Your browser is old and dusty. Try Google Chrome!

Details for sll0924

ORF sll0924
Accession NP_440212.1
Symbol
Category hypothetical protein
Definition Hypothetical
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -368 -382 2.94952 0.168
NP_440795.1_7 Forward -336 -329 11.7405 0.0778
NP_440795.1_7 Forward -169 -162 10.8555 0.132
NP_441418.1_6 Reverse -149 -168 -22.6167 0.182
NP_441418.1_6 Reverse -264 -283 -29.6965 0.234
NP_440897.1_6 Forward -58 -39 8.55343 0.0706
NP_441453.1_1 Forward -280 -262 11.0314 0.122
NP_441453.1_4 Reverse -49 -57 6.80426 0.121
NP_441453.1_4 Reverse -328 -336 4.73931 0.252
NP_441453.1_4 Reverse -367 -375 4.24765 0.259
NP_442151.1_6 Forward -58 -44 10.3243 0.125
NP_442151.1_6 Reverse -161 -175 7.9644 0.184
NP_442151.1_6 Forward -52 -38 6.48943 0.233
NP_442151.1_6 Reverse -43 -57 5.50613 0.274
NP_441818.1_1 Forward -57 -46 14.6111 0.0477
NP_440259.1_4 Reverse -194 -208 11.046 0.262
NP_440996.1_3 Reverse -251 -269 10.4422 0.247
NP_441976.1_1 Forward -226 -207 13.2741 0.162
NP_442173.1_1 Forward -57 -49 5.72262 0.203
NP_442173.1_1 Reverse -50 -58 4.54265 0.27
NP_442752.1_4 Reverse -49 -56 13.8055 0.0199
NP_443027.1_4 Reverse -47 -57 10.2065 0.138
NP_443027.1_4 Forward -339 -329 6.46988 0.275
NP_440784.1_7 Reverse -162 -169 9.67555 0.104
NP_440784.1_7 Reverse -50 -57 6.23397 0.241
NP_440784.1_7 Forward -57 -50 6.13563 0.241
NP_442062.1_8 Reverse -49 -59 14.533 0.0128
NP_442062.1_8 Forward -376 -366 6.56821 0.123
NP_440761.1_4 Reverse -323 -342 -11.6036 0.189
NP_441859.1_3 Reverse -48 -67 2.55527 0.258
NP_442242.1_4 Forward -57 -50 10.8555 0.127
NP_440044.1_8 Forward -57 -38 2.45773 0.15
NP_440044.1_8 Reverse -191 -210 -3.63879 0.288
NP_439918.1_2 Forward -382 -363 1.67108 0.211
NP_441210.1_3 Reverse -34 -53 12.2908 0.276
NP_442110.1_7 Reverse -328 -342 3.93283 0.209
NP_442110.1_7 Forward -58 -44 1.17956 0.236
NP_441083.1_5 Reverse -360 -370 2.04498 0.195
NP_441083.1_5 Forward -58 -48 1.65166 0.2
NP_441083.1_5 Reverse -49 -59 0.0783647 0.245
NP_442827.1_8 Forward -66 -47 -2.8529 0.29
NP_441738.1_2 Forward -56 -49 15.28 0.0102
NP_441558.1_5 Forward -54 -35 11.8975 0.0751
NP_440209.1_1 Reverse -49 -57 8.57422 0.0425
NP_440209.1_1 Reverse -264 -272 5.32929 0.139
NP_440209.1_1 Forward -58 -50 5.23096 0.145
NP_440655.1_2 Forward -336 -317 2.55606 0.293
NP_442889.1_8 Forward -61 -47 6.19383 0.199
NP_442889.1_8 Reverse -364 -378 3.53891 0.275
NP_440447.1_1 Reverse -44 -62 7.00065 0.194
NP_440056.1_9 Reverse -248 -267 13.5798 0.295
NP_442570.1_3 Forward -385 -366 -5.80207 0.25
NP_440538.1_10 Reverse -365 -384 11.1109 0.268
NP_441716.1_1 Reverse -225 -239 5.50613 0.227
NP_441716.1_1 Reverse -43 -57 2.94952 0.284
NP_441716.1_1 Forward -58 -44 2.85119 0.289
NP_442111.1_4 Reverse -48 -62 6.58777 0.12
NP_442111.1_4 Reverse -305 -319 2.85119 0.263
NP_442111.1_4 Reverse -327 -341 2.35953 0.28
NP_440906.1_5 Reverse -329 -336 9.47889 0.116
NP_440906.1_5 Forward -272 -265 8.20058 0.19
NP_440906.1_5 Reverse -265 -272 8.20058 0.19
NP_440906.1_5 Reverse -50 -57 6.23397 0.234
NP_440906.1_5 Forward -57 -50 6.13563 0.241
NP_440747.1_10 Reverse -46 -58 -11.9574 0.178
NP_441486.1_1 Reverse -364 -378 9.63603 0.025
NP_441486.1_1 Reverse -46 -60 5.99778 0.0344
NP_441486.1_1 Forward -379 -365 4.32615 0.0462
NP_441486.1_1 Forward -55 -41 -5.90027 0.266
NP_440944.1_2 Reverse -252 -271 -2.75381 0.28
NP_442634.1_4 Reverse -326 -340 3.53951 0.105
NP_442634.1_4 Forward -73 -59 -3.93365 0.176
NP_440057.1_6 Reverse -375 -394 12.2293 0.279
NP_441014.1_10 Reverse -189 -208 2.55527 0.216
NP_442848.1_1 Reverse -43 -57 -1.47537 0.263
NP_443018.1_3 Reverse -50 -57 12.6255 0.0471
NP_443018.1_3 Reverse -44 -51 10.6589 0.0967
NP_443018.1_3 Forward -57 -50 5.25066 0.214
NP_443018.1_3 Forward -375 -368 4.26735 0.267
NP_443018.1_3 Forward -51 -44 4.16902 0.278
NP_443018.1_3 Reverse -368 -375 4.16902 0.278
NP_443018.1_3 Forward -169 -162 4.07068 0.299
NP_440376.1_1 Forward -376 -367 4.52295 0.156
NP_440376.1_1 Reverse -101 -110 2.55633 0.218
NP_440376.1_1 Reverse -49 -58 0.0980582 0.285
NP_440376.1_1 Forward -383 -374 -0.000272808 0.285
NP_440376.1_1 Forward -58 -49 -0.196935 0.285
NP_441588.1_4 Forward -374 -364 6.66654 0.185
NP_441588.1_4 Reverse -369 -379 6.37155 0.2
NP_441588.1_4 Forward -271 -261 6.07655 0.214
NP_442687.1_7 Reverse -160 -170 10.5014 0.0994
NP_442485.1_3 Reverse -338 -357 -0.590531 0.253
NP_440892.1_3 Forward -119 -100 21.0423 0.0186
NP_442530.1_2 Reverse -29 -39 12.3697 0.276
NP_440642.1_10 Forward -20 -6 1.37564 0.293
NP_440741.1_3 Reverse -100 -119 1.0811 0.169
NP_440141.1_8 Forward -176 -157 5.60432 0.273
NP_440662.1_2 Forward -213 -194 -5.60541 0.298
NP_442782.1_7 Reverse -41 -60 2.55606 0.193
NP_441414.1_9 Forward -52 -33 2.75272 0.0631
NP_441414.1_9 Forward -273 -254 -2.55715 0.119
NP_441487.1_7 Reverse -358 -377 9.83255 0.215
NP_439959.1_3 Forward -162 -143 10.4225 0.242
NP_442937.1_5 Reverse -191 -210 8.65258 0.216
NP_442937.1_5 Forward -381 -362 7.86593 0.241
NP_441958.1_5 Forward -59 -49 0.865012 0.12
NP_441958.1_5 Reverse -100 -110 -1.29827 0.236
NP_441958.1_5 Reverse -48 -58 -6.31315 0.28
NP_440203.1_5 Forward -55 -45 14.8275 0.0886
NP_440995.1_8 Forward -68 -49 -0.885524 0.288
NP_439990.1_5 Reverse -259 -272 5.32916 0.298
NP_442376.1_2 Forward -163 -144 -7.67036 0.286
NP_442376.1_2 Reverse -148 -167 -7.67036 0.286
NP_440153.1_5 Forward -57 -43 0.392915 0.299
NP_440153.1_8 Forward -154 -141 -3.12731 0.285
NP_440858.1_1 Forward -218 -199 -4.03212 0.27
NP_442064.1_1 Forward -63 -44 -2.95047 0.146
NP_443055.1_6 Forward -178 -160 1.00172 0.237
NP_441099.1_5 Reverse -350 -369 -8.26035 0.191
NP_442002.1_9 Reverse -100 -107 13.0188 0.185
NP_441938.1_6 Reverse -251 -270 11.9958 0.206
NP_441294.1_7 Reverse -363 -377 13.8581 0.0551
NP_442438.1_10 Forward -210 -196 -0.295402 0.256
NP_441000.1_6 Forward -171 -157 2.94952 0.123
NP_440484.1_3 Reverse -326 -340 8.55439 0.298
NP_441175.1_2 Reverse -181 -200 6.29264 0.272
NP_441550.1_8 Forward -60 -50 5.19112 0.26
NP_441916.1_7 Forward -376 -366 4.10993 0.19
NP_441547.1_2 Reverse -38 -56 9.45892 0.197
NP_442004.1_6 Forward -58 -44 1.57289 0.285
NP_440703.1_9 Reverse -1 -14 6.11523 0.288
NP_441725.1_5 Forward -57 -47 1.455 0.135
NP_441725.1_5 Reverse -50 -60 0.766681 0.149
NP_441725.1_5 Reverse -162 -172 -0.609952 0.265
NP_439966.1_7 Reverse -47 -57 6.0761 0.195
NP_439966.1_7 Reverse -159 -169 5.19112 0.24
NP_442941.1_3 Forward -57 -47 10.1081 0.024
NP_442281.1_1 Reverse -44 -58 2.16228 0.276
NP_442281.1_1 Reverse -369 -383 1.96562 0.282
NP_442281.1_1 Reverse -362 -376 1.5723 0.296
NP_442256.1_2 Forward -60 -42 -8.33898 0.221
NP_441644.1_6 Reverse -367 -377 3.8145 0.261
NP_441644.1_6 Reverse -49 -59 3.61784 0.272
NP_443049.1_6 Reverse -48 -58 13.8856 0.139
NP_443049.1_6 Forward -171 -161 13.4952 0.162
NP_441071.1_2 Forward -43 -24 14.6576 0.279
NP_441071.1_2 Reverse -31 -50 14.4666 0.279
NP_441071.1_2 Reverse -33 -52 12.7478 0.291
NP_442215.1_2 Reverse -365 -381 -3.8747 0.223
NP_442215.1_2 Reverse -358 -374 -4.1697 0.228
NP_442215.1_2 Reverse -159 -175 -4.1697 0.228
NP_442215.1_2 Forward -60 -44 -6.13632 0.264
NP_440929.1_8 Forward -58 -49 7.76787 0.0533
NP_440929.1_8 Reverse -49 -58 7.66954 0.0624
NP_442933.1_1 Forward -36 -17 8.35512 0.253
NP_442933.1_10 Forward -58 -49 6.48957 0.119
NP_442933.1_10 Forward -376 -367 5.01461 0.204
NP_442648.1_1 Forward -50 -31 8.75091 0.248
NP_442926.1_3 Reverse -317 -336 1.86774 0.298
NP_442554.1_8 Forward -51 -41 8.53483 0.074
NP_442554.1_8 Forward -57 -47 6.07655 0.126
NP_442554.1_8 Reverse -368 -378 4.79825 0.173
NP_442554.1_8 Reverse -162 -172 3.61828 0.218
NP_441762.1_7 Forward -171 -159 -5.86088 0.246
NP_442142.1_4 Forward -173 -160 4.64028 0.214
NP_442292.1_1 Forward -57 -48 8.65285 0.0335
NP_442292.1_1 Reverse -368 -377 6.09625 0.116
NP_442292.1_1 Forward -51 -42 5.21127 0.152
NP_442292.1_1 Reverse -50 -59 -0.786921 0.287
NP_441264.1_5 Forward -126 -107 39.1352 0.000000468
NP_443009.1_5 Reverse -48 -59 4.97473 0.222
NP_443009.1_5 Reverse -263 -274 4.48308 0.244
NP_441715.1_4 Forward -57 -47 4.99491 0.24
NP_441448.1_2 Reverse -369 -388 7.57013 0.134
NP_440183.1_1 Forward -336 -317 8.84924 0.244
NP_441468.1_1 Reverse -50 -57 6.13563 0.209
NP_441468.1_1 Forward -57 -50 6.0373 0.223
NP_441468.1_1 Forward -375 -368 4.36568 0.237
NP_441468.1_1 Forward -169 -162 4.07068 0.263
NP_441468.1_1 Reverse -44 -51 3.97235 0.277
NP_441020.2_6 Forward -164 -147 11.2486 0.124
NP_441020.2_6 Forward -129 -112 6.43035 0.262
NP_441015.1_8 Forward -206 -187 -0.39387 0.292
NP_441015.1_10 Forward -169 -150 -6.88371 0.258
NP_441673.1_1 Reverse -49 -58 1.37636 0.114
NP_441673.1_1 Forward -58 -49 1.1797 0.163
NP_441826.1_2 Reverse -43 -57 4.22782 0.104
NP_441826.1_5 Forward -327 -308 0.491109 0.3
NP_441637.1_8 Reverse -192 -209 10.9536 0.237
NP_442868.1_6 Reverse -47 -57 0.176696 0.247
NP_442719.1_2 Reverse -334 -352 7.49153 0.118
NP_442808.1_1 Reverse -160 -170 6.66608 0.102
NP_442808.1_1 Reverse -366 -376 6.0761 0.131
NP_441101.1_10 Forward -235 -216 -5.31042 0.281
NP_442820.1_3 Reverse -199 -209 18.7607 0.159
NP_442050.1_5 Reverse -47 -57 6.76441 0.282
NP_442342.1_9 Reverse -159 -175 5.76173 0.233
NP_440346.1_6 Reverse -381 -391 14.1473 0.273
NP_441114.1_3 Reverse -335 -344 7.66954 0.231
NP_440558.1_2 Forward -346 -327 -4.6221 0.247
NP_441498.1_3 Reverse -33 -51 10.8348 0.214
NP_441878.1_6 Forward -171 -161 1.74999 0.0642
NP_441878.1_6 Forward -59 -49 0.57002 0.14
NP_441878.1_6 Reverse -189 -199 -0.0199663 0.163
NP_441878.1_6 Forward -377 -367 -7.39479 0.222
NP_441878.1_6 Reverse -100 -110 -7.49312 0.231
NP_441878.1_6 Reverse -121 -131 -7.98478 0.285
NP_441036.1_8 Forward -274 -264 6.37155 0.234
NP_441557.1_5 Forward -58 -49 7.57121 0.049
NP_441557.1_5 Reverse -49 -58 1.08137 0.0794
NP_441557.1_5 Forward -376 -367 -0.590259 0.219
NP_442066.2_4 Forward -383 -364 -8.16202 0.294
NP_441739.1_2 Reverse -374 -390 3.20445 0.281
NP_442183.1_1 Reverse -101 -115 4.42448 0.261
NP_442183.1_3 Forward -118 -99 14.7483 0.243
NP_442347.1_2 Forward -57 -48 12.2911 0.056
NP_442347.1_2 Forward -368 -359 3.7363 0.284
NP_442645.1_2 Forward -384 -365 -16.2252 0.227
NP_441037.1_4 Forward -172 -162 6.63549 0.25
NP_441037.1_4 Forward -60 -50 6.53804 0.255
NP_441633.1_3 Reverse -159 -172 -3.71729 0.177
NP_440136.1_2 Reverse -50 -57 6.23397 0.171
NP_440136.1_2 Forward -57 -50 6.13563 0.193
NP_442998.1_5 Forward -209 -199 9.51814 0.238
NP_442998.1_5 Reverse -29 -39 7.64985 0.287
NP_442998.1_10 Forward -56 -49 15.5754 0.0102
NP_442998.1_10 Forward -271 -264 5.74231 0.255
NP_440299.1_1 Reverse -45 -58 7.59019 0.109
NP_440299.1_1 Forward -277 -264 2.67367 0.279
NP_441799.1_1 Forward -174 -160 3.73557 0.284
NP_441799.1_1 Reverse -363 -377 3.44058 0.298
NP_441007.1_10 Forward -175 -162 1.69091 0.203
NP_440256.1_1 Reverse -98 -117 -7.08038 0.228
NP_440456.1_7 Forward -212 -198 10.7177 0.285
NP_441559.1_8 Reverse -157 -171 -6.98191 0.281
NP_440717.1_1 Reverse -307 -326 4.52268 0.296
NP_441704.1_8 Reverse -38 -57 16.6165 0.0783
NP_440134.1_2 Reverse -47 -66 -0.39387 0.298
NP_442452.1_8 Reverse -43 -57 15.3386 0.273
NP_441464.1_8 Reverse -49 -63 5.1128 0.26
NP_442386.1_9 Reverse -366 -375 13.1756 0.0406
NP_442386.1_9 Reverse -160 -169 6.78414 0.219
NP_442386.1_9 Reverse -42 -51 6.68581 0.219
NP_442386.1_9 Forward -53 -44 4.62087 0.294
NP_442054.1_1 Forward -142 -123 19.174 0.00168
NP_442054.1_2 Forward -164 -145 8.35759 0.0296
NP_442054.1_3 Forward -119 -100 32.4487 0.0000143
NP_441750.1_1 Reverse -319 -338 -5.40875 0.21
NP_441340.1_5 Forward -51 -44 11.3472 0.0526
NP_441340.1_5 Reverse -50 -57 6.23397 0.132
NP_441340.1_5 Forward -57 -50 5.84064 0.208
NP_441340.1_5 Reverse -368 -375 4.07068 0.239
NP_441340.1_9 Reverse -28 -38 8.25522 0.256
NP_441297.1_10 Reverse -244 -263 18.6974 0.191
NP_442714.1_5 Reverse -2 -21 6.39097 0.238
NP_440586.1_8 Reverse -50 -57 14.69 0.026
NP_440586.1_8 Reverse -368 -375 7.70858 0.227
NP_440586.1_8 Forward -169 -162 7.41359 0.251
NP_440586.1_8 Reverse -44 -51 5.74197 0.283
NP_442251.1_6 Forward -57 -50 12.0355 0.0627
NP_440684.1_9 Forward -382 -368 8.25939 0.233
NP_441262.1_3 Reverse -49 -56 14.7888 0.0223
NP_441262.1_3 Forward -273 -266 5.15232 0.265
NP_443051.1_1 Forward -59 -50 6.19458 0.0849
NP_443051.1_1 Reverse -48 -57 0.884706 0.125
NP_439937.1_9 Forward -59 -42 -15.4981 0.287
NP_440398.1_6 Reverse -202 -221 4.32602 0.275
NP_440372.1_2 Reverse -50 -57 6.82395 0.0854
NP_440372.1_2 Forward -57 -50 6.52896 0.188
NP_440819.1_5 Forward -46 -38 7.68924 0.266
NP_440316.1_10 Forward -171 -161 7.25653 0.251
NP_441803.1_2 Reverse -301 -320 0.58944 0.249
NP_439977.1_5 Reverse -322 -341 -3.3438 0.299
NP_440139.1_1 Reverse -155 -174 4.12856 0.19
NP_442384.1_10 Forward -58 -45 0.510939 0.289
NP_441018.1_7 Forward -387 -368 13.3725 0.136
NP_442262.1_10 Reverse -50 -57 12.9205 0.0422
NP_442262.1_10 Reverse -44 -51 12.0355 0.062
NP_441689.1_5 Reverse -47 -57 5.78111 0.197
NP_440344.1_10 Reverse -132 -149 -13.8258 0.296
NP_440531.1_6 Forward -384 -365 -5.21209 0.294
NP_441640.1_8 Reverse -44 -63 7.96426 0.103
NP_440297.1_9 Reverse -50 -60 0.176696 0.282
NP_440297.1_9 Reverse -162 -172 0.0783647 0.282
NP_440297.1_9 Forward -57 -47 -0.511621 0.289
NP_440894.1_10 Forward -63 -44 3.53937 0.271
NP_440999.1_9 Reverse -157 -171 6.19444 0.101
NP_440999.1_9 Reverse -305 -319 1.86788 0.157
NP_441748.1_9 Forward -20 -1 9.04509 0.185
NP_440575.1_8 Reverse -33 -52 2.45773 0.166
NP_441543.1_2 Reverse -307 -316 10.1278 0.0788
NP_441543.1_2 Forward -336 -327 8.25953 0.104
NP_441543.1_2 Forward -57 -48 7.07956 0.131
NP_441543.1_2 Reverse -368 -377 5.21127 0.209
NP_442845.1_2 Forward -58 -44 11.3077 0.131
NP_442845.1_2 Reverse -43 -57 6.3911 0.21
NP_442845.1_2 Forward -382 -368 5.30946 0.237
NP_441469.1_8 Forward -171 -162 8.94785 0.227
NP_442637.1_3 Forward -79 -60 5.11266 0.202
NP_443064.1_6 Reverse -101 -111 9.94905 0.187
NP_442578.1_7 Reverse -50 -57 14.6904 0.026
NP_442286.1_1 Forward -34 -15 7.17762 0.285
NP_441462.1_2 Reverse -49 -59 1.94665 0.0807
NP_441462.1_2 Reverse -101 -111 -1.10161 0.281
NP_441462.1_5 Forward -211 -192 4.03102 0.285
NP_443062.1_1 Reverse -231 -249 9.42349 0.134
NP_442204.1_1 Reverse -45 -56 7.92515 0.108
NP_442204.1_5 Forward -325 -306 3.24438 0.193
NP_442204.1_5 Reverse -39 -58 0.196116 0.27
NP_440516.1_2 Forward -64 -46 -0.0791831 0.243
NP_440516.1_8 Reverse -49 -58 1.08137 0.129
NP_440516.1_8 Forward -170 -161 -0.491928 0.262
NP_441033.1_2 Reverse -151 -170 -1.96717 0.145
NP_442428.1_5 Reverse -50 -57 6.13563 0.209
NP_442428.1_5 Forward -57 -50 6.0373 0.212
NP_442428.1_5 Forward -375 -368 4.66067 0.244
NP_442428.1_5 Forward -169 -162 4.56234 0.249
NP_442428.1_5 Reverse -44 -51 4.36568 0.271
NP_442428.1_5 Reverse -329 -336 3.77569 0.277
NP_441443.1_1 Forward -171 -152 1.0811 0.218
NP_442120.1_10 Forward -315 -296 -8.26035 0.23
NP_441867.1_2 Reverse -13 -32 -14.0619 0.277
NP_440673.1_3 Forward -56 -49 12.4288 0.0426
NP_440673.1_3 Reverse -163 -170 9.38056 0.192
NP_441052.1_2 Reverse -161 -171 5.68323 0.107
NP_441052.1_2 Forward -58 -48 1.55333 0.238
NP_441052.1_2 Forward -315 -305 1.455 0.244
NP_442219.1_9 Forward -57 -48 7.96454 0.0696
NP_442219.1_9 Reverse -226 -235 2.85133 0.218
NP_440436.1_4 Forward -272 -263 10.7174 0.0743
NP_440436.1_4 Forward -57 -48 7.57079 0.124
NP_440436.1_4 Reverse -368 -377 4.81753 0.239
NP_442577.1_7 Reverse -379 -398 9.34008 0.199
NP_441719.1_4 Reverse -50 -57 13.5105 0.026
NP_441719.1_4 Forward -57 -50 6.52896 0.188
NP_442813.1_5 Reverse -214 -233 1.96607 0.276
NP_442366.1_3 Reverse -366 -384 -1.25915 0.208
NP_442366.1_3 Forward -59 -41 -1.25915 0.208
NP_442366.1_3 Forward -384 -366 -4.50408 0.272
NP_442366.1_3 Forward -323 -305 -4.70074 0.275
NP_443054.1_2 Reverse -372 -386 7.47274 0.153
NP_441851.1_10 Reverse -48 -58 11.6814 0.0659
NP_441851.1_10 Forward -59 -49 6.07655 0.187
NP_441851.1_10 Forward -377 -367 5.97822 0.19
NP_442011.1_1 Forward -377 -358 -0.4922 0.268
NP_441668.1_4 Reverse -33 -52 -2.65548 0.293
NP_442515.1_1 Reverse -48 -62 4.91614 0.107
NP_441982.1_6 Forward -268 -259 15.2546 0.274
NP_440165.1_5 Forward -128 -109 -8.26035 0.297
NP_441046.1_2 Reverse -253 -272 -1.7705 0.292
NP_441349.1_10 Reverse -39 -58 -0.688862 0.0958
NP_441349.1_10 Reverse -145 -164 -4.32711 0.167
NP_441349.1_10 Forward -137 -118 -5.60541 0.207
NP_441394.1_4 Forward -212 -193 11.1109 0.2
NP_440396.1_10 Reverse -335 -351 12.8408 0.153
NP_442450.1_5 Forward -60 -50 6.66654 0.16
NP_442450.1_5 Reverse -47 -57 6.07655 0.204
NP_440588.1_2 Reverse -40 -59 3.53937 0.0988
NP_440588.1_2 Reverse -152 -171 -5.70374 0.259
NP_440588.1_3 Forward -200 -181 10.4225 0.253
NP_440943.1_4 Forward -119 -107 17.1486 0.0959
NP_442006.1_2 Reverse -1 -18 -9.59759 0.197
NP_442243.1_1 Reverse -43 -61 7.58986 0.178
NP_441570.1_1 Forward -358 -340 -14.6322 0.226
NP_441078.1_4 Reverse -49 -58 0.196389 0.205
NP_441078.1_4 Forward -58 -49 -0.000272808 0.205
NP_441078.1_4 Forward -170 -161 -1.86856 0.272
NP_441078.1_4 Forward -376 -367 -1.96689 0.282
NP_442348.1_2 Forward -383 -374 10.6195 0.259
NP_442443.1_4 Reverse -4 -14 18.1707 0.14
NP_440793.1_1 Forward -36 -22 9.43874 0.293
NP_440526.1_3 Reverse -162 -173 1.13984 0.267
NP_440526.1_3 Reverse -368 -379 0.844851 0.267
NP_441432.1_8 Forward -377 -368 11.3078 0.0569
NP_441432.1_8 Reverse -48 -57 7.27622 0.101
NP_441432.1_8 Forward -338 -329 2.65466 0.292
NP_441432.1_8 Reverse -333 -342 2.55633 0.298
NP_441432.1_8 Forward -171 -162 2.55633 0.298
NP_442320.1_8 Reverse -43 -57 3.53951 0.0594
NP_440760.1_1 Reverse -49 -68 -16.1268 0.166
NP_440199.1_10 Reverse -46 -56 15.5163 0.0861
NP_440199.1_10 Forward -55 -45 7.25653 0.231
NP_441072.1_2 Forward -387 -368 13.7658 0.159
NP_442489.1_7 Forward -58 -49 7.47288 0.0613
NP_442489.1_7 Reverse -49 -58 0.688044 0.152
NP_442489.1_7 Forward -376 -367 -1.47524 0.203
NP_442489.1_7 Forward -170 -161 -1.57357 0.213
NP_442489.1_7 Reverse -118 -127 -1.86856 0.259
NP_442489.1_7 Reverse -101 -110 -1.86856 0.259
NP_440559.1_1 Reverse -50 -59 13.3727 0.0401
NP_440559.1_1 Forward -57 -48 7.76787 0.0918
NP_440559.1_1 Forward -272 -263 4.71961 0.217
NP_440559.1_1 Forward -51 -42 4.12963 0.295
NP_441659.2_8 Reverse -49 -59 6.46988 0.0744
NP_441659.2_8 Reverse -367 -377 4.50326 0.132
NP_441022.1_1 Reverse -32 -41 13.2728 0.216
NP_441022.1_1 Forward -43 -34 13.2728 0.216
NP_441022.1_1 Forward -264 -255 10.8747 0.284
NP_439956.1_7 Forward -388 -369 2.94938 0.265
NP_442346.1_5 Forward -72 -62 6.27322 0.208
NP_442346.1_5 Reverse -48 -58 6.27322 0.208
NP_442346.1_5 Forward -377 -367 5.87989 0.225
NP_442346.1_5 Forward -171 -161 5.38824 0.248
NP_442346.1_5 Reverse -263 -273 4.3066 0.291
NP_440352.1_5 Forward -56 -37 15.2838 0.13
NP_440352.1_5 Reverse -20 -39 10.417 0.275
NP_440831.1_3 Reverse -152 -171 5.61052 0.28
NP_440004.1_8 Reverse -334 -353 14.2566 0.259
NP_440459.1_2 Forward -385 -368 8.59364 0.254
NP_442551.1_4 Forward -345 -330 -2.38005 0.259
NP_442603.1_7 Forward -58 -44 9.43874 0.146
NP_441888.1_9 Forward -376 -357 15.1413 0.26
NP_441047.1_2 Reverse -368 -387 0.687771 0.239
NP_441833.1_4 Forward -57 -50 6.52896 0.0924
NP_441833.1_4 Reverse -50 -57 6.23397 0.163
NP_442799.1_2 Reverse -41 -60 5.99764 0.18
NP_442699.1_8 Forward -299 -280 -12.0953 0.238
NP_442162.1_9 Reverse -50 -57 6.62729 0.142
NP_442162.1_9 Forward -57 -50 6.52896 0.178
NP_440671.1_4 Reverse -43 -57 5.99778 0.266
NP_440671.1_4 Reverse -95 -109 4.91614 0.3
NP_440224.1_1 Reverse -38 -57 -1.67217 0.181
NP_442140.1_3 Forward -375 -365 5.38824 0.211
NP_442140.1_3 Forward -169 -159 5.28991 0.216
NP_442140.1_3 Reverse -50 -60 5.28991 0.216
NP_442021.1_3 Forward -315 -296 -5.21209 0.254
NP_441813.1_5 Reverse -47 -57 6.17489 0.1
NP_441813.1_5 Reverse -159 -169 -0.216628 0.237
NP_440590.1_4 Forward -57 -44 3.06754 0.0772
NP_440590.1_4 Forward -272 -259 -2.04567 0.235
NP_440590.1_4 Forward -239 -226 -2.63565 0.247
NP_440567.1_1 Forward -57 -43 12.586 0.0225
NP_440567.1_1 Forward -375 -361 1.76955 0.194
NP_442497.1_10 Reverse -50 -59 8.25953 0.047
NP_442497.1_10 Forward -57 -48 0.589713 0.153
NP_442497.1_10 Reverse -162 -171 0.196389 0.208
NP_440821.1_4 Reverse -47 -57 8.53483 0.0468
NP_440821.1_4 Forward -60 -50 0.57002 0.169
NP_441239.1_9 Reverse -159 -171 8.39711 0.134
NP_441239.1_9 Forward -112 -100 5.64384 0.213
NP_441017.1_6 Reverse -45 -59 17.8952 0.0431
NP_440833.1_6 Forward -264 -250 6.98048 0.292
NP_442216.1_2 Forward -128 -109 19.764 0.000859
NP_440212.1_1 Forward -136 -117 38.9385 0.00000153
NP_440212.1_2 Forward -115 -98 31.7997 0.000168
NP_440212.1_3 Forward -157 -138 30.4821 0.00012
NP_440212.1_4 Forward -177 -159 19.2497 0.187
NP_440212.1_5 Forward -63 -44 20.8456 0.0532
NP_440212.1_6 Forward -91 -72 19.8614 0.114
NP_440546.1_6 Reverse -324 -343 8.06259 0.265
NP_441230.1_5 Reverse -156 -175 3.83436 0.191
NP_440462.1_6 Reverse -47 -57 4.50326 0.197
NP_440462.1_6 Forward -164 -154 3.91327 0.224
NP_441607.1_1 Reverse -84 -103 15.4731 0.163
NP_442340.1_3 Reverse -198 -217 -8.35868 0.246
NP_440868.1_4 Reverse -157 -169 1.51394 0.181
NP_440868.1_4 Reverse -45 -57 -0.846001 0.282
NP_440812.1_4 Forward -213 -194 19.3955 0.198
NP_442402.1_4 Forward -98 -79 -5.90115 0.249
NP_441848.1_4 Reverse -24 -40 17.5773 0.151
NP_440696.1_3 Forward -62 -44 -1.16082 0.251
NP_442039.1_7 Reverse -336 -346 6.76487 0.299
NP_441811.1_8 Forward -64 -50 10.816 0.219
NP_441926.1_3 Forward -110 -94 2.41848 0.276
NP_442837.1_3 Forward -57 -50 12.1338 0.0702
NP_442837.1_3 Reverse -226 -233 7.11894 0.173
NP_442837.1_3 Reverse -50 -57 6.0373 0.25
NP_442053.1_1 Forward -58 -49 6.78456 0.115
NP_442053.1_1 Reverse -118 -127 5.60459 0.176
NP_440505.1_3 Reverse -13 -23 9.61647 0.122
NP_440505.1_3 Reverse -47 -57 7.45319 0.154
NP_442532.1_7 Reverse -264 -278 3.73617 0.191
NP_442532.1_7 Forward -170 -156 2.16287 0.252
NP_441408.2_7 Reverse -326 -345 1.67108 0.215
NP_442174.1_9 Reverse -326 -345 9.0459 0.205
NP_440914.1_1 Reverse -1 -11 9.10306 0.186
NP_441011.1_8 Forward -336 -327 5.50626 0.256
NP_441011.1_8 Forward -375 -366 5.11294 0.283
NP_442533.1_6 Forward -199 -190 4.91628 0.165
NP_442533.1_6 Forward -376 -367 4.81794 0.172
NP_442533.1_6 Forward -170 -161 4.32629 0.184
NP_442232.1_9 Forward -51 -32 17.5015 0.199
NP_442229.1_1 Forward -378 -364 7.96378 0.189
NP_443016.1_5 Reverse -198 -217 9.14342 0.195
NP_441482.1_7 Forward -116 -102 -6.78525 0.193
NP_441482.1_7 Forward -343 -329 -11.7018 0.281
NP_439944.1_9 Forward -57 -47 9.22315 0.1
NP_441527.1_4 Reverse -17 -36 -2.43547 0.156
NP_441527.1_4 Reverse -10 -29 -4.05883 0.179
NP_441527.1_4 Reverse -2 -21 -5.30023 0.198
NP_441527.1_4 Reverse -9 -28 -11.2207 0.278
NP_440115.1_6 Reverse -46 -56 8.4365 0.13
NP_441602.1_3 Reverse -123 -142 -4.6221 0.269
NP_440429.1_2 Reverse -123 -142 10.7175 0.267
NP_441869.1_9 Reverse -179 -198 25.1722 0.00531
NP_439903.1_6 Reverse -325 -344 4.81688 0.189
NP_441286.1_1 Forward -59 -47 0.825626 0.107
NP_441286.1_1 Reverse -42 -54 -0.452677 0.133
NP_441286.1_1 Reverse -48 -60 -3.10761 0.145
NP_441286.1_1 Reverse -263 -275 -6.94252 0.288
NP_440670.1_8 Reverse -49 -58 7.47288 0.0773
NP_440670.1_8 Forward -58 -49 5.89959 0.131
NP_440670.1_8 Reverse -264 -273 5.50626 0.152
NP_440670.1_8 Reverse -101 -110 5.3096 0.167
NP_440670.1_8 Forward -273 -264 4.32629 0.199
NP_441930.1_2 Forward -383 -373 12.5664 0.258
NP_440886.1_7 Reverse -160 -170 7.64939 0.0865
NP_440886.1_7 Forward -151 -141 3.91283 0.26
NP_441001.1_10 Forward -377 -358 5.50599 0.29
NP_442213.1_6 Forward -360 -341 4.916 0.285
NP_440907.2_8 Reverse -50 -60 11.091 0.0969
NP_440907.2_8 Forward -336 -326 3.91283 0.289
NP_442264.1_2 Forward -62 -45 6.03703 0.267
NP_440841.1_4 Forward -172 -153 -7.96535 0.25
NP_441463.1_3 Reverse -151 -170 -0.885524 0.134
NP_441463.1_6 Reverse -332 -346 9.02504 0.25
NP_441626.1_2 Reverse -50 -57 6.13563 0.177
NP_441626.1_2 Forward -57 -50 5.93897 0.231
NP_442365.1_7 Reverse -233 -252 -1.86883 0.196
NP_442794.1_1 Reverse -39 -51 3.48056 0.286
NP_442615.1_1 Reverse -358 -376 -3.91409 0.171
NP_442615.1_1 Forward -179 -161 -6.4707 0.248
NP_441962.1_4 Reverse -329 -348 -3.14714 0.143
NP_441431.1_2 Reverse -364 -378 12.8803 0.104
NP_441431.1_2 Reverse -158 -172 8.45543 0.216
NP_441488.1_8 Forward -57 -43 9.34041 0.157
NP_441836.1_2 Forward -211 -192 -1.27885 0.217
NP_441193.1_1 Reverse -155 -174 10.7167 0.263
NP_441993.1_1 Forward -382 -363 8.86616 0.136
NP_442698.1_10 Reverse -45 -64 -0.983855 0.297
NP_440766.1_4 Reverse -45 -59 0.982901 0.259
NP_441237.1_9 Reverse -50 -60 14.6313 0.0285
NP_441237.1_9 Reverse -368 -378 11.2881 0.189
NP_441237.1_9 Forward -51 -41 11.2881 0.189
NP_442930.1_1 Forward -41 -31 12.5659 0.239
NP_442930.1_1 Reverse -34 -44 12.5659 0.239
NP_442867.1_8 Reverse -239 -258 4.62101 0.278
NP_440457.1_1 Reverse -45 -57 8.59377 0.101
NP_442509.1_9 Forward -110 -100 11.4843 0.128
NP_442936.1_10 Reverse -31 -45 14.2405 0.216
NP_442936.1_10 Forward -44 -30 14.2405 0.216
NP_441885.1_5 Forward -58 -48 1.25834 0.11
NP_441885.1_5 Forward -315 -305 -1.19994 0.255
NP_442341.1_7 Forward -59 -45 7.27608 0.109
NP_442341.1_7 Reverse -305 -319 6.98109 0.113
NP_442341.1_7 Forward -384 -370 3.44117 0.224
NP_442341.1_7 Forward -93 -79 2.2612 0.263
NP_442341.1_9 Reverse -159 -173 7.17714 0.204
NP_442534.1_7 Forward -384 -365 7.57094 0.269
NP_443000.1_7 Reverse -47 -57 7.35486 0.0859
NP_441842.1_10 Reverse -42 -56 16.3225 0.0311
NP_442451.1_2 Reverse -326 -345 -9.24366 0.259
NP_440149.1_8 Forward -382 -363 -3.04881 0.18
NP_441875.1_7 Reverse -251 -261 17.0896 0.227
NP_440216.1_1 Reverse -118 -132 -11.3085 0.178
NP_440216.1_6 Reverse -42 -58 4.0901 0.204
NP_440216.1_9 Forward -50 -41 12.0944 0.252
NP_440216.1_9 Reverse -3 -12 6.78456 0.289
NP_440172.1_1 Forward -170 -160 4.10993 0.205
NP_440172.1_1 Reverse -101 -111 1.94665 0.29
NP_442015.1_10 Reverse -45 -58 0.0192843 0.245
NP_441226.1_7 Forward -51 -44 12.4284 0.0404
NP_441226.1_7 Reverse -368 -375 11.2485 0.0971
NP_441757.1_3 Reverse -48 -67 -1.08219 0.245
NP_441757.1_3 Reverse -263 -282 -2.55715 0.283
NP_441111.1_7 Forward -57 -49 8.86921 0.0589
NP_441111.1_7 Reverse -368 -376 -0.570565 0.233
NP_441766.1_2 Forward -58 -49 6.48957 0.096
NP_443052.1_9 Forward -335 -316 -3.3438 0.249
NP_442154.1_1 Forward -384 -366 -15.4188 0.218
NP_442564.1_9 Reverse -196 -210 14.5086 0.227
NP_442046.1_10 Reverse -152 -171 18.1907 0.239
NP_440261.1_5 Forward -57 -44 -12.4687 0.297
NP_440261.1_5 Reverse -50 -63 -12.4687 0.297
NP_440988.1_10 Forward -54 -40 8.4809 0.205
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CATCAAGGAAGCTTTTCGGGAATTGGCGTTGGCTGATCTCAACGTTATCGGAATTGTGGCCAATGCTATCACTTCTACGTCCGGCGGTTATGGCTACTACTATGGTCGTTACTACAATAACCGTTACTACGATCGTCAAAAAGTTGCCCAGGCAGACAATTAGGATCGGGAGCACAGAACCCCACCTTGCGGGGCAAAAATGGCCAGGTCCAAAAAAGGCTTAACGTATGGGCGATGACGGGCTCGAACCGCCGACATCCTGCTTGTAAGGCAGGCGCTCTACCAACTGAGCTAATCGCCCTTTACTCGTGCTTAACCACTATATCATAGGTTATCGTTTTGTTCGATCGCCATCGGAAAAAATTTTTTCCTAGTTACCTATTCCCTTTTTGCCTTTGCC

CDS

ATGCCCGCCGGTAAAATCCATGACCGCATTACCCTGGGAGCCACCCCAGCGGTTATGGCCATCACATTTATTGGCACTGGTAGTGCCCGACTAACCCTGCTAATGGCGATCGCCTTTGGATTTAGCGGGTTGATGTTTGGCCCGGATCTGGACATCCATTCCTGTCAATATAAAAGGTGGGGCTGGCTGAGATGGGTCTGGCTTCCCTACCGCCACTTCATTCCCCATCGATCGCCCCTTTCCCACGGCTTTTTGATTGGTACGATTTTGCGTTTATTGTATCTAGGCAGTTGGCTGCTACTGGCTTCAGCAGGCATAGGGACAGTGCTGATACTGTTACAAAAGCTTAATTTACAGGGAATTAACTGGTTGATCCCGAGACAATGGCTGGAGCAACACCGTTGGGAACTGCTAACAATTTTTGTTGGCTTGGAGGCAGGGGCCATGGCCCATAGTGTGAGCGATTGGGGAGGTAGTTGGCTCAAAAAAAAGCTAAAGCCACAGCAAAAAAAACACTCTAGCCAAGGCAAGTCTAAATCTCGCCGGCGTTCCTAA

Protein

MPAGKIHDRITLGATPAVMAITFIGTGSARLTLLMAIAFGFSGLMFGPDLDIHSCQYKRWGWLRWVWLPYRHFIPHRSPLSHGFLIGTILRLLYLGSWLLLASAGIGTVLILLQKLNLQGINWLIPRQWLEQHRWELLTIFVGLEAGAMAHSVSDWGGSWLKKKLKPQQKKHSSQGKSKSRRRS