Your browser is old and dusty. Try Google Chrome!

Details for sll0926

ORF sll0926
Accession NP_440208.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -125 -111 -1.47537 0.262
NP_440557.1_1 Forward -95 -76 4.32602 0.183
NP_440795.1_7 Forward -125 -118 14.6904 0.0123
NP_440795.1_7 Reverse -118 -125 14.6904 0.0123
NP_441418.1_6 Forward -126 -107 -10.522 0.0362
NP_441453.1_4 Reverse -117 -125 16.539 0.00633
NP_441453.1_4 Forward -126 -118 16.539 0.00633
NP_441623.1_1 Forward -330 -312 -4.11075 0.274
NP_442151.1_6 Reverse -117 -131 16.7159 0.0139
NP_441818.1_6 Reverse -110 -124 11.6026 0.253
NP_441818.1_9 Forward -47 -28 -5.01543 0.248
NP_440226.1_1 Reverse -117 -136 19.2723 0.0114
NP_440226.1_1 Forward -126 -107 8.06259 0.0944
NP_440348.1_6 Forward -240 -221 2.3594 0.289
NP_442173.1_1 Forward -125 -117 15.4574 0.00633
NP_442173.1_1 Reverse -118 -126 15.4574 0.00633
NP_442752.1_4 Forward -126 -119 13.8055 0.0199
NP_442752.1_4 Reverse -117 -124 13.8055 0.0199
NP_443027.1_4 Forward -128 -118 15.3197 0.0437
NP_443027.1_4 Reverse -115 -125 5.87989 0.294
NP_439997.1_4 Forward -226 -207 11.9958 0.186
NP_441812.1_3 Reverse -116 -130 14.3559 0.126
NP_442975.1_10 Reverse -113 -127 10.8154 0.0516
NP_442975.1_10 Forward -130 -116 3.34225 0.259
NP_441675.1_4 Reverse -155 -174 7.86593 0.235
NP_440784.1_7 Forward -125 -118 15.9687 0.0123
NP_440784.1_7 Reverse -118 -125 15.9687 0.0123
NP_442909.1_7 Forward -125 -111 10.422 0.136
NP_441054.1_4 Forward -136 -118 1.59244 0.172
NP_439979.1_2 Forward -126 -107 8.06259 0.258
NP_440878.1_9 Reverse -107 -126 3.24438 0.174
NP_442062.1_8 Forward -126 -116 19.4496 0.000558
NP_442062.1_8 Reverse -117 -127 10.3048 0.0493
NP_440304.1_4 Forward -128 -118 18.9579 0.00406
NP_440304.1_4 Reverse -115 -125 1.84832 0.299
NP_442242.1_4 Forward -125 -118 14.3954 0.0124
NP_442242.1_4 Reverse -118 -125 14.3954 0.0124
NP_440044.1_8 Reverse -118 -137 0.786102 0.191
NP_440044.1_8 Forward -125 -106 -3.24547 0.281
NP_441781.1_7 Forward -126 -107 -2.36049 0.289
NP_442762.1_10 Reverse -221 -240 -18.5851 0.297
NP_441208.1_9 Reverse -114 -128 10.0294 0.196
NP_441208.1_9 Forward -129 -115 4.91614 0.282
NP_440370.1_10 Forward -135 -116 9.93088 0.212
NP_442110.1_7 Reverse -117 -131 9.5377 0.0724
NP_441083.1_5 Forward -126 -116 11.3864 0.0159
NP_441083.1_5 Reverse -117 -127 11.2881 0.0159
NP_442827.1_8 Reverse -109 -128 7.17681 0.0976
NP_441434.1_7 Forward -124 -110 4.03116 0.225
NP_441434.1_7 Reverse -119 -133 1.96621 0.288
NP_441738.1_2 Forward -124 -117 15.28 0.0102
NP_441738.1_2 Reverse -119 -126 15.28 0.0102
NP_441558.1_5 Forward -128 -109 5.99764 0.232
NP_441955.1_8 Forward -123 -106 6.03703 0.285
NP_440209.1_1 Reverse -117 -125 18.1123 0.00295
NP_440209.1_1 Forward -126 -118 18.1123 0.00295
NP_442889.1_1 Reverse -194 -213 -12.0953 0.218
NP_442889.1_8 Forward -129 -115 9.34041 0.1
NP_440056.1_9 Reverse -160 -179 12.7015 0.295
NP_441713.1_1 Forward -132 -113 -4.32711 0.113
NP_441713.1_7 Reverse -118 -137 15.3391 0.293
NP_441770.1_4 Forward -329 -310 -7.67036 0.234
NP_440178.1_7 Reverse -116 -135 -13.7669 0.143
NP_442111.1_4 Forward -127 -113 5.30946 0.169
NP_441163.1_1 Reverse -109 -126 13.0178 0.183
NP_440906.1_5 Forward -125 -118 15.8704 0.0124
NP_440906.1_5 Reverse -118 -125 15.8704 0.0124
NP_440747.1_10 Reverse -114 -126 5.44718 0.0137
NP_440747.1_10 Forward -129 -117 -1.92764 0.0192
NP_441130.1_10 Reverse -115 -129 9.73436 0.12
NP_441854.1_10 Forward -277 -258 3.34271 0.282
NP_441486.1_1 Reverse -114 -128 5.1128 0.0391
NP_441486.1_1 Forward -129 -115 5.01447 0.0398
NP_441486.1_1 Forward -213 -199 -6.39192 0.294
NP_442634.1_4 Reverse -115 -129 -3.34366 0.161
NP_442634.1_4 Forward -128 -114 -3.54032 0.161
NP_440403.1_4 Reverse -108 -127 -8.35868 0.254
NP_442848.1_1 Reverse -111 -125 -1.18038 0.263
NP_443018.1_3 Forward -125 -118 14.8871 0.0123
NP_443018.1_3 Reverse -118 -125 14.8871 0.0123
NP_441316.1_7 Reverse -115 -130 6.27308 0.107
NP_441316.1_7 Forward -128 -113 -0.216765 0.2
NP_441634.1_8 Forward -38 -24 -2.55701 0.295
NP_441634.1_8 Forward -128 -114 -3.44199 0.295
NP_441634.1_8 Reverse -115 -129 -4.4253 0.295
NP_440376.1_1 Forward -126 -117 19.4693 0.000692
NP_440376.1_1 Reverse -117 -126 19.4693 0.000692
NP_440376.1_1 Reverse -201 -210 4.62128 0.154
NP_441588.1_4 Forward -124 -114 7.25653 0.178
NP_441588.1_4 Reverse -119 -129 6.66654 0.185
NP_442687.1_7 Reverse -116 -126 15.8113 0.0125
NP_442687.1_7 Forward -127 -117 9.02648 0.0994
NP_442687.1_7 Reverse -265 -275 7.64985 0.127
NP_442687.1_7 Forward -211 -201 3.81494 0.286
NP_442958.1_3 Forward -137 -118 0.0977854 0.267
NP_440642.1_1 Reverse -261 -280 6.98095 0.266
NP_442296.1_9 Forward -125 -106 1.86774 0.186
NP_442658.1_1 Reverse -115 -125 15.9091 0.00966
NP_442658.1_1 Forward -128 -118 15.9091 0.00966
NP_442782.1_2 Forward -221 -207 0.294584 0.291
NP_442205.1_9 Reverse -111 -127 -3.38305 0.282
NP_441414.1_9 Forward -126 -107 -0.688862 0.0942
NP_440607.1_10 Reverse -66 -85 17.8948 0.285
NP_441487.1_9 Reverse -116 -135 14.6508 0.0454
NP_441958.1_5 Forward -127 -117 21.2195 0.000805
NP_441958.1_5 Reverse -116 -126 12.2714 0.00183
NP_440203.1_5 Forward -207 -197 11.3859 0.195
NP_439905.1_1 Reverse -46 -59 11.0324 0.204
NP_439905.1_1 Reverse -118 -131 9.75405 0.216
NP_440984.1_7 Forward -131 -117 20.1574 0.00473
NP_440984.1_7 Reverse -112 -126 11.6026 0.122
NP_442911.1_2 Reverse -107 -126 -5.50708 0.16
NP_441580.1_6 Forward -137 -118 2.94938 0.117
NP_440153.1_5 Forward -125 -111 2.45787 0.223
NP_441591.1_10 Forward -128 -109 5.60432 0.295
NP_443055.1_6 Forward -248 -230 0.903388 0.238
NP_440993.1_2 Forward -131 -115 5.6634 0.234
NP_440934.1_1 Reverse -103 -122 4.62101 0.25
NP_440138.1_6 Forward -346 -327 9.24175 0.175
NP_441913.1_1 Reverse -308 -324 15.9497 0.246
NP_442995.1_5 Forward -122 -103 11.0125 0.219
NP_442002.1_1 Forward -56 -38 -10.4039 0.292
NP_442002.1_9 Reverse -116 -123 10.7572 0.185
NP_441654.1_7 Reverse -209 -228 10.597 0.299
NP_441294.1_7 Reverse -113 -127 8.86667 0.274
NP_441646.1_1 Reverse -110 -129 2.45773 0.218
NP_442438.1_10 Forward -131 -117 1.76955 0.188
NP_442413.1_4 Forward -56 -37 18.0924 0.157
NP_441000.1_6 Forward -127 -113 -3.93365 0.225
NP_441000.1_6 Reverse -116 -130 -5.01529 0.257
NP_440147.1_4 Reverse -115 -128 21.4554 0.00117
NP_440147.1_4 Forward -128 -115 2.47756 0.208
NP_441550.1_8 Forward -128 -118 17.4824 0.00754
NP_441550.1_8 Reverse -115 -125 8.3377 0.124
NP_441916.1_7 Reverse -117 -127 18.9579 0.00144
NP_441916.1_7 Forward -126 -116 18.4663 0.00144
NP_440465.1_10 Forward -129 -110 9.43923 0.173
NP_441041.1_4 Forward -47 -28 -1.7705 0.103
NP_441041.1_7 Forward -129 -117 18.3015 0.00558
NP_441041.1_7 Reverse -114 -126 9.65268 0.108
NP_442396.1_5 Reverse -113 -126 9.45906 0.129
NP_441725.1_5 Reverse -118 -128 8.92815 0.0553
NP_441725.1_5 Forward -125 -115 2.04498 0.115
NP_439966.1_7 Forward -128 -118 13.8442 0.0234
NP_439966.1_7 Reverse -115 -125 9.91099 0.0968
NP_439966.1_9 Forward -57 -48 4.42462 0.253
NP_439966.1_9 Forward -128 -119 0.983037 0.253
NP_439966.1_9 Reverse -115 -124 0.884706 0.253
NP_442941.1_3 Reverse -118 -128 10.9931 0.0116
NP_442941.1_3 Forward -125 -115 2.63497 0.14
NP_440289.1_2 Forward -129 -116 5.03416 0.0636
NP_440289.1_2 Reverse -114 -127 -3.61896 0.267
NP_440289.1_4 Forward -130 -111 23.1072 0.0433
NP_442281.1_1 Forward -131 -117 14.2569 0.0198
NP_442281.1_1 Reverse -112 -126 11.897 0.0428
NP_440647.1_9 Reverse -115 -133 6.41066 0.219
NP_442500.1_8 Reverse -313 -327 13.3598 0.198
NP_442012.1_1 Forward -132 -113 5.89931 0.141
NP_439983.1_7 Forward -310 -292 12.5072 0.245
NP_440498.1_1 Reverse -108 -126 5.72234 0.0981
NP_440498.1_1 Forward -135 -117 1.98577 0.201
NP_440498.1_1 Reverse -23 -41 -2.73412 0.245
NP_441644.1_6 Reverse -117 -127 19.0557 0.000803
NP_441644.1_6 Forward -126 -116 10.1076 0.0628
NP_441644.1_6 Reverse -201 -211 3.12618 0.297
NP_443049.1_6 Forward -48 -38 11.0554 0.282
NP_442215.1_2 Forward -212 -196 12.1532 0.0334
NP_442215.1_2 Reverse -115 -131 7.04003 0.0699
NP_442215.1_2 Reverse -298 -314 -6.33298 0.268
NP_442177.1_5 Forward -38 -24 8.45605 0.276
NP_442029.1_6 Forward -101 -82 5.211 0.255
NP_442029.1_10 Forward -99 -80 4.12936 0.293
NP_440929.1_8 Forward -126 -117 19.2726 0.000701
NP_440929.1_8 Reverse -117 -126 19.2726 0.000701
NP_442933.1_10 Forward -126 -117 17.601 0.00325
NP_442933.1_10 Reverse -117 -126 17.601 0.00325
NP_441751.2_8 Reverse -118 -132 2.75286 0.0759
NP_442554.1_8 Reverse -118 -128 19.1546 0.00369
NP_442554.1_8 Forward -125 -115 13.2547 0.0187
NP_441762.1_7 Reverse -116 -128 11.7404 0.0142
NP_441762.1_7 Forward -127 -115 10.2654 0.0142
NP_442313.1_5 Forward -95 -76 5.40766 0.256
NP_442142.1_4 Forward -129 -116 14.1783 0.0311
NP_442142.1_4 Reverse -114 -127 5.32859 0.194
NP_442142.1_4 Reverse -42 -55 5.32859 0.194
NP_442292.1_1 Reverse -118 -127 17.5026 0.00435
NP_442292.1_1 Forward -125 -116 9.63616 0.0183
NP_440919.1_7 Forward -101 -83 7.28266 0.228
NP_442476.1_6 Forward -125 -111 11.3077 0.056
NP_442476.1_6 Reverse -118 -132 7.66941 0.112
NP_443009.1_5 Forward -127 -116 19.626 0.00102
NP_443009.1_5 Reverse -116 -127 7.82632 0.118
NP_442301.1_2 Reverse -168 -187 5.99684 0.263
NP_442408.2_1 Forward -126 -107 0.884433 0.196
NP_441371.1_3 Forward -283 -265 5.23069 0.292
NP_441715.1_4 Forward -125 -115 9.41981 0.097
NP_441715.1_4 Reverse -118 -128 7.25653 0.108
NP_441198.1_8 Forward -128 -118 15.4199 0.0427
NP_441198.1_8 Reverse -85 -95 11.1228 0.222
NP_441468.1_1 Forward -125 -118 15.8704 0.0124
NP_441468.1_1 Reverse -118 -125 15.8704 0.0124
NP_441020.2_6 Forward -128 -111 11.8386 0.11
NP_441673.1_1 Forward -126 -117 20.8459 0.000698
NP_441673.1_1 Reverse -117 -126 20.8459 0.000698
NP_441826.1_2 Reverse -111 -125 -1.47537 0.248
NP_441826.1_2 Forward -132 -118 -2.26202 0.269
NP_442811.1_2 Forward -277 -258 1.0811 0.252
NP_442868.1_6 Forward -128 -118 8.63316 0.0555
NP_442868.1_6 Reverse -115 -125 0.865012 0.205
NP_442719.1_2 Forward -298 -280 -3.52148 0.2
NP_442719.1_2 Forward -330 -312 -8.53634 0.251
NP_442808.1_1 Reverse -116 -126 18.4657 0.00201
NP_442808.1_1 Forward -127 -117 8.73102 0.0481
NP_442808.1_1 Reverse -44 -54 4.40448 0.199
NP_442808.1_1 Reverse -265 -275 3.42118 0.24
NP_441101.1_1 Forward -128 -110 10.5406 0.286
NP_442775.1_4 Forward -59 -40 12.8808 0.263
NP_440145.1_3 Forward -136 -117 10.0292 0.0426
NP_442542.1_9 Forward -133 -119 6.48882 0.235
NP_442050.1_5 Forward -128 -118 17.1874 0.00812
NP_440630.1_3 Forward -137 -118 4.62101 0.203
NP_441878.1_6 Forward -127 -117 10.5014 0.0176
NP_441878.1_6 Reverse -116 -126 10.4031 0.0176
NP_441878.1_6 Reverse -200 -210 2.53664 0.0363
NP_441036.1_8 Reverse -116 -126 17.7779 0.000554
NP_441036.1_8 Forward -127 -117 15.713 0.00724
NP_441036.1_8 Reverse -234 -244 6.56821 0.225
NP_441557.1_5 Forward -126 -117 19.9609 0.000699
NP_441557.1_5 Reverse -117 -126 19.9609 0.000699
NP_442066.2_9 Forward -130 -117 19.3905 0.00844
NP_442066.2_9 Forward -178 -165 7.09911 0.247
NP_441433.1_8 Forward -95 -76 14.6508 0.147
NP_441308.1_8 Forward -128 -118 12.4681 0.218
NP_440101.1_3 Reverse -112 -131 1.0811 0.284
NP_441458.1_10 Forward -99 -80 1.0811 0.298
NP_442183.1_1 Reverse -117 -131 11.996 0.0648
NP_442183.1_1 Forward -126 -112 11.7993 0.0675
NP_441574.1_1 Forward -129 -110 -7.57203 0.292
NP_441549.1_9 Reverse -113 -131 -5.78238 0.198
NP_441238.1_5 Forward -326 -307 17.1082 0.139
NP_442347.1_2 Forward -125 -116 11.1111 0.056
NP_442347.1_2 Reverse -118 -127 3.34298 0.284
NP_442645.1_2 Forward -128 -109 -20.2567 0.288
NP_442645.1_2 Forward -134 -115 -20.4534 0.288
NP_441037.1_4 Forward -128 -118 16.5761 0.0168
NP_441037.1_4 Reverse -115 -125 14.7245 0.028
NP_442594.1_7 Reverse -106 -125 9.7334 0.186
NP_442317.1_6 Reverse -112 -131 4.22769 0.247
NP_441633.1_3 Reverse -115 -128 13.0973 0.018
NP_441633.1_3 Forward -128 -115 -5.78224 0.236
NP_440136.1_2 Forward -125 -118 15.9687 0.0123
NP_440136.1_2 Reverse -118 -125 15.9687 0.0123
NP_442998.1_5 Forward -264 -254 7.45319 0.292
NP_442998.1_10 Forward -124 -117 15.5754 0.0102
NP_442998.1_10 Reverse -119 -126 15.5754 0.0102
NP_440299.1_1 Reverse -113 -126 8.08184 0.098
NP_441799.1_1 Reverse -113 -127 19.2718 0.00667
NP_441799.1_1 Forward -130 -116 16.3219 0.0152
NP_440640.1_9 Reverse -297 -316 11.9958 0.281
NP_441007.1_10 Forward -131 -118 21.9471 0.00574
NP_441007.1_10 Reverse -112 -125 1.59258 0.203
NP_442334.1_8 Forward -70 -52 5.13236 0.252
NP_440256.1_1 Forward -129 -110 2.3594 0.0652
NP_442283.1_4 Reverse -322 -341 19.8623 0.2
NP_441559.1_8 Reverse -112 -126 -7.08024 0.283
NP_441559.1_8 Reverse -196 -210 -7.2769 0.289
NP_440915.1_6 Forward -130 -116 4.42448 0.0953
NP_440915.1_6 Reverse -113 -127 -2.75368 0.28
NP_442158.1_4 Forward -272 -262 10.3048 0.299
NP_440717.1_1 Reverse -118 -137 7.57094 0.265
NP_442785.1_7 Forward -128 -114 11.111 0.228
NP_441866.1_6 Forward -98 -79 13.175 0.163
NP_440748.1_5 Forward -207 -188 2.16274 0.223
NP_442031.1_5 Reverse -103 -122 13.9625 0.157
NP_442031.1_9 Reverse -107 -126 14.3549 0.179
NP_441464.1_8 Forward -126 -112 5.21113 0.26
NP_440695.1_6 Reverse -72 -86 9.53873 0.283
NP_441939.1_4 Forward -326 -307 15.517 0.198
NP_441494.1_6 Forward -131 -118 6.80412 0.272
NP_442993.1_1 Reverse -117 -133 -1.41643 0.0906
NP_442386.1_9 Reverse -116 -125 15.7322 0.0144
NP_442386.1_9 Forward -127 -118 6.39082 0.219
NP_441340.1_5 Forward -125 -118 15.6737 0.0124
NP_441340.1_5 Reverse -118 -125 15.6737 0.0124
NP_442327.1_3 Forward -26 -7 4.24897 0.3
NP_442484.1_2 Forward -95 -76 0.294447 0.25
NP_440327.1_6 Reverse -105 -124 3.04771 0.285
NP_440161.1_3 Forward -128 -109 7.96426 0.282
NP_442714.1_5 Forward -125 -106 3.93269 0.238
NP_442950.1_3 Forward -305 -286 14.2574 0.214
NP_441027.1_1 Forward -325 -311 11.1104 0.277
NP_440211.1_4 Reverse -311 -321 16.4996 0.215
NP_440586.1_8 Forward -125 -118 13.2151 0.026
NP_440586.1_8 Reverse -118 -125 13.2151 0.026
NP_442251.1_6 Forward -125 -118 15.2804 0.0124
NP_442251.1_6 Reverse -118 -125 15.2804 0.0124
NP_440684.1_9 Reverse -111 -125 11.701 0.172
NP_441262.1_3 Reverse -117 -124 14.7888 0.0223
NP_441262.1_3 Forward -126 -119 14.7888 0.0223
NP_440027.1_3 Reverse -107 -125 8.3765 0.193
NP_443051.1_1 Forward -127 -118 19.5676 0.00335
NP_443051.1_1 Reverse -116 -125 10.4228 0.00754
NP_439996.1_9 Reverse -263 -282 15.3382 0.19
NP_439937.1_8 Reverse -261 -280 -0.197208 0.238
NP_439937.1_9 Reverse -116 -133 -16.1864 0.287
NP_440398.1_6 Reverse -214 -233 5.40766 0.275
NP_440626.1_1 Forward -125 -106 14.1583 0.192
NP_440439.1_1 Reverse -114 -127 10.5407 0.0365
NP_440439.1_1 Forward -129 -116 10.344 0.0369
NP_440372.1_2 Forward -125 -118 16.3621 0.0124
NP_440372.1_2 Reverse -118 -125 16.3621 0.0124
NP_440770.1_3 Forward -164 -150 15.3392 0.245
NP_442663.1_1 Reverse -291 -310 1.17865 0.269
NP_442488.1_4 Reverse -220 -239 7.66927 0.298
NP_441572.1_7 Forward -132 -113 12.6841 0.039
NP_442384.1_10 Forward -126 -113 15.4572 0.00986
NP_442384.1_10 Forward -210 -197 2.77255 0.213
NP_442384.1_10 Reverse -201 -214 2.2809 0.23
NP_440399.1_2 Reverse -30 -49 13.4708 0.0871
NP_442790.1_4 Reverse -108 -127 -5.60541 0.144
NP_442262.1_10 Forward -125 -118 14.1988 0.0123
NP_442262.1_10 Reverse -118 -125 14.1988 0.0123
NP_441689.1_5 Forward -128 -118 8.43603 0.132
NP_441689.1_5 Reverse -85 -95 5.28945 0.273
NP_440344.1_1 Forward -57 -38 10.3242 0.188
NP_440344.1_10 Forward -133 -116 -8.61428 0.13
NP_440344.1_10 Reverse -110 -127 -10.7776 0.19
NP_440344.1_10 Reverse -38 -55 -12.1542 0.243
NP_440344.1_10 Forward -180 -163 -13.0392 0.273
NP_440531.1_6 Forward -134 -115 5.60432 0.112
NP_440531.1_6 Forward -283 -264 -0.295539 0.209
NP_441335.1_9 Forward -134 -116 16.1446 0.279
NP_440562.1_3 Reverse -118 -135 15.4768 0.0567
NP_441965.1_10 Forward -129 -113 17.2665 0.0412
NP_440297.1_9 Forward -125 -115 -0.118297 0.282
NP_440297.1_9 Reverse -118 -128 -0.314959 0.282
NP_441896.1_3 Forward -135 -116 -2.95047 0.294
NP_440700.1_8 Forward -263 -249 14.4542 0.232
NP_440999.1_9 Reverse -113 -127 6.48943 0.0969
NP_440999.1_9 Forward -130 -116 1.86788 0.157
NP_440999.1_9 Reverse -262 -276 -1.77037 0.249
NP_440888.1_2 Reverse -117 -131 16.3219 0.00724
NP_440888.1_2 Forward -126 -112 5.50552 0.276
NP_440600.1_4 Reverse -109 -127 -0.865831 0.159
NP_442033.1_10 Reverse -115 -134 -9.24366 0.212
NP_441543.1_2 Forward -125 -116 18.486 0.00236
NP_441543.1_2 Reverse -118 -127 15.9293 0.00518
NP_442845.1_2 Forward -132 -118 12.6843 0.104
NP_441551.1_5 Reverse -113 -129 7.62932 0.243
NP_441918.1_7 Forward -310 -291 -2.85214 0.297
NP_441469.1_8 Reverse -116 -125 16.126 0.00797
NP_441469.1_8 Forward -127 -118 6.5879 0.227
NP_442315.1_3 Forward -96 -77 5.89931 0.275
NP_443064.1_6 Reverse -117 -127 10.8217 0.13
NP_442578.1_7 Forward -125 -118 14.5921 0.026
NP_442578.1_7 Reverse -118 -125 14.5921 0.026
NP_440148.1_1 Forward -259 -240 -7.37537 0.285
NP_441462.1_2 Reverse -117 -127 20.2362 0.000805
NP_441462.1_2 Forward -126 -116 11.5831 0.00406
NP_441621.1_7 Reverse -115 -129 4.12949 0.0934
NP_441621.1_7 Forward -128 -114 -3.24533 0.188
NP_441621.1_7 Forward -119 -105 -3.24533 0.188
NP_443062.1_1 Reverse -117 -135 8.93595 0.145
NP_443062.1_1 Reverse -27 -45 5.6207 0.224
NP_443062.1_6 Reverse -109 -128 8.55425 0.142
NP_440519.1_3 Forward -172 -153 11.1109 0.224
NP_442204.1_1 Forward -233 -222 8.31847 0.0977
NP_442204.1_5 Reverse -107 -126 1.27776 0.24
NP_442204.1_5 Forward -136 -117 -0.787193 0.298
NP_440516.1_2 Reverse -111 -129 5.03403 0.134
NP_440516.1_6 Reverse -108 -122 9.83206 0.234
NP_440516.1_8 Forward -126 -117 16.9127 0.00442
NP_440516.1_8 Reverse -117 -126 16.9127 0.00442
NP_442428.1_5 Forward -125 -118 15.8704 0.0124
NP_442428.1_5 Reverse -118 -125 15.8704 0.0124
NP_442428.1_8 Forward -59 -40 -0.000545616 0.258
NP_440603.1_6 Forward -202 -184 13.9821 0.269
NP_440673.1_3 Forward -124 -117 12.4288 0.0426
NP_440673.1_3 Reverse -119 -126 12.4288 0.0426
NP_440673.1_3 Forward -155 -148 6.3323 0.283
NP_441052.1_2 Forward -126 -116 10.5014 0.0285
NP_441052.1_2 Reverse -117 -127 10.4031 0.0285
NP_441052.1_2 Reverse -201 -211 4.20827 0.163
NP_442219.1_9 Forward -125 -116 8.35786 0.0681
NP_442219.1_9 Reverse -118 -127 8.25953 0.0681
NP_440436.1_4 Forward -125 -116 18.1905 0.00233
NP_440436.1_4 Reverse -118 -127 9.24241 0.0871
NP_441884.1_8 Forward -127 -108 -7.86702 0.254
NP_441884.1_9 Forward -129 -110 -5.50708 0.0594
NP_441884.1_9 Reverse -114 -133 -24.2883 0.286
NP_440314.1_9 Reverse -118 -137 13.8641 0.0238
NP_440314.1_9 Reverse -202 -221 -9.53865 0.269
NP_441719.1_2 Forward -99 -85 17.5772 0.191
NP_441719.1_4 Forward -125 -118 16.3621 0.0124
NP_441719.1_4 Reverse -118 -125 16.3621 0.0124
NP_441733.1_10 Forward -129 -116 18.1122 0.0292
NP_441004.1_1 Forward -53 -34 -15.4385 0.275
NP_442813.1_4 Forward -204 -185 1.76941 0.197
NP_442813.1_4 Forward -99 -80 -8.752 0.299
NP_442366.1_5 Reverse -114 -124 15.2208 0.0375
NP_442873.1_5 Reverse -47 -66 8.25844 0.261
NP_440296.1_10 Forward -129 -110 -14.5535 0.27
NP_441115.1_4 Reverse -116 -134 11.1298 0.151
NP_442206.1_4 Reverse -118 -137 7.07928 0.259
NP_442206.1_8 Forward -56 -40 16.0465 0.278
NP_442206.1_10 Forward -126 -111 1.94652 0.212
NP_440328.1_4 Reverse -111 -130 5.99764 0.138
NP_443054.1_2 Reverse -115 -129 3.24451 0.24
NP_443054.1_2 Forward -128 -114 1.76955 0.245
NP_441851.1_10 Reverse -116 -126 16.008 0.00552
NP_441851.1_10 Forward -127 -117 8.53483 0.114
NP_440347.1_9 Forward -137 -118 17.2074 0.173
NP_442622.1_1 Forward -127 -108 -11.8986 0.257
NP_442622.1_8 Forward -126 -108 -18.6637 0.243
NP_442011.1_1 Reverse -116 -135 -1.27885 0.268
NP_442515.1_1 Reverse -116 -130 -2.26202 0.271
NP_442515.1_1 Forward -127 -113 -4.22864 0.298
NP_440593.1_3 Reverse -255 -274 -6.39206 0.273
NP_441046.1_2 Forward -56 -37 -0.4922 0.281
NP_442689.1_2 Forward -128 -109 15.6341 0.212
NP_441349.1_10 Reverse -107 -126 -9.34199 0.289
NP_441349.1_10 Reverse -114 -133 -9.73531 0.297
NP_441409.1_6 Forward -179 -160 -14.5535 0.259
NP_440432.1_9 Reverse -118 -133 5.3881 0.0555
NP_442843.1_1 Forward -125 -106 1.27776 0.168
NP_442843.1_1 Reverse -88 -107 -1.7705 0.202
NP_440474.1_8 Reverse -118 -132 14.0603 0.0658
NP_441150.1_6 Forward -325 -306 13.5683 0.268
NP_442450.1_5 Reverse -115 -125 7.55152 0.13
NP_440588.1_2 Reverse -108 -127 0.491109 0.146
NP_441570.1_1 Forward -126 -108 -4.50408 0.0745
NP_441570.1_1 Reverse -266 -284 -10.3056 0.166
NP_441078.1_4 Forward -126 -117 19.6659 0.0007
NP_441078.1_4 Reverse -117 -126 19.6659 0.0007
NP_441078.1_4 Reverse -201 -210 -1.6719 0.266
NP_442388.1_3 Forward -129 -110 5.70265 0.282
NP_442348.1_2 Forward -55 -46 11.6028 0.232
NP_440526.1_3 Reverse -118 -129 11.6612 0.0646
NP_441432.1_8 Forward -127 -118 16.8143 0.00595
NP_441432.1_8 Reverse -116 -125 8.25953 0.0755
NP_441432.1_8 Forward -276 -267 6.98123 0.112
NP_441333.1_1 Forward -325 -315 15.1171 0.175
NP_442320.1_8 Forward -132 -118 6.29277 0.029
NP_441732.1_2 Reverse -113 -129 -7.70961 0.0885
NP_441732.1_2 Forward -130 -114 -15.1828 0.145
NP_440760.1_1 Forward -126 -107 -5.60541 0.0503
NP_440760.1_1 Reverse -117 -136 -20.7484 0.225
NP_441328.2_8 Reverse -115 -134 16.8132 0.268
NP_442751.1_2 Reverse -44 -63 6.39016 0.221
NP_442489.1_7 Forward -126 -117 20.1576 0.000695
NP_442489.1_7 Reverse -117 -126 20.1576 0.000695
NP_442489.1_7 Reverse -201 -210 -1.37691 0.195
NP_440386.1_3 Forward -183 -164 -7.08038 0.274
NP_440559.1_1 Forward -125 -116 8.75118 0.0586
NP_440559.1_1 Reverse -118 -127 8.65285 0.0586
NP_441659.2_8 Reverse -117 -127 20.9245 0.000805
NP_441659.2_8 Forward -126 -116 11.9764 0.0147
NP_441022.1_1 Forward -261 -252 13.081 0.216
NP_442913.1_10 Forward -135 -116 8.16093 0.0491
NP_442913.1_10 Reverse -108 -127 -3.54046 0.212
NP_442776.1_1 Forward -119 -100 3.83436 0.279
NP_442346.1_5 Forward -127 -117 16.303 0.00248
NP_442346.1_5 Reverse -116 -126 9.02648 0.118
NP_442346.1_5 Reverse -200 -210 4.3066 0.291
NP_440352.1_5 Reverse -302 -321 16.4519 0.0992
NP_440545.1_3 Forward -130 -113 -0.452814 0.154
NP_440545.1_3 Reverse -113 -130 -1.23946 0.165
NP_441856.1_3 Reverse -114 -133 2.0644 0.206
NP_440010.1_3 Forward -66 -47 -7.86702 0.29
NP_442551.1_4 Reverse -198 -213 -1.20007 0.245
NP_442603.1_9 Reverse -80 -98 9.16393 0.214
NP_441888.1_7 Reverse -112 -126 3.73617 0.225
NP_441050.1_5 Forward -191 -173 2.87075 0.211
NP_440449.1_6 Forward -134 -116 4.85163 0.288
NP_441948.1_4 Reverse -110 -128 1.19912 0.133
NP_440170.1_6 Reverse -248 -267 12.1925 0.283
NP_441833.1_4 Forward -125 -118 15.9687 0.0124
NP_441833.1_4 Reverse -118 -125 15.9687 0.0124
NP_441895.1_2 Forward -204 -185 -26.9432 0.275
NP_442060.1_10 Forward -242 -223 9.14423 0.265
NP_442699.1_8 Forward -271 -252 -12.4886 0.253
NP_442162.1_9 Forward -125 -118 16.2637 0.0124
NP_442162.1_9 Reverse -118 -125 16.2637 0.0124
NP_440671.1_4 Forward -36 -22 7.57108 0.214
NP_443026.1_5 Forward -306 -287 -2.55715 0.283
NP_440224.1_1 Forward -137 -118 2.65439 0.132
NP_442943.1_1 Forward -260 -245 4.34977 0.235
NP_440772.1_6 Forward -125 -106 8.45592 0.292
NP_442140.1_3 Forward -125 -115 16.2046 0.0255
NP_442140.1_3 Reverse -118 -128 7.94484 0.124
NP_440875.1_9 Reverse -119 -129 16.8403 0.0145
NP_442547.1_7 Forward -279 -260 14.5051 0.171
NP_441813.1_5 Reverse -115 -125 9.91146 0.021
NP_441813.1_5 Forward -128 -118 8.73149 0.0367
NP_440590.1_4 Forward -125 -112 3.36254 0.0746
NP_440590.1_4 Reverse -118 -131 2.96921 0.0783
NP_440567.1_1 Reverse -118 -132 17.4042 0.0153
NP_440567.1_1 Forward -125 -111 6.19444 0.0871
NP_442497.1_10 Reverse -118 -127 17.601 0.00813
NP_442497.1_10 Forward -125 -116 10.4228 0.0087
NP_440821.1_4 Forward -128 -118 10.7964 0.0146
NP_440821.1_4 Reverse -115 -125 10.2065 0.0163
NP_441239.1_9 Forward -128 -116 17.4436 0.0146
NP_441239.1_9 Reverse -115 -127 12.3303 0.0477
NP_441009.1_9 Reverse -250 -269 23.5006 0.038
NP_440706.1_1 Forward -130 -111 -1.27885 0.258
NP_441727.1_3 Forward -103 -84 8.65258 0.202
NP_440400.1_1 Reverse -29 -48 -2.45958 0.285
NP_441892.1_1 Reverse -108 -125 -6.05768 0.296
NP_440665.1_1 Forward -123 -104 -9.63698 0.244
NP_440604.1_6 Forward -30 -11 -5.31042 0.271
NP_442270.1_9 Reverse -106 -125 -7.86702 0.214
NP_442629.1_3 Forward -59 -40 1.17943 0.284
NP_441874.1_1 Forward -273 -259 8.75105 0.294
NP_441567.1_4 Forward -102 -83 4.81767 0.281
NP_441617.1_6 Forward -298 -279 -7.67036 0.292
NP_440546.1_4 Reverse -117 -127 13.5365 0.0459
NP_440546.1_4 Forward -126 -116 11.8882 0.0679
NP_441230.1_5 Forward -131 -112 1.57275 0.239
NP_440462.1_6 Forward -128 -118 19.4496 0.00371
NP_440462.1_6 Reverse -115 -125 9.02648 0.0498
NP_442340.1_3 Reverse -278 -297 -3.54046 0.207
NP_442340.1_3 Forward -94 -75 -9.24366 0.274
NP_442611.1_1 Reverse -117 -136 5.211 0.181
NP_440868.1_4 Reverse -113 -125 20.2952 0.00865
NP_440868.1_4 Forward -130 -118 9.47875 0.0482
NP_442499.1_3 Reverse -116 -134 7.09898 0.282
NP_441582.1_5 Forward -212 -193 5.89851 0.205
NP_442402.1_4 Reverse -30 -49 -8.26108 0.278
NP_442402.1_6 Reverse -277 -286 13.4711 0.284
NP_442402.1_10 Forward -320 -310 10.501 0.288
NP_441848.1_4 Forward -270 -254 7.83714 0.288
NP_441084.1_6 Reverse -85 -99 12.8346 0.152
NP_441084.1_6 Forward -128 -114 12.3498 0.164
NP_442039.1_4 Forward -125 -118 15.1821 0.0124
NP_442039.1_4 Reverse -118 -125 15.1821 0.0124
NP_442039.1_7 Reverse -308 -318 11.2881 0.257
NP_442039.1_7 Forward -88 -78 7.15819 0.279
NP_442039.1_10 Reverse -257 -275 14.6697 0.227
NP_442829.1_2 Reverse -178 -194 8.62426 0.287
NP_440825.1_7 Forward -125 -115 12.4217 0.155
NP_442837.1_3 Forward -125 -118 15.7721 0.0124
NP_442837.1_3 Reverse -118 -125 15.7721 0.0124
NP_442053.1_1 Forward -126 -117 18.3876 0.0007
NP_442053.1_1 Reverse -117 -126 18.3876 0.0007
NP_440505.1_3 Forward -128 -118 15.418 0.0114
NP_440505.1_3 Reverse -115 -125 6.76487 0.169
NP_441203.1_1 Reverse -118 -137 -13.8652 0.173
NP_442532.1_7 Forward -126 -112 4.52282 0.171
NP_440914.1_1 Reverse -117 -127 16.3248 0.00196
NP_440914.1_1 Forward -126 -116 8.6151 0.186
NP_441011.1_8 Forward -125 -116 16.9127 0.00602
NP_441011.1_8 Reverse -118 -127 16.6177 0.00602
NP_442533.1_1 Reverse -225 -244 -17.0118 0.279
NP_442533.1_6 Forward -126 -117 17.2076 0.00137
NP_442533.1_6 Reverse -117 -126 17.2076 0.00137
NP_442533.1_6 Reverse -201 -210 4.32629 0.184
NP_440263.1_5 Forward -88 -74 11.406 0.294
NP_442322.1_4 Reverse -79 -96 -7.5333 0.284
NP_442229.1_1 Forward -128 -114 9.43874 0.184
NP_441482.1_7 Reverse -111 -125 -10.6202 0.211
NP_439944.1_9 Reverse -118 -128 17.7779 0.00341
NP_441028.1_6 Reverse -257 -267 5.78111 0.243
NP_440116.1_8 Reverse -118 -137 -1.86883 0.122
NP_440115.1_6 Forward -129 -119 7.84651 0.146
NP_441602.1_3 Reverse -112 -131 -0.885524 0.226
NP_441972.1_5 Forward -125 -106 -6.29373 0.229
NP_441972.1_5 Reverse -118 -137 -9.34199 0.283
NP_441106.1_1 Forward -127 -118 18.486 0.0028
NP_441106.1_1 Reverse -116 -125 18.191 0.0028
NP_439903.1_6 Forward -129 -110 9.14342 0.127
NP_441286.1_1 Reverse -116 -128 5.15219 0.0259
NP_441286.1_1 Forward -127 -115 -3.40261 0.145
NP_440670.1_8 Forward -126 -117 18.3876 0.000699
NP_440670.1_8 Reverse -117 -126 18.3876 0.000699
NP_442881.1_7 Reverse -105 -124 19.3707 0.121
NP_440886.1_7 Reverse -116 -126 17.7774 0.0011
NP_440886.1_7 Forward -127 -117 8.04271 0.0805
NP_442614.1_2 Reverse -117 -131 6.29277 0.291
NP_441399.1_6 Reverse -261 -280 11.995 0.239
NP_442072.1_9 Reverse -116 -134 -11.1906 0.0789
NP_442022.1_4 Forward -222 -203 8.65258 0.268
NP_440907.2_8 Reverse -118 -128 19.1541 0.00362
NP_440907.2_8 Forward -125 -115 14.2375 0.0312
NP_442264.1_5 Forward -96 -82 11.0127 0.273
NP_441021.1_8 Reverse -112 -130 2.28076 0.25
NP_440841.1_4 Reverse -85 -104 -4.81876 0.194
NP_441463.1_3 Forward -106 -87 -7.17871 0.255
NP_441626.1_2 Forward -125 -118 15.7721 0.0124
NP_441626.1_2 Reverse -118 -125 15.7721 0.0124
NP_442211.1_3 Reverse -76 -95 8.73642 0.273
NP_442615.1_1 Forward -135 -117 11.4255 0.0179
NP_441962.1_4 Forward -131 -112 -14.6519 0.291
NP_440387.1_1 Forward -126 -110 12.4482 0.0122
NP_440387.1_1 Reverse -117 -133 -0.728113 0.141
NP_441431.1_2 Forward -129 -115 15.0436 0.0537
NP_441431.1_2 Reverse -114 -128 13.4703 0.0891
NP_440114.1_5 Forward -71 -52 21.0423 0.0247
NP_440114.1_10 Reverse -117 -131 18.0925 0.0075
NP_440114.1_10 Forward -126 -112 12.6843 0.0754
NP_441817.1_1 Forward -58 -40 12.7038 0.285
NP_440287.1_5 Forward -249 -230 6.29183 0.292
NP_440287.1_6 Forward -128 -109 3.93269 0.208
NP_441720.1_2 Forward -130 -111 15.0432 0.213
NP_440766.1_4 Forward -130 -116 6.88276 0.097
NP_440766.1_5 Forward -87 -75 7.17833 0.29
NP_442743.1_4 Forward -125 -106 -6.78538 0.279
NP_442930.1_1 Reverse -5 -15 11.4843 0.258
NP_440798.1_6 Forward -125 -112 5.52582 0.14
NP_440798.1_6 Reverse -118 -131 1.9859 0.188
NP_441801.1_4 Forward -171 -161 12.4681 0.201
NP_441984.1_3 Forward -65 -47 6.41066 0.269
NP_442509.1_9 Forward -126 -116 16.2041 0.00739
NP_442509.1_9 Reverse -117 -127 8.04271 0.192
NP_442509.1_9 Forward -210 -200 7.25606 0.229
NP_442514.1_5 Reverse -253 -272 -9.04772 0.294
NP_442514.1_5 Forward -277 -258 -9.14605 0.294
NP_440554.1_4 Reverse -118 -128 15.418 0.0199
NP_440554.1_4 Forward -125 -115 7.35486 0.103
NP_441885.1_5 Forward -126 -116 11.4848 0.00668
NP_441885.1_5 Reverse -117 -127 11.3864 0.00668
NP_442341.1_7 Reverse -116 -130 9.04604 0.0795
NP_442341.1_7 Forward -127 -113 7.17775 0.11
NP_442341.1_9 Reverse -115 -129 5.1122 0.279
NP_441173.1_9 Forward -318 -310 10.9338 0.242
NP_441173.1_9 Reverse -78 -86 10.2454 0.261
NP_440409.1_1 Forward -134 -115 -0.000545616 0.216
NP_440409.1_1 Reverse -109 -128 -0.0988766 0.216
NP_443000.1_7 Forward -128 -118 10.7964 0.0345
NP_443000.1_7 Reverse -115 -125 1.94665 0.226
NP_440076.1_9 Forward -250 -237 15.85 0.288
NP_441842.1_1 Reverse -119 -132 10.3434 0.3
NP_441842.1_10 Forward -133 -119 13.9626 0.0666
NP_440275.1_3 Forward -128 -118 18.6629 0.0082
NP_440275.1_3 Reverse -115 -125 8.33817 0.0602
NP_440091.1_1 Forward -130 -118 3.2839 0.163
NP_440091.1_1 Reverse -113 -125 0.727295 0.233
NP_440679.1_10 Forward -124 -105 -6.49039 0.161
NP_443010.1_10 Forward -129 -112 2.09436 0.283
NP_441359.1_5 Reverse -114 -133 7.07928 0.186
NP_442451.1_2 Reverse -109 -128 2.26107 0.143
NP_440149.1_8 Forward -126 -107 7.47261 0.0628
NP_440216.1_1 Reverse -117 -131 7.9644 0.00737
NP_440216.1_1 Forward -126 -112 -1.18038 0.0301
NP_440216.1_9 Reverse -308 -317 11.9961 0.252
NP_440172.1_1 Reverse -117 -127 17.5813 0.00421
NP_440172.1_1 Forward -126 -116 8.73149 0.0586
NP_442371.1_1 Reverse -310 -320 14.0409 0.191
NP_442015.1_10 Reverse -113 -126 10.7374 0.0391
NP_441226.1_7 Forward -125 -118 14.4934 0.0123
NP_441226.1_7 Reverse -118 -125 14.4934 0.0123
NP_442446.1_3 Forward -138 -119 12.4875 0.223
NP_441111.1_7 Forward -125 -117 18.7023 0.00294
NP_441111.1_7 Reverse -118 -126 18.7023 0.00294
NP_441766.1_2 Forward -126 -117 17.5026 0.00297
NP_441766.1_2 Reverse -117 -126 17.5026 0.00297
NP_440416.1_1 Reverse -117 -136 -4.32711 0.128
NP_443052.1_8 Forward -136 -117 -1.27885 0.0786
NP_443052.1_9 Reverse -41 -60 2.0644 0.177
NP_443052.1_9 Reverse -44 -63 -6.88371 0.289
NP_442403.1_9 Forward -108 -89 2.16274 0.288
NP_441430.1_2 Reverse -259 -278 1.47442 0.144
NP_442564.1_10 Reverse -305 -319 8.94771 0.296
NP_440261.1_5 Reverse -118 -131 8.27909 0.0273
NP_440261.1_5 Forward -125 -112 -2.53732 0.0924
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

TAAAGGAAGGAAGACGGTTTTATTATCCTGACCTGTTGGTAACTTGTGACGAAAGAGATGCTCCGAGCCAGGCATTTGTTAATTTTCCCAGGGTGATTATTGAGGTTTTGTCGGAATCCACAGAAGGCTTTGACCGGGGCAAAAAGTTTCAGGATTACCGCACCCTGCCCAGTTTATGGGCGTATATTTTGGTCAACGCCCAGCAGTATTTGGTGGAGTGTTTTCAGCGGACTCCCCAGGATTTTTGGTTGCTGAAGTCCTATGAGGGTCTAGAGGCGATCGCCGACATTGAGGCGCTTAATTTAGCCATTCCTTTGGCGGAAATTTATGCCACCCTGAATCTGCCGGCATTGGTGGATGAAGTTGGCATGGAGACTGATTTAACGTAAATATTGTCCTG

CDS

ATGACAAAAATTTTCGCTGATTCTTCTATTAATCCCCTCAGTGTGGCCCCAATGATGGACCATACTGATCGCCATTTTCGCTATTTTCTACGGCAGTTAACCCGCCACACCCTGTTGTACACAGAAATGATTACGGCCCAGGCCATCCTCCACGGCGATCGCCAGAGGTTATTAAATTTTAGCCCGGAGGAAAAACCCGTAGCGTTGCAATTGGGGGGCGATGATCCCCAACTCCTAGCGGAATGTGCCCGCATTGGCCAGGATTGGGGATATGACGAAATTAACTTGAATGTGGGCTGTCCCAGCGATCGGGTGCAGAGCGGCAATTTTGGGGCTTGTTTAATGGCTCAACCGGATTTGGTAGCCCAATGTGTGAGTGCAATGCAAAAGGCCGTGGAAATTCCCGTCACCGTTAAACATCGCATTGGCATTGATCATCGGGACAGTTATGAAGATTTAGTGCATTTTGTCGAAATCGTGGCAAACGCTGGCTGTCAAAGATTCACTGTCCATGCCCGTAAAGCCTGGCTCCAGGGGCTTAGTCCCAAGGAAAACCGAACCATTCCTCCCCTACGTTACGAAGATGTTTATCAATTAAAAAAGGATTTTCCCCAGTTATTGATCGAAATTAATGGCGGTATCACCCAAACTGAGCAAATTCAACAGCATCTTAGCCATGTGGATGCAGTGATGGTGGGCCGAGCCGCCTACGAAAATCCCTACCTTTTCGCCACCGTAGACCGGGACATTTACCACAAAACCAATTTAGTCCCCAGCCGAGCGGAAATTATTGAACGTATGTTGCCCTATGTGGAAGAGCGTTTACGTCACGGCGATCGCCTTAATCAAATTACCAGGCATTTATTGAGTTTGTTCAATGGTCAACCCAGGGCTAAATTTTGGCGTCGTACCCTGAGTGATTCCACTCTATTGGCTTCTGCAGGGCCGGAGCTATTACAAACAGCCCTCCAAGCCCAAAAATTCCCAGGGGTATTGGTAGCATAG

Protein

MTKIFADSSINPLSVAPMMDHTDRHFRYFLRQLTRHTLLYTEMITAQAILHGDRQRLLNFSPEEKPVALQLGGDDPQLLAECARIGQDWGYDEINLNVGCPSDRVQSGNFGACLMAQPDLVAQCVSAMQKAVEIPVTVKHRIGIDHRDSYEDLVHFVEIVANAGCQRFTVHARKAWLQGLSPKENRTIPPLRYEDVYQLKKDFPQLLIEINGGITQTEQIQQHLSHVDAVMVGRAAYENPYLFATVDRDIYHKTNLVPSRAEIIERMLPYVEERLRHGDRLNQITRHLLSLFNGQPRAKFWRRTLSDSTLLASAGPELLQTALQAQKFPGVLVA