Your browser is old and dusty. Try Google Chrome!

Details for sll0934

ORF sll0934
Accession NP_440200.1
Symbol ccmA
Category CO2 fixation
Definition carboxysome formation protein CcmA
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -199 -213 12.291 0.048
NP_440557.1_1 Reverse -205 -224 4.03102 0.192
NP_440795.1_7 Forward -335 -328 8.8889 0.188
NP_441418.1_6 Reverse -198 -217 -29.2048 0.219
NP_442657.1_1 Forward -116 -99 15.7128 0.165
NP_442291.1_5 Reverse -197 -213 10.9733 0.0409
NP_441453.1_4 Reverse -198 -206 7.29591 0.0589
NP_441453.1_4 Forward -207 -199 6.70593 0.121
NP_442151.1_6 Forward -349 -335 5.70279 0.266
NP_442838.1_7 Reverse -239 -258 -11.0136 0.263
NP_441818.1_1 Reverse -199 -210 9.30127 0.246
NP_440226.1_1 Forward -207 -188 10.6192 0.061
NP_441630.1_2 Forward -24 -5 14.4541 0.206
NP_440259.1_4 Forward -333 -319 13.5526 0.226
NP_441098.1_3 Reverse -100 -119 -4.39637 0.28
NP_440348.1_6 Reverse -211 -230 12.6841 0.103
NP_440150.1_2 Reverse -200 -219 9.43841 0.217
NP_442173.1_1 Forward -206 -198 7.59091 0.163
NP_442173.1_1 Reverse -199 -207 5.82095 0.2
NP_001035873.1_8 Reverse -245 -264 8.35759 0.224
NP_442752.1_3 Reverse -355 -365 14.9838 0.288
NP_442752.1_4 Forward -207 -200 13.8055 0.0199
NP_443027.1_4 Forward -209 -199 10.2065 0.138
NP_443027.1_4 Reverse -242 -252 8.73149 0.191
NP_442975.1_10 Reverse -194 -208 7.86545 0.116
NP_442975.1_10 Forward -340 -326 4.42388 0.245
NP_440784.1_7 Reverse -199 -206 6.23397 0.241
NP_440784.1_7 Forward -206 -199 6.13563 0.241
NP_440061.1_9 Forward -289 -275 7.07881 0.219
NP_441145.1_7 Forward -161 -142 5.50599 0.22
NP_442062.1_3 Reverse -144 -163 -1.08219 0.255
NP_442062.1_3 Reverse -164 -183 -2.26216 0.269
NP_442062.1_8 Forward -207 -197 9.61647 0.0587
NP_442062.1_8 Reverse -198 -208 5.19158 0.181
NP_442972.1_1 Forward -116 -98 6.8091 0.291
NP_440304.1_4 Forward -215 -205 5.28991 0.218
NP_442242.1_4 Forward -206 -199 12.4288 0.0393
NP_440044.1_8 Forward -335 -316 3.34271 0.132
NP_441781.1_7 Reverse -198 -217 -0.885524 0.267
NP_441208.1_9 Forward -279 -265 5.50613 0.267
NP_442110.1_7 Reverse -198 -212 1.76955 0.222
NP_442110.1_7 Forward -99 -85 0.982901 0.241
NP_441925.1_4 Reverse -366 -385 -15.8325 0.274
NP_441925.1_4 Reverse -278 -297 -16.8158 0.285
NP_441083.1_5 Reverse -198 -208 1.84832 0.198
NP_441738.1_2 Reverse -200 -207 15.28 0.0102
NP_440209.1_1 Forward -207 -199 14.8674 0.012
NP_440655.1_2 Forward -330 -311 3.24438 0.293
NP_442889.1_1 Reverse -222 -241 -6.49039 0.191
NP_442889.1_8 Reverse -324 -338 3.24392 0.284
NP_440056.1_9 Reverse -212 -231 15.0437 0.272
NP_441713.1_1 Forward -244 -225 -12.6852 0.248
NP_441783.1_3 Reverse -143 -162 11.4058 0.219
NP_442570.1_3 Forward -300 -281 -5.60541 0.246
NP_442570.1_3 Forward -295 -276 -6.39206 0.257
NP_442570.1_3 Reverse -202 -221 -6.49039 0.258
NP_440538.1_10 Reverse -331 -350 15.5357 0.179
NP_441716.1_2 Reverse -100 -119 -0.759618 0.277
NP_441163.1_1 Forward -221 -204 12.9194 0.183
NP_440343.1_9 Reverse -17 -36 9.43923 0.251
NP_440851.1_3 Reverse -162 -181 1.57275 0.285
NP_440906.1_5 Forward -206 -199 12.0355 0.0724
NP_440906.1_5 Reverse -199 -206 12.0355 0.0724
NP_440747.1_10 Forward -210 -198 -12.1541 0.227
NP_440747.1_10 Forward -290 -278 -12.2524 0.254
NP_441486.1_1 Forward -210 -196 13.3726 0.00871
NP_441486.1_1 Reverse -195 -209 0.589577 0.132
NP_441880.2_10 Reverse -270 -288 7.88563 0.288
NP_440944.1_2 Forward -219 -200 -1.37718 0.259
NP_440842.1_4 Reverse -163 -182 5.66585 0.154
NP_440842.1_10 Forward -240 -226 3.8345 0.254
NP_441014.1_5 Forward -218 -200 11.0322 0.261
NP_442848.1_1 Forward -213 -199 6.19444 0.0799
NP_442848.1_4 Reverse -227 -241 5.40779 0.296
NP_442848.1_5 Forward -221 -203 -3.42244 0.291
NP_441012.1_4 Forward -211 -198 5.72248 0.291
NP_443018.1_3 Forward -206 -199 5.34899 0.212
NP_443018.1_3 Reverse -199 -206 5.34899 0.212
NP_443018.1_3 Reverse -328 -335 4.56234 0.241
NP_443018.1_3 Forward -335 -328 4.46401 0.244
NP_443018.1_3 Reverse -245 -252 4.26735 0.267
NP_443018.1_3 Forward -252 -245 4.07068 0.299
NP_441634.1_8 Forward -289 -275 -4.62196 0.295
NP_440376.1_1 Forward -287 -278 4.42462 0.159
NP_440376.1_1 Reverse -229 -238 0.786375 0.26
NP_440376.1_1 Reverse -198 -207 -0.000272808 0.285
NP_440376.1_1 Forward -207 -198 -0.0986038 0.285
NP_441588.1_4 Reverse -200 -210 8.63316 0.14
NP_441588.1_4 Forward -205 -195 5.09324 0.297
NP_442687.1_7 Forward -208 -198 6.37155 0.171
NP_441077.1_2 Reverse -163 -182 4.24897 0.228
NP_441763.1_10 Forward -218 -199 5.60352 0.284
NP_442658.1_1 Reverse -196 -206 11.6809 0.0768
NP_442658.1_1 Forward -215 -205 9.02601 0.169
NP_440141.1_9 Forward -365 -346 1.27776 0.27
NP_440656.1_8 Reverse -316 -335 -7.67036 0.262
NP_441414.1_9 Forward -287 -268 -5.70374 0.178
NP_441414.1_9 Forward -207 -188 -8.752 0.245
NP_441256.1_8 Reverse -37 -56 2.0644 0.285
NP_442937.1_5 Forward -390 -371 7.57094 0.248
NP_442321.1_4 Reverse -291 -310 -1.47551 0.27
NP_441958.1_5 Forward -208 -198 1.455 0.0956
NP_439990.1_5 Forward -212 -199 7.98409 0.183
NP_442690.1_1 Forward -118 -99 -10.522 0.215
NP_442690.1_1 Forward -179 -160 -13.5702 0.264
NP_442911.1_2 Reverse -188 -207 -11.1119 0.299
NP_440200.1_1 Forward -323 -304 29.7937 0.000534
NP_440200.1_2 Forward -344 -325 32.9403 0.0000117
NP_440200.1_3 Forward -366 -347 26.4505 0.00547
NP_440200.1_4 Forward -289 -270 22.3206 0.06
NP_440200.1_5 Forward -257 -238 23.6972 0.0114
NP_440200.1_8 Forward -387 -368 23.3039 0.0386
NP_441429.1_4 Forward -239 -220 13.6666 0.158
NP_442002.1_9 Reverse -133 -140 11.3472 0.185
NP_441938.1_3 Reverse -202 -221 17.7974 0.0918
NP_441000.1_6 Forward -254 -240 -5.31028 0.273
NP_440147.1_4 Reverse -196 -209 0.805932 0.244
NP_441916.1_7 Forward -207 -197 6.56821 0.0919
NP_441916.1_7 Reverse -198 -208 1.455 0.285
NP_441916.1_10 Forward -215 -196 3.04771 0.236
NP_440345.1_5 Forward -55 -41 15.2889 0.269
NP_441041.1_4 Reverse -198 -217 -12.2919 0.262
NP_441041.1_4 Forward -219 -200 -13.0786 0.28
NP_441041.1_7 Reverse -266 -278 8.58373 0.133
NP_441041.1_7 Reverse -195 -207 4.79381 0.295
NP_440703.1_9 Reverse -334 -347 7.59019 0.254
NP_441725.1_5 Reverse -205 -215 7.05986 0.106
NP_441725.1_5 Reverse -199 -209 1.55333 0.133
NP_439966.1_7 Reverse -276 -286 8.3377 0.14
NP_439966.1_7 Forward -209 -199 5.97777 0.199
NP_442941.1_3 Reverse -199 -209 10.2065 0.0213
NP_440260.1_8 Reverse -201 -219 5.72234 0.154
NP_442281.1_1 Forward -212 -198 3.93223 0.213
NP_441079.1_7 Forward -118 -99 -1.96793 0.212
NP_440395.1_9 Forward -222 -203 16.1257 0.263
NP_442012.1_2 Forward -209 -190 3.53937 0.238
NP_441556.1_10 Reverse -223 -237 12.3632 0.195
NP_440498.1_1 Reverse -367 -385 -3.12744 0.256
NP_443030.1_4 Reverse -120 -139 -2.16383 0.241
NP_441644.1_6 Reverse -198 -208 6.17443 0.165
NP_441644.1_6 Reverse -244 -254 4.89613 0.22
NP_441644.1_6 Forward -336 -326 3.12618 0.297
NP_442215.1_2 Reverse -196 -212 -4.26803 0.23
NP_442215.1_2 Reverse -202 -218 -4.56302 0.235
NP_442215.1_2 Forward -222 -206 -6.23465 0.266
NP_442933.1_10 Forward -207 -198 13.9627 0.0192
NP_442933.1_10 Reverse -198 -207 8.1612 0.0885
NP_441751.2_8 Reverse -199 -213 5.99778 0.0404
NP_442554.1_8 Reverse -199 -209 6.17489 0.125
NP_442554.1_8 Forward -335 -325 3.32329 0.23
NP_441762.1_7 Reverse -197 -209 -5.66422 0.228
NP_441762.1_7 Forward -208 -196 -7.13918 0.285
NP_442142.1_4 Forward -210 -197 5.42692 0.192
NP_442292.1_1 Reverse -199 -208 8.75118 0.0306
NP_440919.1_7 Reverse -271 -289 7.66829 0.223
NP_441024.1_7 Forward -332 -314 10.9331 0.262
NP_443009.1_5 Forward -208 -197 7.43299 0.129
NP_443009.1_5 Forward -254 -243 4.8764 0.226
NP_441865.1_3 Reverse -102 -120 18.8004 0.0883
NP_441715.1_4 Reverse -199 -209 5.09324 0.233
NP_441448.1_1 Reverse -311 -330 5.30933 0.261
NP_440158.1_1 Reverse -165 -184 13.9891 0.137
NP_440183.1_1 Reverse -199 -218 5.80098 0.278
NP_440464.1_10 Forward -273 -263 11.9577 0.273
NP_441468.1_1 Forward -286 -279 6.72562 0.126
NP_441468.1_1 Reverse -199 -206 6.13563 0.209
NP_441468.1_1 Forward -206 -199 6.0373 0.223
NP_441468.1_1 Reverse -245 -252 3.97235 0.277
NP_441468.1_1 Forward -335 -328 3.97235 0.277
NP_441015.1_10 Forward -296 -277 -3.14714 0.185
NP_441673.1_1 Reverse -198 -207 1.37636 0.114
NP_441673.1_1 Forward -207 -198 1.1797 0.163
NP_441826.1_2 Forward -213 -199 12.1926 0.0298
NP_441826.1_2 Reverse -198 -212 4.03116 0.105
NP_441826.1_2 Forward -219 -205 -4.03198 0.291
NP_441764.1_1 Forward -180 -161 13.9625 0.116
NP_441764.1_1 Reverse -154 -173 11.9958 0.162
NP_441764.1_4 Reverse -161 -178 9.98168 0.271
NP_442868.1_6 Forward -239 -229 1.16001 0.205
NP_442868.1_6 Forward -209 -199 0.0783647 0.248
NP_442719.1_2 Forward -336 -318 -10.5029 0.276
NP_442719.1_2 Reverse -260 -278 -10.6996 0.28
NP_442361.1_3 Forward -213 -200 8.08242 0.285
NP_442808.1_1 Reverse -197 -207 8.63269 0.0481
NP_442808.1_1 Reverse -277 -287 4.40448 0.199
NP_442808.1_1 Forward -239 -229 2.92952 0.252
NP_442542.1_2 Forward -215 -202 4.73917 0.298
NP_442542.1_9 Reverse -237 -251 9.53707 0.134
NP_442050.1_5 Forward -209 -199 6.66608 0.286
NP_441114.1_3 Forward -236 -227 7.57121 0.231
NP_440558.1_2 Reverse -225 -244 -6.78538 0.28
NP_441878.1_6 Forward -288 -278 0.963343 0.128
NP_441878.1_6 Forward -350 -340 -7.19813 0.21
NP_441878.1_6 Reverse -228 -238 -7.29646 0.217
NP_441878.1_6 Forward -214 -204 -7.39479 0.222
NP_441036.1_8 Reverse -197 -207 15.9097 0.00724
NP_441557.1_5 Forward -207 -198 8.84951 0.0343
NP_441557.1_5 Reverse -198 -207 0.786375 0.106
NP_441557.1_8 Reverse -279 -289 13.8442 0.204
NP_441590.1_4 Reverse -343 -362 3.24359 0.29
NP_441739.1_2 Forward -277 -261 1.82783 0.294
NP_440101.1_3 Reverse -217 -236 3.04771 0.239
NP_442830.1_5 Reverse -276 -290 4.52221 0.239
NP_441564.1_10 Forward -234 -215 2.16274 0.287
NP_442183.1_1 Reverse -198 -212 7.07942 0.149
NP_442183.1_1 Forward -336 -322 4.03116 0.282
NP_442397.1_9 Reverse -198 -217 11.5042 0.244
NP_439980.1_4 Forward -242 -223 17.5024 0.0903
NP_442347.1_2 Reverse -199 -208 3.93297 0.284
NP_442347.1_10 Reverse -349 -363 16.5185 0.182
NP_442645.1_2 Forward -215 -196 -18.2901 0.27
NP_442888.1_9 Reverse -198 -217 15.9291 0.179
NP_440136.1_2 Reverse -199 -206 6.23397 0.171
NP_440136.1_2 Forward -206 -199 6.13563 0.193
NP_442590.1_10 Reverse -198 -217 9.24257 0.2
NP_442998.1_5 Reverse -318 -328 9.91146 0.232
NP_442998.1_10 Reverse -200 -207 15.5754 0.0102
NP_440899.1_1 Reverse -316 -335 6.74838 0.267
NP_440299.1_1 Reverse -194 -207 10.5401 0.0569
NP_440299.1_1 Forward -211 -198 10.3434 0.0573
NP_440299.1_1 Forward -257 -244 8.18017 0.0964
NP_440810.1_4 Forward -99 -80 22.7139 0.0156
NP_441007.1_10 Forward -354 -341 -0.669033 0.287
NP_442333.2_5 Forward -224 -205 -4.91709 0.214
NP_440256.1_1 Forward -210 -191 -6.09707 0.201
NP_440709.1_1 Reverse -161 -180 15.1416 0.0336
NP_441559.1_8 Forward -282 -268 4.03116 0.133
NP_441270.1_5 Forward -362 -343 11.14 0.294
NP_440915.1_6 Reverse -225 -239 -2.65535 0.278
NP_442158.1_4 Reverse -208 -218 11.9764 0.26
NP_442866.1_1 Reverse -199 -218 -9.34199 0.292
NP_440748.1_5 Reverse -81 -100 -0.688862 0.26
NP_441464.1_10 Forward -353 -339 9.34103 0.262
NP_440695.1_6 Reverse -97 -111 10.6053 0.265
NP_442386.1_9 Reverse -197 -206 7.07914 0.219
NP_442386.1_9 Reverse -243 -252 4.81753 0.282
NP_442054.1_2 Reverse -71 -90 -2.0655 0.224
NP_441340.1_5 Reverse -328 -335 11.0522 0.0749
NP_441340.1_5 Forward -206 -199 6.13563 0.175
NP_441340.1_5 Reverse -199 -206 5.93897 0.198
NP_442327.1_3 Forward -190 -171 8.83258 0.224
NP_440327.1_2 Forward -396 -377 14.4541 0.297
NP_440146.1_2 Forward -342 -328 14.6509 0.23
NP_442714.1_7 Forward -206 -187 9.53756 0.126
NP_442714.1_7 Forward -237 -218 -0.885524 0.274
NP_442950.1_6 Forward -49 -30 4.916 0.285
NP_440586.1_8 Forward -206 -199 11.4451 0.0645
NP_440586.1_8 Reverse -245 -252 7.70858 0.227
NP_442251.1_6 Reverse -199 -206 12.0355 0.0627
NP_440192.1_4 Forward -280 -261 13.4724 0.169
NP_440684.1_9 Forward -213 -199 16.9125 0.0681
NP_441262.1_3 Forward -207 -200 14.7888 0.0223
NP_440027.1_3 Forward -237 -219 1.5917 0.3
NP_443051.1_1 Forward -208 -199 0.786375 0.125
NP_439937.1_9 Forward -239 -222 -0.0601847 0.109
NP_439937.1_9 Forward -279 -262 -13.9248 0.287
NP_439937.1_9 Forward -280 -263 -14.7114 0.287
NP_439937.1_9 Forward -208 -191 -17.1697 0.294
NP_440408.1_6 Forward -347 -329 14.1788 0.245
NP_440626.1_1 Forward -206 -187 8.35677 0.299
NP_440439.1_6 Reverse -151 -170 3.34271 0.242
NP_440372.1_2 Forward -206 -199 6.72562 0.0929
NP_440372.1_2 Reverse -199 -206 6.62729 0.151
NP_440372.1_3 Reverse -164 -178 14.2399 0.209
NP_440574.1_7 Reverse -211 -230 9.14423 0.293
NP_440316.1_10 Forward -214 -204 13.0581 0.214
NP_439977.1_5 Reverse -192 -211 1.37609 0.194
NP_440139.1_1 Reverse -192 -211 3.53858 0.202
NP_442384.1_10 Reverse -198 -211 6.1158 0.11
NP_441877.1_9 Forward -182 -165 13.0185 0.127
NP_441877.1_9 Reverse -152 -169 12.7235 0.127
NP_441018.1_7 Forward -301 -282 6.29264 0.294
NP_442262.1_10 Reverse -328 -335 7.90559 0.266
NP_441689.1_5 Forward -209 -199 5.68278 0.215
NP_440163.1_10 Forward -210 -200 11.3864 0.169
NP_440344.1_10 Reverse -191 -208 -7.82764 0.119
NP_440562.1_3 Reverse -341 -358 2.79211 0.261
NP_441965.1_10 Forward -290 -274 3.30346 0.266
NP_441640.1_8 Reverse -199 -218 2.3594 0.158
NP_440297.1_9 Forward -335 -325 6.96153 0.161
NP_440297.1_9 Reverse -205 -215 6.96153 0.161
NP_440297.1_9 Reverse -245 -255 -0.216628 0.282
NP_440297.1_9 Reverse -199 -209 -0.41329 0.283
NP_440350.1_5 Forward -384 -365 -6.78538 0.297
NP_440999.1_9 Reverse -284 -298 0.687908 0.177
NP_440888.1_2 Reverse -278 -292 12.0937 0.0516
NP_440888.1_2 Reverse -198 -212 6.78381 0.22
NP_440888.1_2 Forward -136 -122 5.30886 0.284
NP_440179.1_6 Forward -36 -17 13.3725 0.123
NP_439969.1_1 Forward -138 -119 -0.000545616 0.218
NP_442033.1_10 Forward -37 -18 -10.6203 0.243
NP_441759.1_2 Reverse -319 -338 1.86774 0.191
NP_441543.1_2 Reverse -328 -337 7.57121 0.113
NP_441543.1_2 Reverse -199 -208 7.17789 0.131
NP_441543.1_2 Forward -206 -197 5.99792 0.159
NP_442845.1_2 Forward -342 -328 7.37441 0.195
NP_442845.1_2 Forward -213 -199 5.30946 0.237
NP_442845.1_2 Forward -293 -279 3.63784 0.282
NP_441469.1_8 Reverse -277 -286 5.21127 0.283
NP_442315.1_2 Reverse -224 -236 12.0354 0.291
NP_443064.1_6 Reverse -198 -208 8.6886 0.276
NP_442578.1_7 Forward -206 -199 5.93897 0.183
NP_440220.1_4 Reverse -281 -300 -0.197979 0.261
NP_441462.1_2 Forward -207 -197 1.16001 0.0976
NP_443062.1_1 Forward -207 -189 5.91323 0.215
NP_443062.1_1 Reverse -16 -34 5.5232 0.227
NP_443062.1_6 Forward -305 -286 4.71934 0.214
NP_440889.1_4 Reverse -123 -142 6.19431 0.232
NP_442204.1_1 Reverse -309 -320 9.79344 0.0736
NP_442204.1_1 Forward -211 -200 0.353664 0.281
NP_442204.1_5 Reverse -234 -253 -0.39387 0.286
NP_442487.1_6 Reverse -185 -204 10.9134 0.239
NP_442780.1_1 Reverse -166 -185 8.06259 0.279
NP_440516.1_8 Forward -207 -198 8.1612 0.0417
NP_441785.1_1 Reverse -198 -212 17.8771 0.0627
NP_442428.1_4 Reverse -197 -216 4.32602 0.236
NP_442428.1_5 Reverse -199 -206 6.13563 0.209
NP_442428.1_5 Forward -206 -199 6.0373 0.212
NP_442428.1_5 Forward -335 -328 4.36568 0.271
NP_442428.1_5 Reverse -245 -252 4.36568 0.271
NP_440673.1_3 Forward -251 -244 13.2155 0.0426
NP_440673.1_3 Reverse -200 -207 12.4288 0.0426
NP_441052.1_2 Reverse -278 -288 5.5849 0.111
NP_441052.1_2 Reverse -198 -208 1.74999 0.229
NP_442219.1_9 Reverse -199 -208 8.06287 0.0696
NP_440436.1_4 Reverse -199 -208 13.9623 0.0193
NP_440436.1_4 Forward -206 -197 13.6673 0.0225
NP_440436.1_4 Forward -252 -243 10.7174 0.0743
NP_440436.1_4 Reverse -205 -214 6.48915 0.157
NP_440436.1_4 Forward -40 -31 5.11253 0.222
NP_441719.1_4 Forward -206 -199 6.72562 0.093
NP_441719.1_4 Reverse -199 -206 6.62729 0.151
NP_441004.1_1 Forward -219 -200 -15.2418 0.273
NP_441004.1_1 Forward -243 -224 -16.5201 0.286
NP_441004.1_2 Forward -248 -229 5.11266 0.195
NP_441004.1_4 Forward -240 -230 7.64985 0.294
NP_442366.1_3 Reverse -197 -215 5.32902 0.0878
NP_442366.1_3 Reverse -133 -151 -1.75081 0.217
NP_442694.1_4 Forward -330 -321 10.8161 0.294
NP_442854.1_6 Reverse -278 -297 6.88262 0.229
NP_443054.1_2 Reverse -76 -90 5.1128 0.24
NP_441851.1_10 Forward -208 -198 7.25653 0.144
NP_441157.1_1 Reverse -165 -179 6.88214 0.187
NP_440463.1_8 Reverse -227 -246 7.88715 0.264
NP_442689.1_8 Forward -114 -97 -0.649475 0.202
NP_441349.1_4 Reverse -283 -302 5.211 0.138
NP_441349.1_10 Forward -297 -278 -9.63698 0.297
NP_442843.1_1 Forward -286 -267 -11.5053 0.291
NP_441524.1_6 Forward -340 -322 4.14905 0.287
NP_441124.1_5 Forward -182 -172 14.2496 0.215
NP_441031.1_1 Forward -175 -156 4.7982 0.288
NP_442237.1_3 Forward -116 -102 15.9588 0.297
NP_440195.1_4 Forward -219 -200 22.6156 0.0176
NP_442006.1_2 Reverse -235 -252 -15.6941 0.228
NP_441570.1_1 Forward -213 -195 -16.4021 0.245
NP_441078.1_4 Reverse -198 -207 0.196389 0.205
NP_441078.1_4 Forward -207 -198 -0.000272808 0.205
NP_441078.1_4 Reverse -278 -287 -1.6719 0.266
NP_441078.1_4 Forward -287 -278 -1.86856 0.272
NP_440526.1_3 Reverse -199 -210 7.33466 0.153
NP_441432.1_8 Forward -208 -199 7.17789 0.102
NP_441432.1_8 Forward -337 -328 3.04799 0.268
NP_441333.1_1 Reverse -153 -163 11.9712 0.241
NP_442320.1_8 Forward -213 -199 2.16287 0.079
NP_441030.1_4 Forward -184 -165 4.72643 0.29
NP_440760.1_1 Forward -287 -268 -20.8467 0.225
NP_440199.1_10 Forward -210 -200 16.7946 0.0381
NP_442751.1_7 Forward -30 -12 16.5379 0.297
NP_442489.1_7 Reverse -198 -207 0.884706 0.145
NP_442489.1_7 Forward -207 -198 0.491382 0.178
NP_442489.1_7 Forward -287 -278 -1.37691 0.195
NP_440565.1_2 Forward -250 -236 15.4196 0.292
NP_440559.1_1 Reverse -199 -208 14.1594 0.0317
NP_441659.2_6 Reverse -156 -175 14.0599 0.234
NP_441659.2_8 Reverse -198 -208 6.37155 0.0774
NP_441659.2_8 Reverse -340 -350 1.455 0.24
NP_441659.2_8 Reverse -244 -254 0.668351 0.26
NP_441040.1_5 Reverse -193 -212 2.16274 0.291
NP_442849.1_1 Reverse -25 -39 9.83269 0.225
NP_441800.1_7 Reverse -338 -356 -1.75081 0.251
NP_442346.1_5 Forward -208 -198 14.828 0.00967
NP_442346.1_5 Forward -337 -327 8.33817 0.14
NP_440459.1_2 Forward -229 -212 14.1002 0.119
NP_442603.1_9 Forward -233 -215 0.412472 0.293
NP_441833.1_4 Reverse -199 -206 14.1004 0.0258
NP_441833.1_4 Forward -206 -199 6.13563 0.198
NP_442162.1_9 Reverse -199 -206 6.62729 0.142
NP_442162.1_9 Forward -206 -199 6.52896 0.178
NP_440671.1_1 Forward -182 -163 11.2991 0.19
NP_440671.1_1 Reverse -152 -171 7.37522 0.217
NP_440671.1_4 Forward -213 -199 10.3243 0.161
NP_442140.1_3 Forward -206 -196 14.4347 0.0486
NP_442140.1_3 Reverse -245 -255 10.1081 0.0926
NP_441813.1_5 Forward -209 -199 6.07655 0.104
NP_441813.1_5 Reverse -196 -206 -0.41329 0.242
NP_441813.1_9 Reverse -111 -130 11.8975 0.256
NP_442089.1_6 Reverse -205 -224 13.3725 0.1
NP_440590.1_4 Reverse -199 -212 2.47756 0.0879
NP_440567.1_1 Reverse -199 -213 0.491246 0.244
NP_440567.1_1 Forward -206 -192 0.196253 0.254
NP_442497.1_10 Reverse -199 -208 0.688044 0.141
NP_440821.1_4 Forward -209 -199 8.4365 0.0503
NP_440400.1_1 Forward -235 -216 7.96345 0.22
NP_442270.1_9 Forward -218 -199 -10.3253 0.253
NP_441017.1_6 Forward -211 -197 13.6669 0.179
NP_441017.1_6 Reverse -240 -254 12.0937 0.227
NP_440876.1_5 Forward -274 -255 10.7175 0.244
NP_440354.1_1 Forward -19 -1 17.0304 0.249
NP_441617.1_6 Reverse -99 -118 0.58944 0.248
NP_442138.1_10 Reverse -198 -217 -4.91709 0.266
NP_440412.1_5 Reverse -100 -119 12.2561 0.287
NP_440546.1_4 Forward -207 -197 11.5004 0.0806
NP_440546.1_4 Forward -393 -383 6.45857 0.296
NP_442041.1_5 Reverse -238 -257 -1.57384 0.286
NP_440462.1_6 Forward -27 -17 2.04498 0.294
NP_442787.1_9 Reverse -211 -230 14.0608 0.296
NP_442479.1_9 Forward -117 -98 -9.53865 0.266
NP_440696.1_3 Reverse -218 -236 -4.01242 0.294
NP_442837.1_3 Reverse -199 -206 6.13563 0.25
NP_442837.1_3 Forward -206 -199 5.93897 0.265
NP_440160.1_2 Forward -232 -213 -9.44032 0.299
NP_440505.1_3 Forward -209 -199 15.0247 0.0149
NP_441701.1_3 Forward -301 -284 8.49531 0.247
NP_440520.1_1 Reverse -227 -246 -4.42544 0.272
NP_441203.1_1 Reverse -328 -347 -19.5684 0.297
NP_442532.1_4 Reverse -99 -117 12.425 0.215
NP_441408.2_7 Reverse -325 -344 -0.983855 0.241
NP_441408.2_7 Reverse -82 -101 -3.3438 0.272
NP_440914.1_1 Reverse -198 -208 14.7634 0.00997
NP_440914.1_1 Forward -213 -203 11.6404 0.0843
NP_441699.1_7 Reverse -164 -183 6.78348 0.255
NP_441011.1_8 Forward -206 -197 8.45619 0.144
NP_442533.1_6 Reverse -278 -287 14.1594 0.0149
NP_442533.1_6 Forward -207 -198 5.3096 0.145
NP_442533.1_6 Reverse -340 -349 2.65466 0.246
NP_442541.1_10 Forward -137 -123 0.785655 0.298
NP_441482.1_7 Forward -213 -199 -10.9151 0.222
NP_439944.1_9 Forward -335 -325 10.2065 0.0917
NP_439944.1_9 Reverse -199 -209 9.32148 0.1
NP_441697.1_5 Forward -195 -176 -11.5072 0.295
NP_440816.1_2 Reverse -165 -184 6.33814 0.281
NP_440116.1_8 Reverse -199 -218 -0.197208 0.105
NP_440007.1_9 Reverse -81 -95 3.14618 0.275
NP_440007.1_9 Forward -217 -203 2.35953 0.281
NP_441106.1_1 Reverse -197 -206 13.9627 0.0279
NP_441106.1_1 Forward -337 -328 4.62128 0.213
NP_441106.1_1 Reverse -243 -252 4.32629 0.227
NP_441106.1_3 Reverse -151 -170 16.8141 0.103
NP_441216.1_5 Reverse -338 -357 11.7 0.284
NP_441286.1_1 Forward -208 -196 -5.76255 0.223
NP_441286.1_1 Reverse -197 -209 -7.04085 0.3
NP_440670.1_8 Reverse -198 -207 6.98123 0.0882
NP_440886.1_7 Reverse -277 -287 5.87944 0.158
NP_440886.1_7 Reverse -339 -349 4.89613 0.213
NP_442401.1_1 Reverse -356 -375 19.174 0.102
NP_439899.1_1 Forward -183 -165 21.4159 0.031
NP_440907.2_8 Forward -24 -14 5.78111 0.188
NP_441021.1_1 Reverse -199 -218 2.65439 0.083
NP_440841.1_4 Forward -209 -190 -8.06369 0.25
NP_441463.1_6 Reverse -202 -216 6.3193 0.274
NP_441626.1_2 Forward -206 -199 6.0373 0.212
NP_441626.1_2 Reverse -199 -206 6.0373 0.212
NP_441988.1_5 Forward -232 -213 14.4541 0.274
NP_442794.1_1 Forward -217 -205 3.87389 0.283
NP_442615.1_1 Reverse -189 -207 13.1955 0.0119
NP_441962.1_9 Forward -135 -116 7.47261 0.258
NP_440387.1_1 Reverse -198 -214 -3.28472 0.157
NP_440387.1_1 Reverse -327 -343 -5.15301 0.217
NP_441836.1_2 Reverse -192 -211 -5.21209 0.275
NP_441993.1_1 Reverse -211 -230 4.18821 0.223
NP_440114.1_10 Forward -336 -322 13.2743 0.0609
NP_442324.1_7 Reverse -310 -329 6.24429 0.268
NP_440293.1_3 Reverse -20 -39 -0.0988766 0.228
NP_440293.1_3 Forward -294 -275 -3.3438 0.244
NP_440293.1_9 Forward -292 -278 18.4952 0.0971
NP_440293.1_10 Forward -358 -339 6.58763 0.198
NP_440766.1_4 Forward -211 -197 11.996 0.0581
NP_441421.1_6 Reverse -166 -183 13.994 0.212
NP_442743.1_5 Reverse -199 -218 2.65439 0.293
NP_439910.1_2 Reverse -190 -207 -22.2823 0.22
NP_442867.1_8 Forward -252 -233 4.42435 0.283
NP_440457.1_1 Forward -211 -199 -0.0593532 0.25
NP_441801.1_4 Forward -223 -213 2.7333 0.262
NP_441801.1_4 Reverse -304 -314 2.53664 0.292
NP_442680.1_5 Reverse -314 -333 5.73827 0.216
NP_440473.1_9 Reverse -233 -252 -6.49039 0.235
NP_440554.1_4 Forward -252 -242 4.20827 0.198
NP_441845.1_6 Forward -219 -201 6.60732 0.167
NP_441885.1_5 Reverse -198 -208 1.455 0.11
NP_441885.1_5 Forward -207 -197 0.668351 0.133
NP_441885.1_5 Reverse -278 -288 -0.0199663 0.186
NP_440628.1_1 Forward -18 -8 13.1977 0.29
NP_442703.1_1 Reverse -163 -182 5.0129 0.297
NP_442341.1_7 Reverse -197 -211 1.17956 0.297
NP_443000.1_7 Forward -209 -199 7.25653 0.0927
NP_440507.2_3 Forward -216 -197 8.94676 0.237
NP_440552.1_8 Reverse -165 -182 21.2513 0.0121
NP_440552.1_8 Reverse -135 -152 12.1796 0.235
NP_441842.1_10 Reverse -237 -251 10.226 0.167
NP_440275.1_3 Forward -255 -245 4.40493 0.196
NP_440091.1_1 Reverse -194 -206 3.67722 0.15
NP_440091.1_1 Forward -211 -199 -0.944332 0.3
NP_443060.1_1 Reverse -329 -348 14.1583 0.166
NP_443010.1_10 Forward -281 -264 2.19099 0.281
NP_440149.1_8 Forward -213 -194 -3.04881 0.18
NP_441105.1_3 Forward -347 -328 -7.08038 0.245
NP_441105.1_3 Forward -225 -206 -8.65367 0.275
NP_441111.1_7 Reverse -199 -207 8.96754 0.0463
NP_439971.2_8 Reverse -32 -46 17.6992 0.15
NP_441766.1_2 Forward -207 -198 8.06287 0.0691
NP_442179.1_5 Forward -238 -219 16.9124 0.264
NP_440416.1_9 Reverse -203 -222 -7.08038 0.0964
NP_440416.1_9 Reverse -9 -28 -18.8801 0.266
NP_440416.1_9 Forward -260 -241 -18.8801 0.266
NP_443052.1_8 Reverse -234 -253 -3.14714 0.0981
NP_440072.1_5 Forward -358 -340 -1.94747 0.267
NP_442116.1_6 Forward -175 -158 7.78699 0.254
NP_442116.1_6 Reverse -55 -72 5.68616 0.291
NP_442403.1_8 Reverse -200 -219 12.2908 0.131
NP_442154.1_1 Forward -311 -293 -16.9921 0.247
NP_440988.1_10 Forward -239 -225 4.02751 0.275
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GATTCCCACCTATGTGGTGTTTTCGGTGAGTCTGCTCTTTTTTGGTCTAGGGGTGGTGGGCTTAAGCTATGGCATTTTTTCCACCTCCTGGGAAGATGAGCCTGGCAGTGTCTGGGGCTGGCCGGAATTTCGCCTCAACCTCAGTCGTACCATCGCTGTCTGGCGCAACGCCCAACAAACGGCCCAGGACAATGGCGATCGTTGAACAAAACTCAGAATTTGTAAATTTTCGTTAACAAAGTTAACAATTGGTCAATAATAATTGCCCAGTCCTGTTGGTCAAAATAATTTCGTTAAAATTAGCATTAGCATCGGCTTTTCGAGTCCGCATTTACTGTCAGACCTTTAGCTAAGCTTTTAACCCTCCCTGTCCCAACCTATCGAATAGAGGAAGTTTGTC

CDS

ATGATCGTCGTCATGAAAGTCGGCACCCCAGAAATAGAAATTGAGCGCATTGGTAAGGAGTTTGCCGAACGGGGCCTCACCCCCGAAAAGATTGTTGGTAAGCACAAAGTTGTGATGGGGTTGGTGGGGGAAACAGCCGGACTTGATCCTTTGCAAATCCAAGAGGTTAGCCCCTGGATTGAAGATGTATTACGGGTGGAACAACCTTTTAAACGGGCTAGTTTGACTTTCCGCCATGGGGAATACAGTGAAGTAATCGTTTCTACCCCCGCTGGCCCCGTGGCGATCGGCAAAAACCATCCGGTGGCTGTGGTAGCAGGCCCCTGTTCGGTGGAAAATGAAACCATGATTGTGGAAACGGCCCGTCGAGTTAAGGCGGCCGGGGCCCAGTTTTTACGGGGCGGCGCCTTCAAACCCCGTACCTCTCCCTACGCTTTCCAAGGTCATGGGGAAAGTGCTCTAGGTCTGTTGGCAGCAGCTAAGGAAGCCACTGGTTTGGGCATTATCACCGAAGTGATGGATGCGGCGGATTTAGAAATCATTGCGGAAGTGGCGGATGTAATCCAAGTGGGTGCCCGCAATATGCAGAATTTCTCCATGCTGAAAAAGGTAGGGGCCCAGGATAAGCCAGTGCTGTTAAAGCGGGGCATGGCGGCCACCATTGATGAATGGTTAATGGCGGCAGAATACATTCTCGCGGCGGGTAATCCCAACGTGATTCTTTGTGAGCGGGGCATTCGCACCTTTGACGGCCATTACACCCGCAATTGCCTTGATTTGTCGGTGTTGCCTGTCCTGCGCTCCCTTACGCACCTGCCCATTATGATCGACCCCAGCCACGGCACCGGTAAATCCGAGTATGTGCCCTCCATGGCCATGGCGGCGATCGCCGCGGGGACAGACTCCTTGATGATTGAAGTGCATCCCAACCCGGCTAAAGCTATGTCCGATGGGCCCCAATCTTTGACCCCCGACCGCTTCGACGAAACCATGAAGCAATTGGCGGTTATTGGGCAAACTGTAGGACGTTGGCCTAAAGTAGCGGCCCTGGCCTAG

Protein

MIVVMKVGTPEIEIERIGKEFAERGLTPEKIVGKHKVVMGLVGETAGLDPLQIQEVSPWIEDVLRVEQPFKRASLTFRHGEYSEVIVSTPAGPVAIGKNHPVAVVAGPCSVENETMIVETARRVKAAGAQFLRGGAFKPRTSPYAFQGHGESALGLLAAAKEATGLGIITEVMDAADLEIIAEVADVIQVGARNMQNFSMLKKVGAQDKPVLLKRGMAATIDEWLMAAEYILAAGNPNVILCERGIRTFDGHYTRNCLDLSVLPVLRSLTHLPIMIDPSHGTGKSEYVPSMAMAAIAAGTDSLMIEVHPNPAKAMSDGPQSLTPDRFDETMKQLAVIGQTVGRWPKVAALA