569 0.192
NP_442311.1_5 Reverse -209 -228 6.09597 0.245
NP_441585.1_5 Forward -323 -304 4.03023 0.25
NP_441888.1_7 Reverse -350 -364 2.45787 0.225
NP_441888.1_7 Forward -383 -369 2.16287 0.225
NP_440449.1_6 Forward -266 -248 8.74215 0.194
NP_441948.1_4 Forward -371 -353 5.23069 0.0803
NP_441833.1_4 Forward -363 -356 6.23397 0.163
NP_441833.1_4 Reverse -356 -363 6.13563 0.198
NP_441329.1_3 Forward -182 -172 14.5211 0.253
NP_441329.1_3 Forward -39 -29 12.3037 0.273
NP_441329.1_6 Forward -25 -6 3.67602 0.212
NP_441112.1_6 Forward -374 -355 0.0977854 0.279
NP_442162.1_9 Reverse -356 -363 12.6255 0.0393
NP_442162.1_9 Forward -363 -356 6.52896 0.178
NP_442199.1_7 Forward -321 -302 4.22689 0.245
NP_442140.1_3 Forward -363 -353 7.84651 0.126
NP_442140.1_3 Reverse -356 -366 5.68323 0.198
NP_441609.1_1 Reverse -39 -58 -2.45882 0.29
NP_441671.1_10 Forward -205 -186 2.3594 0.255
NP_440875.1_9 Forward -362 -352 11.2921 0.175
NP_441813.1_3 Forward -340 -321 14.0434 0.255
NP_441813.1_5 Reverse -353 -363 0.176696 0.215
NP_441813.1_5 Forward -366 -356 -0.806614 0.285
NP_440590.1_4 Forward -363 -350 -4.60227 0.263
NP_440567.1_1 Forward -363 -349 10.4227 0.0365
NP_440567.1_1 Reverse -356 -370 -0.0987402 0.264
NP_442497.1_10 Reverse -356 -365 10.0295 0.0222
NP_442497.1_10 Forward -363 -354 0.688044 0.141
NP_440821.1_4 Forward -366 -356 9.81313 0.0246
NP_440821.1_4 Reverse -353 -363 8.92815 0.0382
NP_440227.1_2 Forward -45 -29 12.2516 0.271
NP_441239.1_9 Forward -366 -354 15.1819 0.0229
NP_441239.1_9 Reverse -353 -365 10.5604 0.076
NP_441892.1_1 Forward -373 -356 2.30045 0.141
NP_440665.1_2 Reverse -362 -381 -4.32711 0.246
NP_440219.1_7 Forward -212 -193 15.3391 0.226
NP_440833.1_6 Forward -34 -20 11.602 0.218
NP_442138.1_9 Reverse -244 -263 8.55343 0.262
NP_442052.1_8 Reverse -243 -253 13.353 0.253
NP_440462.1_6 Reverse -353 -363 8.1415 0.0699
NP_442340.1_3 Forward -362 -343 -1.47551 0.188
NP_440868.1_4 Reverse -351 -363 9.77374 0.043
NP_441249.1_8 Forward -126 -107 9.24257 0.177
NP_442479.1_8 Forward -132 -113 5.60432 0.257
NP_442479.1_9 Forward -282 -263 -4.32711 0.252
NP_442479.1_9 Reverse -168 -187 -6.78538 0.266
NP_441582.1_5 Forward -366 -347 6.98015 0.19
NP_441848.1_7 Reverse -105 -124 -1.47628 0.251
NP_441084.1_6 Reverse -132 -146 10.2167 0.25
NP_440696.1_6 Forward -137 -118 3.24438 0.288
NP_440843.1_4 Reverse -303 -322 11.5042 0.23
NP_442039.1_4 Reverse -356 -363 14.3954 0.0271
NP_441180.1_2 Reverse -34 -53 11.9358 0.287
NP_441926.1_3 Forward -156 -140 8.515 0.17
NP_442837.1_3 Forward -363 -356 6.0373 0.25
NP_442837.1_3 Reverse -356 -363 5.93897 0.265
NP_440160.1_2 Reverse -244 -263 -7.57203 0.286
NP_442053.1_1 Forward -364 -355 8.65285 0.0741
NP_442053.1_1 Reverse -355 -364 8.55452 0.0784
NP_440505.1_3 Reverse -353 -363 11.0914 0.0877
NP_440505.1_3 Forward -366 -356 6.17489 0.192
NP_440351.1_8 Reverse -287 -305 4.9357 0.294
NP_440520.1_1 Forward -134 -115 -2.95047 0.208
NP_441252.1_6 Reverse -301 -308 14.3954 0.168
NP_441203.1_2 Forward -97 -78 -5.60541 0.265
NP_442532.1_4 Forward -56 -38 15.4307 0.168
NP_440914.1_1 Forward -364 -354 6.66328 0.269
NP_441011.1_8 Forward -363 -354 7.37455 0.172
NP_442533.1_1 Forward -123 -104 -17.8968 0.297
NP_442533.1_6 Forward -364 -355 8.65285 0.0727
NP_442533.1_6 Reverse -355 -364 7.96454 0.0838
NP_442533.1_6 Forward -306 -297 5.3096 0.145
NP_442533.1_6 Forward -259 -250 2.16301 0.27
NP_440263.1_5 Reverse -172 -186 7.17775 0.294
NP_442232.1_3 Forward -372 -353 -14.4552 0.288
NP_442322.1_4 Reverse -108 -125 -10.0899 0.298
NP_441219.1_6 Reverse -345 -363 9.16393 0.276
NP_441482.1_7 Reverse -256 -270 -5.11362 0.172
NP_442293.1_4 Reverse -293 -311 10.3439 0.226
NP_439944.1_9 Reverse -356 -366 7.84651 0.127
NP_441028.1_6 Reverse -111 -121 6.27276 0.23
NP_442202.1_10 Forward -365 -351 4.71948 0.255
NP_441527.1_4 Forward -24 -5 -4.82277 0.189
NP_441527.1_4 Forward -22 -3 -11.7937 0.284
NP_440115.1_6 Forward -367 -357 8.04317 0.144
NP_440007.1_9 Reverse -186 -200 0.982901 0.29
NP_442728.1_10 Reverse -320 -339 13.4708 0.258
NP_439965.1_5 Forward -205 -186 7.96345 0.299
NP_441602.1_3 Reverse -350 -369 -4.13045 0.261
NP_441106.1_1 Reverse -354 -363 8.55452 0.0538
NP_442249.1_10 Forward -367 -348 7.96426 0.288
NP_440302.1_4 Reverse -245 -264 15.0441 0.283
NP_442306.1_10 Reverse -350 -369 -21.0434 0.242
NP_441286.1_1 Reverse -354 -366 4.8572 0.0272
NP_441286.1_1 Forward -365 -353 -4.38592 0.156
NP_442674.1_1 Reverse -187 -206 11.3381 0.251
NP_440670.1_8 Reverse -355 -364 15.1427 0.00768
NP_440670.1_8 Forward -364 -355 8.65285 0.0627
NP_440670.1_8 Forward -271 -262 3.24465 0.29
NP_440886.1_7 Reverse -354 -364 7.94438 0.0805
NP_440886.1_7 Forward -365 -355 5.48612 0.181
NP_440886.1_10 Reverse -284 -303 8.75009 0.248
NP_442072.1_9 Forward -365 -347 -21.8103 0.212
NP_442401.1_4 Reverse -157 -167 15.7134 0.263
NP_440907.2_8 Reverse -356 -366 9.616 0.103
NP_440907.2_8 Forward -363 -353 7.94438 0.117
NP_441463.1_3 Reverse -345 -364 -3.93378 0.189
NP_442842.1_10 Reverse -4 -23 7.06668 0.207
NP_441626.1_2 Reverse -356 -363 6.43063 0.147
NP_441626.1_2 Forward -363 -356 6.0373 0.212
NP_442365.1_5 Forward -363 -344 7.07928 0.257
NP_442362.1_7 Reverse -131 -149 10.7372 0.277
NP_442209.1_4 Reverse -316 -335 6.58763 0.299
NP_442615.1_1 Forward -373 -355 1.59244 0.0829
NP_442467.1_4 Reverse -129 -148 5.89931 0.287
NP_441962.1_4 Forward -369 -350 -9.63698 0.218
NP_441962.1_4 Forward -252 -233 -12.3902 0.256
NP_440387.1_1 Forward -364 -348 6.74504 0.0282
NP_440855.1_5 Forward -262 -243 3.63691 0.287
NP_441431.1_2 Reverse -352 -366 15.6336 0.045
NP_441431.1_2 Reverse -294 -308 6.0955 0.28
NP_441836.1_2 Reverse -232 -251 3.53937 0.151
NP_441836.1_2 Reverse -55 -74 -3.04881 0.233
NP_441836.1_2 Reverse -291 -310 -6.58872 0.3
NP_441193.1_1 Forward -319 -300 9.43841 0.277
NP_441993.1_1 Forward -132 -113 1.4594 0.276
NP_442084.1_6 Forward -100 -82 4.34571 0.298
NP_440143.1_1 Reverse -235 -254 12.9791 0.284
NP_442352.1_1 Forward -244 -231 13.9033 0.281
NP_440114.1_10 Reverse -355 -369 14.5526 0.0382
NP_440114.1_10 Forward -364 -350 10.1277 0.153
NP_441858.1_2 Forward -166 -147 11.3036 0.258
NP_440293.1_3 Reverse -362 -381 -5.50708 0.279
NP_440766.1_5 Reverse -301 -313 19.3058 0.0617
NP_439988.1_4 Reverse -255 -274 19.5673 0.125
NP_439988.1_7 Forward -362 -348 11.7987 0.292
NP_441237.1_6 Forward -132 -115 10.3636 0.127
NP_441237.1_9 Reverse -356 -366 14.4347 0.0376
NP_442743.1_1 Reverse -114 -133 10.2251 0.242
NP_442743.1_1 Reverse -113 -132 5.30853 0.278
NP_442743.1_1 Forward -46 -27 4.71854 0.288
NP_440502.1_3 Forward -147 -137 13.7899 0.292
NP_440457.1_1 Reverse -293 -305 0.530633 0.25
NP_440457.1_1 Reverse -351 -363 0.137309 0.25
NP_440798.1_6 Forward -363 -350 2.87088 0.159
NP_440798.1_6 Reverse -356 -369 1.88757 0.192
NP_440142.1_7 Reverse -246 -265 10.2259 0.203
NP_442297.1_4 Reverse -365 -384 14.0859 0.214
NP_441332.1_6 Reverse -60 -70 11.5499 0.254
NP_441436.1_8 Reverse -237 -256 16.5191 0.215
NP_442509.1_9 Forward -364 -354 13.1559 0.061
NP_442509.1_9 Reverse -355 -365 7.55106 0.214
NP_441489.1_3 Forward -184 -170 16.2452 0.172
NP_442784.1_8 Reverse -118 -137 15.1416 0.222
NP_442514.1_5 Reverse -106 -125 -8.75273 0.29
NP_440554.1_4 Forward -363 -353 4.40493 0.19
NP_442862.1_3 Forward -185 -168 9.18362 0.231
NP_442862.1_3 Reverse -28 -45 8.49531 0.241
NP_441885.1_5 Forward -364 -354 2.33998 0.0799
NP_441885.1_5 Reverse -355 -365 1.55333 0.109
NP_441885.1_5 Reverse -297 -307 -0.609952 0.215
NP_442341.1_7 Forward -365 -351 8.06273 0.0947
NP_442341.1_7 Reverse -243 -257 1.17956 0.297
NP_441173.1_9 Forward -310 -302 12.1137 0.21
NP_440191.1_4 Reverse -312 -322 13.8268 0.282
NP_440076.1_9 Reverse -250 -263 18.0132 0.166
NP_442513.1_6 Reverse -341 -360 6.1935 0.296
NP_441561.1_4 Reverse -330 -349 11.5042 0.169
NP_441842.1_10 Reverse -348 -362 15.2409 0.0465
NP_441842.1_10 Forward -371 -357 8.45605 0.221
NP_440275.1_3 Forward -366 -356 9.81313 0.0507
NP_440275.1_3 Reverse -353 -363 8.1415 0.0602
NP_440091.1_1 Reverse -351 -363 9.77374 0.0549
NP_440091.1_1 Forward -368 -356 1.12062 0.212
NP_441902.1_3 Reverse -301 -311 13.7591 0.226
NP_440679.1_10 Reverse -348 -367 -20.4534 0.284
NP_443010.1_10 Reverse -352 -369 8.08565 0.164
NP_443010.1_10 Forward -367 -350 3.44723 0.253
NP_442451.1_2 Reverse -347 -366 -8.16202 0.241
NP_439962.1_4 Reverse -347 -366 -8.26035 0.292
NP_440175.1_7 Forward -142 -124 9.16793 0.28
NP_442495.1_3 Forward -131 -113 10.6389 0.282
NP_442495.1_4 Forward -267 -257 14.6313 0.16
NP_441875.1_3 Reverse -122 -141 16.2232 0.252
NP_440216.1_1 Reverse -355 -369 6.29277 0.0156
NP_440216.1_1 Forward -364 -350 -1.8687 0.0412
NP_440216.1_1 Forward -306 -292 -4.7203 0.114
NP_440216.1_9 Forward -353 -344 11.7994 0.254
NP_440216.1_9 Reverse -90 -99 6.68623 0.289
NP_440172.1_1 Reverse -355 -365 13.2547 0.0215
NP_440172.1_1 Forward -364 -354 5.48657 0.143
NP_440172.1_1 Forward -198 -188 4.3066 0.194
NP_440172.1_1 Forward -47 -37 2.04498 0.286
NP_441226.1_7 Forward -305 -298 8.29857 0.205
NP_441226.1_7 Forward -363 -356 5.64364 0.286
NP_441111.1_7 Forward -363 -355 8.96754 0.0463
NP_441111.1_7 Reverse -356 -364 8.86921 0.0589
NP_442379.1_10 Reverse -348 -365 -2.51776 0.233
NP_440244.1_1 Reverse -242 -261 -9.93197 0.298
NP_441766.1_2 Forward -364 -355 7.76787 0.0714
NP_441766.1_2 Reverse -355 -364 7.66954 0.0723
NP_440416.1_9 Forward -205 -186 -12.6852 0.159
NP_440416.1_9 Reverse -362 -381 -17.1101 0.231
NP_443052.1_8 Forward -374 -355 -0.688862 0.0723
NP_443052.1_8 Reverse -345 -364 -7.08038 0.152
NP_443052.1_9 Reverse -110 -129 1.27776 0.186
NP_443052.1_9 Reverse -116 -135 -1.96717 0.231
NP_442116.1_6 Forward -44 -27 17.3362 0.0883
NP_441940.1_1 Reverse -119 -138 10.2251 0.229
NP_440885.1_6 Reverse -211 -230 7.69133 0.227
NP_442154.1_1 Forward -78 -60 -16.7954 0.245
NP_442564.1_10 Reverse -115 -129 9.43936 0.296
NP_440261.1_5 Reverse -356 -369 -0.865694 0.0655
NP_440261.1_5 Forward -363 -350 -12.4687 0.297
NP_440988.1_10 Forward -249 -235 7.60958 0.216
NP_440988.1_10 Reverse -236 -250 5.38289 0.243
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GGTGGATTTTAATCAATACGCAGGCATTCTCCAAGGGGCAATCGCCGCCCTGGAAAGTCCACCGGAAACTGTGCAACAAACCGTGCAAATTTTTGCCCAACGCCGGGCAACATTGATTGATGCTTTAGCGAAGATTGGCTGGGCTGTGCCTCTGCCCACTGCCACCATGTATGTTTGGGCACCATTACCTGAAAGTTGGCTTGGCAATTCCTTGGAATTTTGTCAAAAACTGGTGGCTAAAACCGGTGTTGCCCTTTCTCCAGGGTCTGGCTTTGGTGCAGGGGGGGAAGGTTATGTACGTTTTGCCTTAGTACAGGAGCCGGATATTTTGGCTACGGCGGCCAAAAAAATCGGTCAATTTCTTGACCAAAACTAGACTAAAAGGCAAAGGAATAAAACT

CDS

ATGGAAATTTTGGATCATTATCTGGGCAATTTAGTCAGCATTACCAGGTTTGTGCTGGAAAGTGTTTCCGTGCTGTGTATTATTCTCGGGCTAGTGAAAACTTTGCAAATGGTCTGGGCTGGCGATCGCCGTACTATGAATACGCCCAAATTTTTCAACAGTATTCGCTTGCAATTCGGTTTGTGGTTGGCTCTAGCCCTGGAATTCCAATTGGGGGCAGATATCCTTTCCACCACCATCGCCCCTACCCTAGAAAGCTTGAGCAAACTAGGGCTAATCGCTGTAATCAGGACTTTTTTAAACTATTTTCTTGGTAAAGAACTGGAATCGGAAATCAGAATGGAAATTGAACAGGAAAGACAGGAACATGGCCGTTAA

Protein

MEILDHYLGNLVSITRFVLESVSVLCIILGLVKTLQMVWAGDRRTMNTPKFFNSIRLQFGLWLALALEFQLGADILSTTIAPTLESLSKLGLIAVIRTFLNYFLGKELESEIRMEIEQERQEHGR