Your browser is old and dusty. Try Google Chrome!

Details for sll0914

ORF sll0914
Accession NP_441724.1
Symbol
Category unknown protein
Definition Unknown
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -307 -321 10.9143 0.0562
NP_441061.1_2 Reverse -295 -309 -1.5737 0.265
NP_441061.1_2 Reverse -382 -396 -1.8687 0.274
NP_440795.1_7 Reverse -340 -347 10.2655 0.154
NP_442272.1_2 Forward -205 -186 21.2465 0.0398
NP_442272.1_2 Forward -176 -157 13.7027 0.197
NP_441453.1_4 Forward -396 -388 6.80426 0.121
NP_441453.1_4 Reverse -387 -395 6.11594 0.121
NP_441453.1_4 Forward -348 -340 4.05099 0.268
NP_442151.1_6 Forward -396 -382 10.7177 0.118
NP_442151.1_6 Reverse -339 -353 8.16106 0.182
NP_441818.1_1 Reverse -388 -399 15.2011 0.0343
NP_442173.1_1 Reverse -388 -396 12.0158 0.0316
NP_442173.1_1 Forward -395 -387 10.7375 0.0611
NP_442752.1_4 Forward -396 -389 13.8055 0.0199
NP_442752.1_4 Reverse -251 -258 5.84064 0.166
NP_441675.1_4 Forward -200 -181 13.5691 0.177
NP_441675.1_4 Reverse -11 -30 3.93269 0.263
NP_440784.1_7 Forward -395 -388 6.23397 0.241
NP_440784.1_7 Reverse -388 -395 6.13563 0.241
NP_442062.1_8 Forward -396 -386 7.25653 0.104
NP_442062.1_8 Reverse -251 -261 4.60159 0.206
NP_442062.1_8 Forward -226 -216 4.0116 0.237
NP_441859.1_3 Forward -227 -208 4.81688 0.213
NP_441802.1_1 Reverse -322 -341 4.03102 0.298
NP_440304.1_4 Forward -323 -313 5.48657 0.206
NP_442268.1_9 Forward -46 -27 11.8975 0.295
NP_441781.1_7 Reverse -306 -325 0.294447 0.246
NP_442181.1_1 Reverse -311 -330 13.3725 0.174
NP_442196.1_10 Reverse -235 -254 11.6025 0.224
NP_442742.1_3 Forward -252 -233 14.7491 0.2
NP_440518.1_8 Reverse -344 -363 14.5516 0.205
NP_442110.1_7 Forward -396 -382 8.35772 0.093
NP_441082.1_10 Reverse -239 -252 12.409 0.236
NP_441925.1_4 Reverse -336 -355 -17.6025 0.297
NP_441083.1_5 Reverse -387 -397 9.7148 0.0231
NP_441083.1_5 Forward -396 -386 8.04317 0.046
NP_441083.1_5 Reverse -339 -349 -1.10161 0.295
NP_442827.1_8 Forward -346 -327 3.63691 0.144
NP_441738.1_2 Reverse -389 -396 15.28 0.0102
NP_441738.1_2 Reverse -219 -226 10.0685 0.125
NP_441738.1_2 Forward -258 -251 8.20023 0.181
NP_440209.1_1 Forward -396 -388 8.57422 0.0425
NP_440209.1_1 Reverse -217 -225 5.13263 0.17
NP_442889.1_1 Reverse -306 -325 -1.18052 0.145
NP_441713.1_8 Reverse -341 -359 8.18062 0.293
NP_442570.1_3 Reverse -310 -329 -5.21209 0.241
NP_442570.1_3 Reverse -304 -323 -6.39206 0.257
NP_442570.1_8 Forward -249 -231 19.3903 0.0908
NP_441716.1_1 Reverse -345 -359 3.93283 0.259
NP_441716.1_1 Forward -396 -382 3.53951 0.261
NP_440906.1_5 Forward -395 -388 6.23397 0.234
NP_440906.1_5 Reverse -388 -395 6.13563 0.241
NP_440747.1_10 Reverse -384 -396 -2.4193 0.0434
NP_440747.1_10 Forward -399 -387 -11.9574 0.178
NP_441486.1_1 Forward -399 -385 3.24451 0.0638
NP_441486.1_1 Reverse -384 -398 0.0979218 0.145
NP_442848.1_9 Forward -155 -136 0.687771 0.266
NP_442848.1_9 Forward -354 -335 0.58944 0.266
NP_441012.1_4 Forward -325 -312 11.4257 0.252
NP_443018.1_3 Reverse -388 -395 11.7405 0.0655
NP_443018.1_3 Forward -225 -218 9.77388 0.118
NP_443018.1_3 Forward -118 -111 8.39725 0.147
NP_443018.1_3 Forward -395 -388 5.44732 0.193
NP_443018.1_3 Reverse -340 -347 4.36568 0.254
NP_443018.1_3 Forward -347 -340 4.07068 0.299
NP_440376.1_1 Forward -396 -387 5.99792 0.111
NP_440376.1_1 Reverse -140 -149 3.14632 0.207
NP_440376.1_1 Reverse -387 -396 -0.196935 0.285
NP_441857.1_6 Forward -356 -346 17.188 0.16
NP_441588.1_4 Reverse -389 -399 8.63316 0.14
NP_442687.1_7 Reverse -250 -260 5.97822 0.179
NP_442687.1_7 Forward -349 -339 5.68323 0.189
NP_442687.1_7 Forward -339 -329 4.89658 0.23
NP_441846.1_10 Reverse -60 -79 -22.42 0.259
NP_440360.1_2 Forward -17 -3 14.7492 0.297
NP_442658.1_1 Forward -323 -313 8.14104 0.199
NP_442658.1_1 Reverse -337 -347 4.7978 0.297
NP_440141.1_8 Reverse -62 -81 4.12936 0.293
NP_442496.1_5 Reverse -245 -263 11.9172 0.207
NP_442496.1_5 Reverse -40 -58 4.9357 0.288
NP_442496.1_5 Forward -44 -26 4.34571 0.292
NP_441414.1_9 Forward -396 -377 -1.47551 0.101
NP_442300.1_3 Reverse -338 -357 7.57094 0.185
NP_442321.1_1 Reverse -327 -346 -4.32711 0.216
NP_441958.1_5 Forward -397 -387 0.865012 0.12
NP_441958.1_5 Reverse -250 -260 0.0783647 0.168
NP_442836.1_10 Forward -356 -346 17.0896 0.185
NP_440203.1_5 Reverse -315 -325 15.8108 0.0611
NP_440203.1_5 Forward -77 -67 10.4026 0.225
NP_439905.1_1 Forward -347 -334 9.36073 0.221
NP_440984.1_7 Forward -353 -339 6.19444 0.224
NP_439990.1_5 Reverse -382 -395 9.06573 0.153
NP_442911.1_1 Reverse -160 -173 15.5315 0.271
NP_442911.1_2 Reverse -377 -396 13.6675 0.0118
NP_442064.1_4 Reverse -308 -327 11.2084 0.191
NP_440993.1_3 Reverse -377 -396 -1.37794 0.28
NP_440827.1_3 Forward -332 -313 11.0125 0.275
NP_440138.1_6 Forward -320 -301 12.0933 0.121
NP_441099.1_5 Reverse -377 -396 -6.49039 0.162
NP_441294.1_7 Forward -400 -386 9.34661 0.249
NP_442438.1_10 Reverse -382 -396 -0.983719 0.287
NP_440147.1_4 Forward -340 -327 1.9859 0.213
NP_441550.1_8 Forward -398 -388 11.091 0.0555
NP_441550.1_8 Reverse -385 -395 8.14104 0.132
NP_441550.1_8 Forward -350 -340 4.99446 0.274
NP_441916.1_10 Reverse -244 -263 2.94938 0.236
NP_440206.1_10 Reverse -67 -86 20.354 0.165
NP_440465.1_9 Reverse -11 -29 10.5406 0.119
NP_441041.1_4 Forward -396 -377 -5.01543 0.146
NP_442004.1_6 Forward -260 -246 7.66941 0.157
NP_441725.1_1 Reverse -158 -177 29.4004 0.0000269
NP_441725.1_1 Reverse -187 -206 26.4505 0.000822
NP_441725.1_1 Forward -179 -160 20.4523 0.033
NP_441725.1_1 Forward -208 -189 19.2723 0.0478
NP_441725.1_4 Forward -154 -140 7.47213 0.23
NP_441725.1_5 Reverse -313 -323 7.15819 0.103
NP_441725.1_5 Reverse -388 -398 1.455 0.135
NP_441725.1_5 Forward -225 -215 0.471689 0.173
NP_441725.1_5 Forward -395 -385 0.275027 0.192
NP_439966.1_7 Reverse -385 -395 12.2709 0.0464
NP_439966.1_7 Forward -398 -388 6.0761 0.195
NP_439966.1_7 Reverse -353 -363 4.01116 0.295
NP_442941.1_3 Reverse -388 -398 10.1081 0.024
NP_442941.1_3 Forward -395 -385 0.766681 0.171
NP_440289.1_2 Reverse -336 -349 -5.09393 0.297
NP_440983.1_5 Forward -309 -290 -8.65367 0.295
NP_442281.1_1 Forward -326 -312 9.24208 0.0726
NP_440018.1_3 Forward -310 -291 2.3594 0.291
NP_440437.1_1 Reverse -381 -400 -5.70374 0.292
NP_442500.1_8 Forward -113 -99 9.21432 0.285
NP_442012.1_1 Reverse -245 -264 5.70265 0.146
NP_441556.1_10 Reverse -334 -348 9.44312 0.298
NP_443030.1_4 Forward -328 -309 -5.70374 0.272
NP_441644.1_6 Reverse -339 -349 8.73102 0.0944
NP_441644.1_6 Reverse -387 -397 7.74772 0.117
NP_441644.1_6 Forward -396 -386 5.28945 0.199
NP_443049.1_6 Forward -397 -387 11.8361 0.24
NP_440867.1_10 Forward -241 -222 1.27776 0.298
NP_442215.1_2 Reverse -310 -326 2.8118 0.108
NP_442215.1_2 Reverse -208 -224 -2.98973 0.207
NP_441810.1_5 Reverse -103 -122 8.94757 0.297
NP_442029.1_6 Forward -354 -335 2.65439 0.291
NP_440929.1_8 Reverse -387 -396 14.651 0.0105
NP_440929.1_8 Forward -396 -387 7.66954 0.0624
NP_442554.1_8 Forward -395 -385 10.2065 0.0493
NP_442554.1_8 Reverse -388 -398 6.07655 0.126
NP_442554.1_8 Reverse -340 -350 3.71661 0.215
NP_441762.1_7 Forward -349 -337 -5.76255 0.238
NP_442292.1_1 Reverse -388 -397 8.65285 0.0335
NP_442292.1_1 Forward -395 -386 8.1612 0.0478
NP_443009.1_5 Reverse -250 -261 5.66304 0.193
NP_443009.1_5 Reverse -216 -227 5.07306 0.218
NP_443009.1_5 Forward -299 -288 3.8931 0.274
NP_442301.1_2 Reverse -113 -132 12.4867 0.159
NP_442301.1_2 Forward -343 -324 6.98015 0.258
NP_441741.1_6 Reverse -268 -287 9.63589 0.249
NP_441715.1_4 Reverse -77 -87 8.4365 0.107
NP_441715.1_4 Reverse -388 -398 4.99491 0.24
NP_442076.1_8 Reverse -60 -79 7.7676 0.262
NP_441198.1_8 Forward -323 -313 10.9275 0.232
NP_441468.1_1 Forward -395 -388 6.13563 0.209
NP_441468.1_1 Reverse -388 -395 6.0373 0.223
NP_441468.1_1 Reverse -340 -347 4.46401 0.224
NP_441020.2_6 Reverse -249 -266 6.62702 0.26
NP_441673.1_1 Forward -396 -387 1.37636 0.114
NP_441673.1_1 Reverse -387 -396 1.1797 0.163
NP_441731.1_1 Reverse -65 -83 14.3258 0.281
NP_441876.1_9 Forward -75 -65 10.9926 0.28
NP_442490.1_9 Forward -354 -335 1.86774 0.165
NP_442868.1_6 Forward -398 -388 0.176696 0.247
NP_442868.1_6 Forward -350 -340 0.0783647 0.248
NP_442719.1_2 Reverse -367 -385 -10.1096 0.269
NP_440763.1_2 Reverse -185 -203 14.1077 0.268
NP_441056.1_1 Forward -396 -377 -8.94866 0.286
NP_442227.1_2 Forward -78 -59 -2.26216 0.272
NP_442808.1_1 Reverse -230 -240 4.30615 0.2
NP_442808.1_1 Reverse -345 -355 1.35624 0.287
NP_442775.1_6 Reverse -295 -314 11.8975 0.277
NP_441849.1_2 Reverse -263 -282 4.53544 0.245
NP_442050.1_5 Reverse -385 -395 13.7459 0.029
NP_442050.1_5 Forward -398 -388 6.76441 0.282
NP_441114.1_3 Reverse -314 -323 7.57121 0.231
NP_441114.1_3 Forward -320 -311 7.37455 0.239
NP_440558.1_2 Forward -325 -306 8.94757 0.106
NP_440558.1_2 Reverse -378 -397 8.16093 0.113
NP_440558.1_2 Forward -342 -323 3.44104 0.156
NP_440558.1_2 Reverse -67 -86 0.491109 0.19
NP_440558.1_2 Forward -307 -288 -3.83545 0.239
NP_440558.1_2 Forward -229 -210 -7.17871 0.289
NP_441878.1_6 Forward -349 -339 -0.0199663 0.163
NP_441878.1_6 Reverse -338 -348 -7.29646 0.217
NP_441878.1_6 Forward -322 -312 -7.49312 0.231
NP_442650.1_2 Forward -396 -382 14.1593 0.0968
NP_441557.1_5 Reverse -387 -396 7.57121 0.049
NP_441557.1_5 Forward -396 -387 1.08137 0.0794
NP_441557.1_5 Reverse -251 -260 -0.491928 0.193
NP_442267.1_6 Reverse -301 -320 17.3057 0.205
NP_441433.1_8 Reverse -313 -332 2.0644 0.228
NP_442183.1_1 Forward -396 -382 3.93283 0.289
NP_442135.1_5 Reverse -346 -364 14.473 0.274
NP_441574.1_1 Forward -360 -341 -5.70374 0.267
NP_442444.1_6 Reverse -321 -339 16.5963 0.165
NP_441467.1_5 Forward -108 -98 17.9746 0.199
NP_442347.1_2 Reverse -388 -397 10.3245 0.058
NP_442645.1_2 Reverse -243 -262 -14.8485 0.183
NP_442645.1_2 Forward -324 -305 -20.7484 0.288
NP_441037.1_4 Reverse -249 -259 6.73295 0.245
NP_440235.1_6 Reverse -8 -18 17.4963 0.176
NP_442764.1_3 Forward -322 -312 15.418 0.295
NP_440136.1_2 Forward -395 -388 6.23397 0.171
NP_440136.1_2 Reverse -388 -395 6.13563 0.193
NP_440136.1_2 Reverse -252 -259 4.26735 0.218
NP_441728.2_4 Forward -209 -190 14.3711 0.23
NP_442998.1_10 Reverse -389 -396 15.5754 0.0102
NP_440299.1_1 Reverse -383 -396 11.2284 0.0518
NP_441799.1_1 Forward -352 -338 8.25877 0.12
NP_440640.1_6 Reverse -330 -349 0.0977854 0.276
NP_442334.1_10 Forward -354 -335 -16.7168 0.257
NP_440256.1_1 Reverse -37 -56 -7.27704 0.232
NP_441559.1_8 Reverse -335 -349 1.27789 0.156
NP_441559.1_8 Reverse -308 -322 -3.73699 0.209
NP_441559.1_8 Reverse -284 -298 -6.39192 0.277
NP_441559.1_8 Reverse -334 -348 -7.08024 0.283
NP_440997.1_3 Reverse -211 -230 10.6192 0.266
NP_441704.1_8 Reverse -376 -395 6.29183 0.262
NP_442866.1_1 Reverse -307 -326 -5.80207 0.245
NP_442866.1_1 Reverse -324 -343 -7.17871 0.264
NP_441464.1_10 Forward -244 -230 9.2427 0.262
NP_439985.1_7 Reverse -288 -307 9.73422 0.18
NP_442993.1_1 Reverse -217 -233 -11.1512 0.235
NP_442386.1_9 Reverse -386 -395 8.75075 0.184
NP_442386.1_9 Reverse -338 -347 6.19416 0.23
NP_441340.1_5 Forward -395 -388 13.5105 0.0314
NP_441340.1_5 Reverse -388 -395 5.84064 0.208
NP_441340.1_5 Forward -347 -340 3.97235 0.274
NP_441271.1_1 Reverse -381 -399 14.6697 0.202
NP_441271.1_8 Reverse -320 -330 13.648 0.272
NP_442714.1_7 Forward -384 -365 -1.37718 0.287
NP_440586.1_8 Reverse -388 -395 9.47853 0.146
NP_440586.1_8 Forward -118 -111 7.21693 0.27
NP_440586.1_8 Forward -395 -388 5.74197 0.283
NP_442874.1_6 Reverse -311 -330 17.0107 0.0653
NP_440684.1_9 Forward -354 -340 12.4876 0.168
NP_441262.1_3 Forward -396 -389 14.7888 0.0223
NP_441262.1_3 Forward -226 -219 11.6422 0.0477
NP_443051.1_1 Forward -397 -388 7.47288 0.0571
NP_443051.1_1 Reverse -250 -259 -1.08191 0.281
NP_441740.2_10 Forward -241 -222 10.1275 0.286
NP_440372.1_2 Forward -395 -388 13.8055 0.0214
NP_440372.1_2 Reverse -388 -395 6.52896 0.188
NP_441138.1_5 Reverse -197 -210 10.9479 0.227
NP_441803.1_2 Reverse -232 -251 0.786102 0.244
NP_442384.1_10 Forward -260 -247 5.03416 0.139
NP_442384.1_10 Reverse -329 -342 2.47756 0.224
NP_442035.1_7 Reverse -311 -330 19.3761 0.271
NP_441877.1_7 Reverse -334 -353 -0.39464 0.284
NP_440399.1_1 Forward -135 -116 6.39097 0.3
NP_442262.1_10 Reverse -388 -395 13.2155 0.0213
NP_442262.1_10 Forward -225 -218 11.1505 0.115
NP_442262.1_10 Forward -118 -111 10.7572 0.124
NP_441689.1_5 Forward -398 -388 12.7626 0.113
NP_441689.1_5 Reverse -385 -395 5.97777 0.197
NP_440163.1_10 Forward -399 -389 11.3864 0.169
NP_440344.1_10 Reverse -380 -397 -6.25434 0.113
NP_440282.1_10 Forward -358 -339 -7.37537 0.251
NP_440531.1_8 Reverse -324 -343 1.96607 0.298
NP_441060.1_4 Forward -210 -192 3.55906 0.252
NP_442910.1_1 Reverse -244 -263 -7.37537 0.254
NP_440297.1_9 Reverse -313 -323 7.05986 0.15
NP_440297.1_9 Forward -395 -385 -0.118297 0.282
NP_440297.1_9 Reverse -340 -350 -0.118297 0.282
NP_440297.1_9 Reverse -388 -398 -0.511621 0.289
NP_441103.1_9 Forward -52 -42 12.8802 0.278
NP_440990.1_4 Forward -231 -212 12.9791 0.288
NP_440179.1_6 Reverse -340 -359 8.94757 0.193
NP_441543.1_2 Reverse -388 -397 7.07956 0.131
NP_441543.1_3 Forward -61 -47 6.48882 0.286
NP_442845.1_2 Reverse -312 -326 4.71948 0.254
NP_441304.1_10 Forward -33 -24 12.8811 0.276
NP_441469.1_8 Reverse -338 -347 12.4878 0.107
NP_441469.1_8 Forward -322 -313 9.4395 0.227
NP_443064.1_6 Forward -260 -250 9.65817 0.205
NP_442337.1_8 Reverse -283 -302 -1.27885 0.28
NP_442578.1_7 Forward -395 -388 6.0373 0.18
NP_441462.1_2 Forward -396 -386 0.963343 0.109
NP_441462.1_2 Reverse -251 -261 0.373358 0.154
NP_441621.1_7 Forward -350 -336 -6.58858 0.298
NP_443062.1_1 Forward -396 -378 12.3487 0.0811
NP_443062.1_6 Reverse -331 -350 0.294447 0.299
NP_441560.1_6 Reverse -324 -343 14.9458 0.241
NP_440255.1_7 Forward -198 -181 6.72535 0.299
NP_440516.1_8 Forward -396 -387 9.53783 0.0136
NP_440516.1_8 Reverse -387 -396 5.01461 0.118
NP_440516.1_8 Forward -348 -339 -0.393597 0.255
NP_442428.1_5 Forward -395 -388 6.13563 0.209
NP_442428.1_5 Reverse -388 -395 6.0373 0.212
NP_442428.1_5 Reverse -340 -347 4.759 0.223
NP_442120.1_10 Reverse -307 -326 -15.5368 0.294
NP_441867.1_2 Reverse -243 -262 -12.8819 0.27
NP_440673.1_2 Reverse -110 -129 9.02386 0.259
NP_440673.1_3 Reverse -389 -396 12.4288 0.0426
NP_440673.1_3 Forward -78 -71 6.72562 0.277
NP_441052.1_2 Reverse -387 -397 1.55333 0.238
NP_441052.1_2 Forward -396 -386 0.668351 0.256
NP_442219.1_9 Reverse -388 -397 7.96454 0.0696
NP_442219.1_9 Forward -259 -250 2.35967 0.28
NP_440436.1_4 Reverse -388 -397 7.57079 0.124
NP_441884.1_8 Forward -339 -320 -11.4069 0.269
NP_440041.1_2 Forward -356 -337 -5.60541 0.296
NP_441086.1_3 Forward -281 -262 5.36764 0.29
NP_441719.1_4 Forward -395 -388 6.82395 0.0855
NP_441719.1_4 Reverse -388 -395 6.52896 0.188
NP_441004.1_1 Reverse -246 -265 -9.24366 0.206
NP_441004.1_1 Forward -354 -335 -10.4236 0.219
NP_441004.1_1 Reverse -35 -54 -15.7335 0.277
NP_441004.1_2 Reverse -241 -260 2.85105 0.212
NP_442366.1_3 Forward -227 -209 -0.7675 0.199
NP_442366.1_5 Forward -351 -341 11.6809 0.168
NP_441115.1_4 Forward -227 -209 9.35981 0.218
NP_442694.1_4 Forward -241 -232 11.3078 0.277
NP_442206.1_10 Forward -396 -381 10.2063 0.135
NP_442206.1_10 Forward -321 -306 2.8315 0.198
NP_440328.1_4 Reverse -337 -356 0.491109 0.25
NP_442308.1_3 Forward -357 -338 11.0125 0.275
NP_441851.1_10 Reverse -250 -260 14.828 0.0117
NP_441851.1_10 Forward -397 -387 5.97822 0.19
NP_441851.1_10 Reverse -386 -396 4.40493 0.271
NP_441851.1_10 Forward -322 -312 4.20827 0.282
NP_442208.1_5 Forward -353 -334 -7.86702 0.275
NP_441501.1_9 Forward -257 -238 14.0599 0.292
NP_442515.1_1 Reverse -222 -236 1.86788 0.147
NP_442515.1_1 Reverse -216 -230 -1.08205 0.245
NP_442515.1_1 Forward -30 -16 -1.27871 0.251
NP_441683.1_5 Forward -343 -324 16.7157 0.14
NP_440463.1_7 Reverse -344 -358 18.3875 0.0962
NP_441046.1_2 Reverse -325 -344 0.196116 0.271
NP_442689.1_8 Forward -277 -260 -3.69774 0.251
NP_441409.1_6 Reverse -381 -400 10.8159 0.024
NP_440432.1_9 Reverse -252 -267 -5.13331 0.236
NP_440474.1_8 Reverse -218 -232 13.7653 0.0695
NP_441477.1_5 Reverse -332 -351 9.83255 0.268
NP_442450.1_5 Reverse -215 -225 5.78156 0.227
NP_442450.1_5 Forward -350 -340 5.28991 0.251
NP_440195.1_4 Forward -327 -308 4.03102 0.297
NP_442006.1_2 Reverse -35 -52 -15.1041 0.215
NP_442243.1_1 Forward -328 -310 2.67334 0.204
NP_441570.1_1 Forward -396 -378 -17.1888 0.267
NP_441078.1_4 Forward -396 -387 0.196389 0.205
NP_441078.1_4 Reverse -387 -396 -0.000272808 0.205
NP_441078.1_4 Reverse -339 -348 -1.86856 0.272
NP_440707.1_9 Reverse -42 -61 0.294447 0.293
NP_442443.1_1 Forward -45 -26 -6.88371 0.299
NP_440526.1_3 Reverse -388 -399 0.54986 0.275
NP_441432.1_8 Forward -397 -388 14.0611 0.0258
NP_441432.1_8 Forward -241 -232 7.27622 0.101
NP_441432.1_8 Reverse -312 -321 2.65466 0.292
NP_441432.1_9 Forward -25 -12 14.8036 0.14
NP_442344.1_7 Reverse -340 -359 -8.55534 0.218
NP_440760.1_1 Forward -260 -241 -22.42 0.257
NP_442797.1_7 Reverse -338 -356 3.46073 0.234
NP_440199.1_10 Forward -399 -389 16.7946 0.0381
NP_441057.1_4 Forward -129 -111 1.88744 0.253
NP_442353.1_4 Reverse -333 -352 1.27698 0.251
NP_442353.1_4 Reverse -211 -230 -0.689632 0.29
NP_440713.1_4 Reverse -377 -396 5.99764 0.198
NP_442489.1_7 Forward -396 -387 0.688044 0.152
NP_442489.1_7 Reverse -387 -396 0.688044 0.152
NP_442489.1_7 Reverse -339 -348 -1.37691 0.195
NP_442489.1_7 Forward -226 -217 -1.96689 0.28
NP_442489.1_7 Reverse -217 -226 -2.16355 0.295
NP_441830.1_2 Forward -363 -344 -5.40875 0.286
NP_440941.1_1 Forward -357 -347 16.6963 0.241
NP_440559.1_1 Forward -395 -386 13.7661 0.0357
NP_440559.1_1 Reverse -388 -397 7.76787 0.0918
NP_440559.1_1 Forward -225 -216 4.42462 0.277
NP_441659.2_8 Reverse -387 -397 5.48657 0.106
NP_441659.2_8 Forward -396 -386 5.28991 0.112
NP_441040.1_2 Reverse -331 -350 -8.35868 0.236
NP_441800.1_3 Reverse -313 -331 5.82068 0.286
NP_442346.1_5 Forward -397 -387 6.27322 0.208
NP_442346.1_5 Forward -349 -339 4.50326 0.286
NP_440555.1_7 Forward -334 -315 17.109 0.267
NP_441943.1_8 Forward -331 -312 -3.63879 0.183
NP_441943.1_8 Reverse -316 -335 -4.6221 0.219
NP_442551.1_4 Reverse -310 -325 -2.77337 0.276
NP_442603.1_7 Forward -396 -382 11.4053 0.117
NP_441833.1_4 Reverse -388 -395 6.52896 0.0924
NP_441833.1_4 Forward -395 -388 6.23397 0.163
NP_442162.1_9 Forward -395 -388 12.9205 0.0282
NP_442162.1_9 Reverse -388 -395 12.9205 0.0282
NP_440788.1_8 Reverse -61 -80 7.37428 0.286
NP_440671.1_4 Reverse -381 -395 14.0609 0.0698
NP_441696.1_4 Forward -43 -30 13.0973 0.19
NP_441813.1_5 Reverse -385 -395 11.9764 0.0208
NP_441813.1_5 Forward -398 -388 6.17489 0.1
NP_441813.1_5 Reverse -337 -347 0.275027 0.206
NP_440590.1_4 Forward -395 -382 -4.01229 0.257
NP_440590.1_4 Forward -225 -212 -5.97891 0.296
NP_442497.1_10 Reverse -340 -349 0.688044 0.141
NP_442497.1_10 Reverse -388 -397 0.589713 0.153
NP_442497.1_10 Forward -259 -250 0.491382 0.162
NP_442497.1_10 Forward -225 -216 0.29472 0.199
NP_442497.1_10 Forward -395 -386 -1.18024 0.256
NP_442497.1_10 Reverse -252 -261 -1.18024 0.256
NP_440821.1_4 Forward -398 -388 8.53483 0.0468
NP_440821.1_4 Reverse -385 -395 7.84651 0.0626
NP_441239.1_9 Reverse -337 -349 8.00379 0.145
NP_441239.1_9 Reverse -385 -397 3.08724 0.296
NP_442193.1_1 Reverse -312 -330 7.78729 0.28
NP_442270.1_9 Forward -326 -307 2.3594 0.14
NP_440219.1_1 Reverse -264 -283 13.2234 0.255
NP_440573.1_3 Forward -17 -4 19.9241 0.0557
NP_441541.1_5 Reverse -157 -176 13.4708 0.265
NP_442052.1_8 Forward -350 -340 14.238 0.253
NP_440675.1_1 Forward -235 -216 7.17762 0.195
NP_440462.1_6 Forward -366 -356 1.84832 0.294
NP_442611.1_1 Forward -396 -377 -2.95047 0.295
NP_440868.1_4 Reverse -335 -347 4.26721 0.122
NP_440868.1_4 Forward -400 -388 3.38223 0.136
NP_440401.1_9 Reverse -229 -236 14.5917 0.287
NP_440270.1_6 Reverse -24 -43 15.6341 0.125
NP_440653.1_10 Reverse -211 -230 2.16274 0.29
NP_442923.1_6 Forward -104 -90 13.8579 0.203
NP_442039.1_4 Forward -395 -388 11.6422 0.0747
NP_442039.1_7 Reverse -64 -74 10.1081 0.257
NP_441811.1_1 Reverse -222 -241 8.45592 0.28
NP_442409.1_10 Reverse -309 -323 14.6503 0.293
NP_442837.1_3 Forward -395 -388 6.0373 0.25
NP_442837.1_3 Reverse -388 -395 6.0373 0.25
NP_442053.1_1 Reverse -387 -396 7.07956 0.105
NP_440505.1_3 Forward -398 -388 14.7297 0.0176
NP_442360.1_5 Reverse -319 -329 15.0247 0.172
NP_440351.1_8 Reverse -273 -291 4.83737 0.297
NP_441701.1_3 Reverse -320 -337 5.9387 0.295
NP_441408.2_7 Forward -324 -305 -2.75381 0.272
NP_440914.1_1 Forward -321 -311 11.6404 0.0843
NP_440914.1_1 Forward -396 -386 11.1525 0.105
NP_440914.1_1 Forward -315 -305 9.39583 0.186
NP_440914.1_1 Reverse -387 -397 6.56569 0.273
NP_442533.1_6 Reverse -387 -396 4.42462 0.179
NP_442533.1_6 Reverse -339 -348 3.7363 0.204
NP_441482.1_7 Reverse -245 -259 -9.04686 0.193
NP_441482.1_7 Reverse -381 -395 -10.8168 0.216
NP_439944.1_9 Reverse -388 -398 9.22315 0.1
NP_439944.1_9 Forward -395 -385 7.45319 0.141
NP_441028.1_6 Forward -258 -248 5.78111 0.243
NP_441028.1_6 Forward -147 -137 3.8145 0.281
NP_440116.1_8 Forward -395 -376 -5.40875 0.192
NP_441527.1_4 Forward -111 -92 5.1084 0.108
NP_441527.1_4 Forward -112 -93 -12.8441 0.294
NP_440007.1_9 Forward -325 -311 13.9626 0.163
NP_440007.1_9 Forward -400 -386 8.06273 0.189
NP_440007.1_9 Forward -244 -230 1.37622 0.285
NP_441059.1_2 Reverse -58 -77 -7.08038 0.284
NP_442306.1_10 Reverse -334 -353 -12.0953 0.161
NP_441286.1_1 Reverse -386 -398 10.2654 0.0198
NP_441286.1_1 Forward -397 -385 2.79224 0.0532
NP_441286.1_1 Reverse -311 -323 -6.74586 0.278
NP_442674.1_3 Forward -329 -310 4.52188 0.288
NP_440670.1_8 Forward -396 -387 16.0277 0.00443
NP_440670.1_8 Reverse -387 -396 12.5861 0.0253
NP_441930.1_2 Forward -322 -312 13.0581 0.248
NP_441930.1_2 Reverse -70 -80 12.8614 0.248
NP_440886.1_7 Forward -349 -339 5.48612 0.181
NP_442614.1_2 Forward -396 -382 10.9143 0.223
NP_440767.1_2 Forward -46 -27 -4.42544 0.285
NP_440907.2_8 Forward -259 -249 5.68278 0.191
NP_442264.1_2 Forward -400 -383 8.00365 0.223
NP_442264.1_2 Forward -236 -219 6.52869 0.254
NP_441021.1_1 Reverse -307 -326 -8.752 0.2
NP_441463.1_3 Reverse -296 -315 -0.39387 0.132
NP_441463.1_6 Reverse -310 -324 8.92841 0.25
NP_441626.1_2 Forward -395 -388 12.2322 0.0511
NP_441626.1_2 Reverse -388 -395 5.93897 0.231
NP_442794.1_1 Reverse -383 -395 16.4603 0.0319
NP_442615.1_1 Forward -357 -339 2.47742 0.0675
NP_442615.1_1 Reverse -242 -260 -4.50408 0.188
NP_441962.1_4 Reverse -115 -134 -2.95047 0.139
NP_441962.1_4 Forward -395 -376 -15.0452 0.297
NP_440387.1_1 Reverse -217 -233 -5.25134 0.222
NP_440387.1_1 Reverse -339 -355 -6.03799 0.262
NP_440855.1_3 Reverse -198 -217 6.1935 0.279
NP_441431.1_2 Reverse -336 -350 8.55376 0.211
NP_441488.1_8 Reverse -105 -119 17.0102 0.11
NP_441488.1_8 Reverse -212 -226 8.45543 0.19
NP_442323.1_7 Forward -327 -308 5.70185 0.202
NP_441552.1_3 Reverse -380 -399 12.4867 0.292
NP_440293.1_3 Forward -356 -337 -5.40875 0.276
NP_440293.1_10 Reverse -59 -78 -3.24547 0.291
NP_440766.1_4 Reverse -383 -397 0.294584 0.291
NP_440422.1_10 Reverse -180 -199 8.17758 0.212
NP_441237.1_9 Forward -225 -215 12.2714 0.127
NP_442743.1_4 Reverse -330 -349 1.57275 0.174
NP_442743.1_4 Reverse -313 -332 -7.08038 0.279
NP_440457.1_1 Forward -400 -388 2.30059 0.214
NP_440457.1_1 Reverse -247 -259 -0.0593532 0.25
NP_441801.1_4 Forward -331 -321 2.53664 0.292
NP_441436.1_6 Reverse -237 -256 17.7974 0.0919
NP_441436.1_8 Forward -397 -378 6.68596 0.297
NP_442509.1_9 Reverse -251 -261 6.0761 0.293
NP_442514.1_5 Reverse -311 -330 -7.57277 0.276
NP_442514.1_5 Forward -335 -316 -8.75273 0.29
NP_440554.1_4 Reverse -388 -398 4.10993 0.201
NP_441885.1_5 Forward -396 -386 9.51814 0.0206
NP_441885.1_5 Reverse -387 -397 1.25834 0.11
NP_442341.1_7 Forward -397 -383 2.94952 0.239
NP_442341.1_9 Forward -324 -310 5.60385 0.263
NP_440423.1_3 Forward -245 -226 14.3558 0.201
NP_443000.1_7 Forward -398 -388 7.35486 0.0859
NP_440275.1_3 Forward -398 -388 5.5849 0.14
NP_440091.1_1 Forward -400 -388 6.72548 0.0921
NP_440216.1_9 Reverse -112 -121 10.6195 0.286
NP_440216.1_9 Forward -117 -108 6.19458 0.289
NP_440172.1_1 Forward -338 -328 4.40493 0.189
NP_440172.1_1 Forward -315 -305 4.20827 0.2
NP_440172.1_1 Reverse -387 -397 2.24165 0.279
NP_442015.1_10 Reverse -383 -396 18.6038 0.006
NP_442015.1_10 Reverse -296 -309 -1.16069 0.297
NP_441226.1_7 Forward -395 -388 12.7234 0.0312
NP_441226.1_7 Reverse -388 -395 11.5435 0.0757
NP_441111.1_7 Reverse -388 -396 8.86921 0.0589
NP_441111.1_7 Reverse -340 -348 -0.472234 0.131
NP_441111.1_7 Forward -259 -251 -0.668896 0.274
NP_441766.1_2 Reverse -387 -396 12.6844 0.0158
NP_441766.1_2 Reverse -339 -348 5.3096 0.131
NP_441766.1_9 Forward -248 -229 -1.08219 0.261
NP_440416.1_9 Reverse -305 -324 -7.37537 0.0996
NP_443052.1_9 Forward -54 -35 -5.9004 0.274
NP_442552.1_4 Forward -282 -263 17.4269 0.235
NP_440261.1_5 Reverse -340 -353 -11.5838 0.264
NP_440988.1_10 Forward -398 -384 5.28608 0.243
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

AAATGGCGATCGGAATGGAAACGTTATAAATGCTCCAGGAATCGAGGGTTTGGGCCACCGCGGGCAATAACTTCCCCAGGGCAATGCCAATGACGATACAAAGGGCAACCCAGAGGGTAAGGTATTTTTCAAACAAATTGAGCGTTCCCCCAGCCTTAATGGCTTTGGGGTTAATGCGATTGACCATGACAACTCATCAAAAAAACTTGATGGAATAATCTTACATCAAAAAAACTTGATATGTCAACTCGGTCTGTCCCCGGTCTACTGTTGCCGTGTCTTCCGATGGAAAAGGAGCAAAATAGAGTACTTTATGGAAATCTCATTGCCCCCATTGTTCCATTCACATCCTCCGCTGCCTTAGGTAAAGGGGCATTCAACCTATTTTTCTGATAAAACA

CDS

ATGCCCGCCCCCAAAATTATTAAAATTGGTCAAAATACTGCTTTAATTCTTGCTTCAATTGTCCTTAGTTTGGTAATAGCTGAAATTGCATTGAGGTTAACTGGCATAGGTAAATACAGTCTCTATGACCGAATTTTATTTTTTACCAAGCCTTCCCTGGTGAGAACGGGGGATAAAACTGTTAGGTATGAGCCAAGAACGAAAATTAGAAGTGTTGCTATCTATGGGGATGAAGTTGATTACGACATTGTCTATGGCACCAATAACCTCGGTTTTGTAGATGACGTAGACTACAATTTTGATTCCGCCCCCGGCAAAAAAGTTGTGTTTGTCGGTGACTCTTTCACCGCCGGAGATGGGGGCAATCAGTCCTGGATCAGTCAACTAAGGCGACGTTTGGATCGCCCAGAGATCAGTCTATACAACCTTGGTATTACCGGCGCTGGAGTCAAACAATTTCAGCAATTACTGACAAGTGTTAAAGATGGGGCGCATTTTGATGAAATTAATATCATGGTCATTGGTAATGACTTTTTTCGGACTTTGTGGTATCCGTTAATCCAAGACCAAGCCCTCTGGTTTTGCCAGCAAGAAAACACTAAGGAATGCGTAGAAAATTACCCTCCAGTTATGTACATTGCCAACTACAACGATAGTCAAGAAGAATTGGTAGACCGGGCCAAAAAATTATATGAAACTAAGGGTTCTTCGGAGGAACCCAAGCTAAATTTTCTGCAACAGTTACGTCTGTATAATCTAGCCTGTGATGTGTATAGTTTGGGCAAAAATCAAAGTTCACTCGTTCATTTTTGTCCTCATCTTAAATTTAATCAGGCTAATGAGTATGACAAAAACGAGCTATACAAAAATGCCTTAGCTAGTTTAAGAGAGATTAAAAATAGTTTTCCCAACGCGGTTGTTCGTGTCGTCCACATCCCGGAAAAAGGAGAAACTTTCAGTAATAAGTACTCCCTGGAAATTGGAAGTGATATCAAGCAAATAGGATTGGAGTATGTTCCCCTGCTAGAAATCTGCACTTGGAATCGAGACATGTACCATAAACACGACGCCCATTTTAATGATTTGGGCTACCACAATTTGACTGAGTGCATTTTGGAAAATTTATTTTGA

Protein

MPAPKIIKIGQNTALILASIVLSLVIAEIALRLTGIGKYSLYDRILFFTKPSLVRTGDKTVRYEPRTKIRSVAIYGDEVDYDIVYGTNNLGFVDDVDYNFDSAPGKKVVFVGDSFTAGDGGNQSWISQLRRRLDRPEISLYNLGITGAGVKQFQQLLTSVKDGAHFDEINIMVIGNDFFRTLWYPLIQDQALWFCQQENTKECVENYPPVMYIANYNDSQEELVDRAKKLYETKGSSEEPKLNFLQQLRLYNLACDVYSLGKNQSSLVHFCPHLKFNQANEYDKNELYKNALASLREIKNSFPNAVVRVVHIPEKGETFSNKYSLEIGSDIKQIGLEYVPLLEICTWNRDMYHKHDAHFNDLGYHNLTECILENLF