Your browser is old and dusty. Try Google Chrome!

Details for sll0896

ORF sll0896
Accession NP_442790.1
Symbol ruvC
Category Holliday juction resolvase RuvC
Definition DNA replication, restriction, modification, recombination, and repair
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Forward -303 -289 17.0108 0.0268
NP_441061.1_2 Forward -351 -337 2.06454 0.179
NP_441061.1_2 Reverse -296 -310 0.786239 0.199
NP_440795.1_7 Forward -303 -296 14.6904 0.0123
NP_440795.1_7 Reverse -296 -303 14.6904 0.0123
NP_441418.1_6 Forward -304 -285 -19.0768 0.0844
NP_440815.1_5 Forward -304 -285 4.81767 0.286
NP_442291.1_5 Forward -305 -289 4.87675 0.0841
NP_440897.1_6 Reverse -295 -314 17.2065 0.0226
NP_441453.1_4 Reverse -295 -303 16.539 0.00633
NP_441453.1_4 Forward -304 -296 16.539 0.00633
NP_441453.1_4 Forward -352 -344 3.95266 0.275
NP_441623.1_1 Forward -186 -168 1.98577 0.207
NP_442151.1_6 Reverse -295 -309 20.7474 0.0045
NP_442151.1_6 Forward -304 -290 7.76774 0.19
NP_441818.1_1 Forward -303 -292 18.8393 0.00301
NP_440226.1_1 Forward -304 -285 11.9958 0.0484
NP_441630.1_3 Forward -312 -293 2.85105 0.214
NP_440150.1_6 Forward -115 -96 6.88262 0.223
NP_442173.1_1 Forward -303 -295 15.4574 0.00633
NP_442173.1_1 Reverse -296 -304 15.4574 0.00633
NP_442752.1_4 Forward -304 -297 13.8055 0.0199
NP_442752.1_4 Reverse -295 -302 13.8055 0.0199
NP_443027.1_4 Reverse -293 -303 14.0414 0.0452
NP_441812.1_3 Forward -305 -291 10.9143 0.215
NP_441812.1_3 Forward -347 -333 7.57108 0.272
NP_442975.1_10 Forward -308 -294 10.2254 0.056
NP_442975.1_10 Reverse -291 -305 4.62054 0.241
NP_440784.1_7 Forward -303 -296 15.9687 0.0123
NP_440784.1_7 Reverse -296 -303 15.9687 0.0123
NP_440061.1_9 Reverse -293 -307 9.14375 0.151
NP_440110.1_4 Forward -315 -296 17.6007 0.0521
NP_440110.1_8 Forward -175 -156 2.55606 0.211
NP_442062.1_8 Forward -304 -294 17.3846 0.00193
NP_442062.1_8 Reverse -295 -305 17.3846 0.00193
NP_440761.1_4 Reverse -290 -309 -13.1769 0.257
NP_441859.1_3 Forward -80 -61 7.57013 0.157
NP_440304.1_4 Reverse -293 -303 10.8948 0.051
NP_440304.1_4 Forward -306 -296 1.84832 0.299
NP_442242.1_4 Forward -303 -296 14.3954 0.0124
NP_442242.1_4 Reverse -296 -303 14.3954 0.0124
NP_440044.1_8 Reverse -296 -315 1.76941 0.164
NP_440044.1_8 Forward -303 -284 -1.96717 0.256
NP_440916.1_1 Reverse -149 -163 12.3893 0.206
NP_441200.1_4 Reverse -179 -198 7.96426 0.26
NP_441935.1_6 Forward -295 -276 17.8957 0.227
NP_441594.1_6 Forward -82 -63 2.45773 0.251
NP_442110.1_7 Reverse -295 -309 2.06454 0.222
NP_442110.1_7 Forward -304 -290 0.294584 0.264
NP_441925.1_4 Reverse -94 -113 -16.6192 0.284
NP_441925.1_4 Reverse -180 -199 -17.6025 0.297
NP_440856.1_4 Forward -82 -63 -5.01543 0.274
NP_440856.1_4 Reverse -36 -55 -5.31042 0.285
NP_440856.1_7 Forward -76 -57 -7.57203 0.252
NP_441083.1_5 Forward -304 -294 20.3345 0.00053
NP_441083.1_5 Reverse -295 -305 20.3345 0.00053
NP_439957.1_7 Forward -36 -17 19.764 0.0612
NP_442827.1_8 Forward -312 -293 0.490334 0.206
NP_441738.1_2 Forward -302 -295 15.28 0.0102
NP_441738.1_2 Reverse -297 -304 15.28 0.0102
NP_441558.1_5 Reverse -293 -312 13.5691 0.057
NP_441558.1_5 Forward -354 -335 10.6192 0.0955
NP_440209.1_1 Reverse -295 -303 18.1123 0.00295
NP_440209.1_1 Forward -304 -296 18.1123 0.00295
NP_442889.1_1 Reverse -97 -116 -13.0786 0.247
NP_442889.1_8 Reverse -292 -306 13.1753 0.0588
NP_442889.1_8 Forward -307 -293 9.73373 0.0945
NP_441713.1_1 Forward -165 -146 -17.1101 0.298
NP_441770.1_4 Forward -66 -47 -9.73531 0.26
NP_440178.1_7 Forward -305 -286 -5.9004 0.0657
NP_441716.1_1 Forward -179 -165 11.111 0.0936
NP_441716.1_1 Forward -304 -290 4.22782 0.256
NP_442111.1_4 Reverse -294 -308 11.111 0.0515
NP_441163.1_1 Reverse -270 -287 8.29791 0.232
NP_440906.1_5 Forward -303 -296 15.8704 0.0124
NP_440906.1_5 Reverse -296 -303 15.8704 0.0124
NP_440747.1_10 Forward -307 -295 14.887 0.00223
NP_440747.1_10 Reverse -292 -304 7.51213 0.00286
NP_440747.1_10 Reverse -82 -94 -11.9574 0.178
NP_441486.1_1 Reverse -292 -306 23.5007 0.00162
NP_441486.1_1 Forward -307 -293 12.586 0.0112
NP_441486.1_1 Reverse -346 -360 -4.22864 0.192
NP_440403.1_10 Forward -121 -102 2.55606 0.279
NP_441014.1_10 Forward -305 -286 19.0748 0.0349
NP_441014.1_10 Forward -231 -212 3.53858 0.213
NP_442848.1_1 Reverse -289 -303 6.48943 0.0791
NP_442848.1_4 Forward -230 -216 6.98109 0.282
NP_443018.1_3 Forward -303 -296 14.8871 0.0123
NP_443018.1_3 Reverse -296 -303 14.8871 0.0123
NP_443018.1_3 Reverse -344 -351 10.6589 0.0967
NP_443018.1_3 Reverse -94 -101 7.6106 0.156
NP_443018.1_3 Forward -351 -344 4.16902 0.278
NP_441634.1_8 Forward -306 -292 -4.62196 0.295
NP_440376.1_1 Forward -304 -295 19.4693 0.000692
NP_440376.1_1 Reverse -295 -304 19.4693 0.000692
NP_440376.1_1 Forward -112 -103 0.393051 0.279
NP_441588.1_4 Reverse -297 -307 15.9097 0.0369
NP_441588.1_4 Forward -302 -292 8.63316 0.14
NP_442687.1_7 Reverse -308 -318 11.8781 0.0928
NP_442687.1_7 Forward -305 -295 8.92815 0.0994
NP_442687.1_7 Reverse -294 -304 8.92815 0.0994
NP_442191.1_4 Forward -168 -154 11.3809 0.262
NP_440066.1_5 Forward -227 -208 17.3048 0.19
NP_442485.1_3 Forward -96 -77 -2.0655 0.261
NP_442485.1_3 Forward -193 -174 -3.24547 0.272
NP_441846.1_10 Forward -113 -94 -13.1769 0.199
NP_440642.1_10 Forward -313 -299 9.34041 0.193
NP_441422.1_7 Reverse -341 -358 -8.61428 0.276
NP_442296.1_9 Forward -303 -284 -5.40875 0.284
NP_441763.1_10 Reverse -284 -303 10.52 0.153
NP_440360.1_10 Forward -77 -63 11.2093 0.164
NP_442658.1_1 Reverse -293 -303 6.76441 0.214
NP_442658.1_1 Forward -306 -296 6.76441 0.214
NP_442658.1_1 Forward -104 -94 6.56775 0.224
NP_441414.1_9 Reverse -295 -314 10.5209 0.0205
NP_441414.1_9 Forward -304 -285 7.66927 0.0328
NP_440720.1_1 Forward -315 -296 9.83255 0.154
NP_442937.1_5 Reverse -162 -181 10.0292 0.173
NP_442937.1_5 Forward -309 -290 9.63589 0.185
NP_441317.1_4 Reverse -9 -23 13.2836 0.181
NP_441958.1_5 Forward -305 -295 12.2714 0.00183
NP_441958.1_5 Reverse -294 -304 12.2714 0.00183
NP_440610.1_3 Reverse -337 -356 18.0924 0.0866
NP_441127.1_1 Forward -167 -153 10.0294 0.262
NP_442836.1_10 Forward -204 -194 9.32148 0.277
NP_439905.1_1 Reverse -94 -107 6.90245 0.272
NP_439905.1_1 Forward -351 -338 6.50913 0.285
NP_440984.1_7 Forward -309 -295 11.3077 0.122
NP_439990.1_5 Forward -309 -296 10.934 0.128
NP_439990.1_5 Reverse -290 -303 6.70579 0.223
NP_442690.1_1 Reverse -17 -36 -5.31042 0.157
NP_442911.1_2 Forward -314 -295 -1.96717 0.092
NP_442911.1_2 Reverse -285 -304 -2.16383 0.0946
NP_440153.1_8 Forward -358 -345 4.44418 0.2
NP_443055.1_3 Reverse -286 -305 12.6504 0.205
NP_441913.1_3 Reverse -21 -34 14.3856 0.264
NP_441099.1_5 Reverse -285 -304 4.12936 0.0504
NP_441099.1_5 Forward -314 -295 -10.522 0.256
NP_441099.1_5 Reverse -160 -179 -11.8003 0.29
NP_442002.1_1 Forward -168 -150 -2.43913 0.203
NP_442002.1_1 Forward -111 -93 -5.29072 0.237
NP_441294.1_7 Forward -308 -294 9.15464 0.256
NP_441646.1_1 Forward -311 -292 9.53756 0.127
NP_441646.1_1 Forward -359 -340 2.26107 0.219
NP_442438.1_10 Forward -309 -295 0.0979218 0.239
NP_442438.1_10 Reverse -290 -304 -0.393733 0.259
NP_440377.1_1 Forward -272 -255 11.0804 0.291
NP_440147.1_4 Forward -306 -293 11.3273 0.0326
NP_440147.1_4 Reverse -293 -306 2.18257 0.209
NP_441175.1_7 Reverse -295 -314 7.37428 0.234
NP_441550.1_8 Forward -306 -296 14.6309 0.0132
NP_441550.1_8 Reverse -293 -303 12.3692 0.0336
NP_441550.1_8 Forward -354 -344 7.55106 0.154
NP_441916.1_7 Forward -304 -294 10.3048 0.0261
NP_441916.1_7 Reverse -295 -305 10.3048 0.0261
NP_441916.1_10 Reverse -287 -306 2.45773 0.246
NP_441041.1_4 Forward -304 -285 4.62101 0.0558
NP_441041.1_4 Reverse -295 -314 -8.65367 0.205
NP_442396.1_5 Forward -308 -295 12.114 0.0913
NP_442396.1_5 Reverse -291 -304 9.16406 0.13
NP_442004.1_6 Forward -79 -65 3.04785 0.251
NP_442004.1_6 Reverse -343 -357 2.75286 0.257
NP_441725.1_5 Forward -303 -293 11.2881 0.0247
NP_441725.1_5 Reverse -296 -306 2.04498 0.115
NP_439966.1_7 Reverse -293 -303 15.8108 0.0124
NP_439966.1_7 Forward -306 -296 7.25606 0.15
NP_439966.1_7 Reverse -341 -351 4.7978 0.258
NP_442941.1_3 Forward -303 -293 19.9412 0.00262
NP_442941.1_3 Reverse -296 -306 11.0914 0.0116
NP_440289.1_2 Reverse -292 -305 13.294 0.0132
NP_440289.1_2 Forward -307 -294 -4.9956 0.294
NP_440260.1_8 Forward -313 -295 -7.45401 0.295
NP_442281.1_1 Reverse -290 -304 16.9119 0.00698
NP_442281.1_1 Forward -309 -295 8.84875 0.075
NP_442281.1_1 Forward -249 -235 2.26061 0.272
NP_442256.1_2 Reverse -293 -311 1.98577 0.107
NP_442256.1_2 Forward -306 -288 -0.374176 0.14
NP_001035871.2_7 Forward -207 -197 12.8614 0.243
NP_440437.1_1 Forward -310 -291 -3.93378 0.248
NP_441644.1_6 Forward -304 -294 17.3841 0.00127
NP_441644.1_6 Reverse -295 -305 17.3841 0.00127
NP_441644.1_6 Reverse -343 -353 3.32285 0.288
NP_442215.1_2 Forward -306 -290 11.4649 0.0394
NP_442215.1_2 Reverse -293 -309 8.22001 0.0666
NP_442029.1_1 Forward -114 -95 -19.4701 0.29
NP_442029.1_6 Forward -260 -241 9.73422 0.184
NP_440253.1_2 Forward -304 -286 -1.75081 0.249
NP_440253.1_2 Reverse -295 -313 -3.71743 0.3
NP_440929.1_8 Forward -304 -295 19.2726 0.000701
NP_440929.1_8 Reverse -295 -304 19.2726 0.000701
NP_440929.1_8 Reverse -100 -109 2.65466 0.253
NP_442933.1_10 Forward -304 -295 17.601 0.00325
NP_442933.1_10 Reverse -295 -304 17.601 0.00325
NP_441751.2_8 Forward -303 -289 12.8809 0.0186
NP_442554.1_8 Forward -303 -293 15.9097 0.00747
NP_442554.1_8 Reverse -296 -306 15.3197 0.00882
NP_442554.1_8 Forward -351 -341 5.09324 0.161
NP_442970.1_7 Forward -35 -16 19.8386 0.134
NP_441762.1_7 Reverse -294 -306 0.432302 0.0747
NP_441762.1_7 Forward -305 -293 -6.84419 0.284
NP_442142.1_4 Reverse -292 -305 14.1783 0.0311
NP_442142.1_4 Reverse -90 -103 6.11523 0.173
NP_442142.1_4 Forward -307 -294 2.96866 0.269
NP_442292.1_1 Forward -303 -294 18.486 0.00229
NP_442292.1_1 Reverse -296 -305 18.486 0.00229
NP_441711.1_4 Reverse -286 -305 4.71934 0.202
NP_443009.1_2 Forward -350 -331 2.45773 0.216
NP_443009.1_5 Reverse -294 -305 8.90795 0.0965
NP_443009.1_5 Forward -305 -294 8.90795 0.0965
NP_442408.2_1 Forward -304 -285 -6.98204 0.287
NP_441715.1_4 Forward -303 -293 14.828 0.0268
NP_441715.1_4 Reverse -296 -306 7.94484 0.107
NP_440357.1_3 Forward -354 -335 9.53756 0.203
NP_441448.1_1 Reverse -59 -78 15.5357 0.158
NP_441448.1_1 Forward -295 -276 7.96426 0.21
NP_440183.1_9 Forward -356 -337 -15.4385 0.273
NP_441198.1_5 Reverse -297 -310 14.67 0.206
NP_440464.1_10 Reverse -296 -306 13.0082 0.169
NP_441468.1_1 Forward -303 -296 15.8704 0.0124
NP_441468.1_1 Reverse -296 -303 15.8704 0.0124
NP_441468.1_1 Reverse -344 -351 3.97235 0.277
NP_441020.2_6 Forward -306 -289 8.20031 0.205
NP_441020.2_6 Reverse -293 -310 6.43035 0.262
NP_441015.1_10 Reverse -290 -309 -5.80207 0.232
NP_441015.1_10 Forward -357 -338 -7.17871 0.264
NP_441673.1_1 Forward -304 -295 20.8459 0.000698
NP_441673.1_1 Reverse -295 -304 20.8459 0.000698
NP_440286.1_2 Reverse -208 -221 15.9489 0.296
NP_441826.1_2 Reverse -289 -303 3.14618 0.115
NP_441826.1_2 Forward -310 -296 -1.47537 0.248
NP_442811.1_2 Forward -300 -281 -1.27885 0.256
NP_442868.1_6 Reverse -293 -303 9.91146 0.038
NP_442868.1_6 Forward -306 -296 9.81313 0.038
NP_441056.1_1 Forward -304 -285 -8.26035 0.282
NP_441612.1_2 Reverse -295 -305 8.54929 0.21
NP_441612.1_2 Forward -304 -294 8.54929 0.21
NP_443058.1_7 Forward -305 -286 10.3242 0.206
NP_442361.1_3 Forward -310 -297 9.36073 0.276
NP_442361.1_3 Reverse -289 -302 7.88576 0.285
NP_442808.1_1 Reverse -294 -304 8.63269 0.0481
NP_442808.1_1 Forward -305 -295 8.63269 0.0481
NP_442808.1_1 Reverse -82 -92 1.15957 0.292
NP_440145.1_3 Forward -362 -343 -2.36049 0.168
NP_442542.1_2 Forward -104 -91 13.1956 0.114
NP_442050.1_5 Reverse -293 -303 16.4991 0.00812
NP_442050.1_5 Forward -306 -296 7.64939 0.243
NP_441937.1_5 Reverse -59 -78 2.26107 0.278
NP_440558.1_2 Reverse -67 -86 -2.75381 0.229
NP_441518.1_3 Reverse -285 -304 -5.21209 0.123
NP_441878.1_6 Forward -305 -295 10.4031 0.0176
NP_441878.1_6 Reverse -294 -304 10.4031 0.0176
NP_441878.1_6 Forward -95 -85 -6.60814 0.193
NP_441878.1_6 Forward -359 -349 -7.49312 0.231
NP_441878.1_6 Forward -113 -103 -7.88644 0.278
NP_441036.1_8 Forward -110 -100 10.0098 0.174
NP_441036.1_8 Forward -305 -295 8.33817 0.174
NP_441036.1_8 Reverse -294 -304 8.33817 0.174
NP_442650.1_2 Reverse -182 -196 2.65453 0.254
NP_442721.1_4 Reverse -29 -48 15.9291 0.291
NP_441557.1_5 Forward -304 -295 19.9609 0.000699
NP_441557.1_5 Reverse -295 -304 19.9609 0.000699
NP_441520.1_7 Forward -77 -58 7.07928 0.236
NP_441445.1_1 Reverse -286 -305 3.83436 0.205
NP_442066.2_9 Forward -141 -128 12.6056 0.154
NP_442066.2_9 Reverse -291 -304 9.06573 0.181
NP_441433.1_8 Reverse -125 -144 -3.44213 0.283
NP_440738.1_3 Reverse -150 -169 15.0441 0.054
NP_440738.1_5 Reverse -43 -62 2.16274 0.289
NP_441458.1_10 Forward -313 -294 5.40766 0.216
NP_442469.1_2 Forward -258 -240 13.3922 0.298
NP_442183.1_1 Forward -304 -290 19.8624 0.0054
NP_442183.1_3 Forward -227 -208 16.2232 0.241
NP_441574.1_1 Forward -79 -60 -3.24547 0.238
NP_441238.1_10 Reverse -159 -173 12.0943 0.292
NP_442347.1_2 Forward -303 -294 12.4878 0.056
NP_442347.1_2 Reverse -296 -305 12.4878 0.056
NP_442645.1_2 Reverse -287 -306 -14.3569 0.173
NP_442645.1_2 Forward -312 -293 -22.42 0.291
NP_442888.1_6 Reverse -332 -351 4.52268 0.228
NP_441037.1_4 Forward -306 -296 7.9999 0.237
NP_441633.1_3 Forward -306 -293 1.10092 0.109
NP_441633.1_3 Reverse -293 -306 -5.97891 0.236
NP_440136.1_2 Forward -303 -296 15.9687 0.0123
NP_440136.1_2 Reverse -296 -303 15.9687 0.0123
NP_442590.1_10 Reverse -97 -116 4.62101 0.273
NP_442590.1_10 Reverse -337 -356 4.03102 0.282
NP_442590.1_10 Forward -322 -303 3.53937 0.29
NP_442998.1_10 Forward -302 -295 15.5754 0.0102
NP_442998.1_10 Reverse -297 -304 15.5754 0.0102
NP_440899.1_1 Reverse -284 -303 10.4569 0.181
NP_440899.1_2 Reverse -284 -303 5.70185 0.275
NP_440899.1_3 Forward -176 -157 14.1591 0.233
NP_440299.1_1 Forward -308 -295 22.7331 0.000547
NP_440299.1_1 Reverse -291 -304 4.34528 0.209
NP_441799.1_1 Reverse -291 -305 12.2903 0.0441
NP_441799.1_1 Forward -308 -294 6.98048 0.155
NP_441799.1_9 Forward -113 -94 -4.91709 0.272
NP_441007.1_10 Reverse -290 -303 9.95071 0.0804
NP_441007.1_10 Reverse -338 -351 -0.964025 0.296
NP_441007.1_10 Forward -309 -296 -0.964025 0.296
NP_442201.1_10 Forward -315 -296 2.94938 0.0961
NP_440256.1_1 Reverse -292 -311 -1.37718 0.103
NP_441559.1_8 Forward -225 -211 -6.09693 0.274
NP_440915.1_6 Forward -106 -92 7.9644 0.0631
NP_440915.1_6 Forward -308 -294 3.44117 0.101
NP_440915.1_6 Forward -356 -342 0.0979218 0.176
NP_440748.1_5 Reverse -280 -299 -1.47551 0.267
NP_440787.1_5 Forward -36 -22 10.521 0.256
NP_441939.1_3 Reverse -296 -315 7.47261 0.201
NP_441494.1_6 Reverse -65 -78 16.6372 0.102
NP_439985.1_7 Reverse -337 -356 3.73603 0.26
NP_442993.1_1 Forward -304 -288 -9.28291 0.181
NP_442386.1_9 Reverse -294 -303 13.8639 0.0289
NP_442386.1_9 Forward -305 -296 13.8639 0.0289
NP_442386.1_9 Reverse -342 -351 9.93072 0.144
NP_441340.1_5 Forward -303 -296 15.6737 0.0124
NP_441340.1_5 Reverse -296 -303 15.6737 0.0124
NP_441340.1_5 Forward -351 -344 11.3472 0.0526
NP_442484.1_2 Forward -315 -296 -1.67217 0.295
NP_442240.1_2 Reverse -296 -315 -18.8801 0.295
NP_440586.1_1 Reverse -339 -358 -2.85214 0.259
NP_440586.1_8 Forward -303 -296 13.2151 0.026
NP_440586.1_8 Reverse -296 -303 13.2151 0.026
NP_440586.1_8 Reverse -344 -351 5.74197 0.283
NP_442251.1_6 Forward -303 -296 15.2804 0.0124
NP_442251.1_6 Reverse -296 -303 15.2804 0.0124
NP_440684.1_9 Reverse -289 -303 9.73436 0.216
NP_440684.1_9 Reverse -266 -280 6.6861 0.294
NP_441262.1_3 Reverse -295 -302 14.7888 0.0223
NP_441262.1_3 Forward -304 -297 14.7888 0.0223
NP_440027.1_3 Reverse -93 -111 8.96649 0.187
NP_440027.1_3 Reverse -343 -361 1.78836 0.295
NP_443051.1_1 Reverse -294 -303 10.4228 0.00754
NP_443051.1_1 Forward -305 -296 10.4228 0.00754
NP_439937.1_9 Reverse -92 -109 -12.8431 0.276
NP_441740.2_1 Reverse -172 -191 13.9625 0.264
NP_440372.1_2 Forward -303 -296 16.3621 0.0124
NP_440372.1_2 Reverse -296 -303 16.3621 0.0124
NP_440316.1_10 Forward -103 -93 14.238 0.199
NP_440316.1_10 Forward -287 -277 6.46988 0.257
NP_441803.1_2 Reverse -290 -309 4.42435 0.178
NP_441803.1_2 Forward -351 -332 0.982764 0.242
NP_442384.1_10 Reverse -295 -308 17.7189 0.00567
NP_442384.1_10 Forward -304 -291 8.18076 0.0685
NP_440948.1_10 Reverse -95 -114 17.994 0.179
NP_441604.1_4 Forward -312 -293 1.86774 0.211
NP_441877.1_5 Reverse -27 -46 1.17943 0.276
NP_442262.1_10 Forward -303 -296 14.1988 0.0123
NP_442262.1_10 Reverse -296 -303 14.1988 0.0123
NP_442262.1_10 Reverse -344 -351 12.0355 0.062
NP_442262.1_10 Reverse -94 -101 8.8889 0.219
NP_442262.1_10 Reverse -236 -243 7.11894 0.287
NP_441689.1_5 Reverse -293 -303 15.3192 0.0403
NP_441689.1_5 Forward -306 -296 5.78111 0.197
NP_440163.1_10 Reverse -292 -302 11.3864 0.169
NP_440344.1_10 Reverse -288 -305 -0.0594896 0.0381
NP_440344.1_10 Forward -311 -294 -8.61428 0.13
NP_440282.1_10 Reverse -60 -79 -8.752 0.263
NP_440531.1_1 Forward -220 -201 14.0608 0.134
NP_440531.1_6 Reverse -287 -306 12.9791 0.048
NP_441965.1_10 Forward -307 -291 2.61514 0.285
NP_440297.1_9 Forward -303 -293 9.32148 0.0917
NP_440297.1_9 Reverse -296 -306 -0.118297 0.282
NP_442280.1_5 Forward -336 -317 14.5214 0.276
NP_442280.1_10 Forward -314 -296 9.35044 0.233
NP_441592.1_4 Reverse -295 -314 -3.14714 0.275
NP_440999.1_9 Reverse -291 -305 1.27789 0.168
NP_440888.1_2 Forward -304 -290 14.4536 0.0176
NP_440888.1_2 Reverse -93 -107 13.8636 0.0231
NP_440888.1_2 Reverse -295 -309 13.372 0.0297
NP_440600.1_4 Forward -312 -294 -1.84914 0.178
NP_440491.1_1 Reverse -292 -311 25.0441 0.00399
NP_440052.1_5 Forward -315 -296 12.0942 0.0714
NP_441543.1_2 Forward -303 -294 16.9127 0.00359
NP_441543.1_2 Reverse -296 -305 16.9127 0.00359
NP_442845.1_2 Forward -358 -344 7.47274 0.195
NP_442845.1_2 Forward -310 -296 6.19444 0.215
NP_442845.1_2 Reverse -289 -303 5.99778 0.219
NP_442845.1_2 Reverse -337 -351 4.71948 0.254
NP_441551.1_5 Reverse -339 -355 8.31764 0.238
NP_441258.1_9 Reverse -340 -359 9.93088 0.204
NP_441469.1_8 Forward -305 -296 6.48957 0.227
NP_441469.1_8 Reverse -294 -303 6.48957 0.227
NP_443064.1_6 Forward -304 -294 12.5669 0.0796
NP_443064.1_6 Reverse -295 -305 12.5669 0.0796
NP_442337.1_8 Forward -90 -71 0.786102 0.244
NP_442578.1_7 Forward -303 -296 14.5921 0.026
NP_442578.1_7 Reverse -296 -303 14.5921 0.026
NP_440710.1_1 Reverse -287 -305 -3.6191 0.208
NP_441462.1_2 Forward -304 -294 11.5831 0.00406
NP_441462.1_2 Reverse -295 -305 11.5831 0.00406
NP_441462.1_2 Reverse -85 -95 -0.904945 0.265
NP_443062.1_1 Forward -304 -286 16.444 0.031
NP_443062.1_6 Forward -87 -68 2.94938 0.247
NP_440519.1_6 Reverse -88 -102 13.8643 0.29
NP_441560.1_8 Forward -223 -204 13.4605 0.209
NP_440516.1_8 Forward -304 -295 16.9127 0.00442
NP_440516.1_8 Reverse -295 -304 16.9127 0.00442
NP_440516.1_8 Forward -102 -93 -0.491928 0.262
NP_440516.1_8 Forward -352 -343 -0.590259 0.283
NP_442428.1_5 Forward -303 -296 15.8704 0.0124
NP_442428.1_5 Reverse -296 -303 15.8704 0.0124
NP_442428.1_5 Reverse -344 -351 4.36568 0.271
NP_442120.1_10 Reverse -23 -42 -16.0285 0.296
NP_440673.1_2 Forward -314 -295 12.048 0.156
NP_440673.1_3 Forward -302 -295 12.4288 0.0426
NP_440673.1_3 Reverse -297 -304 12.4288 0.0426
NP_440673.1_3 Reverse -72 -79 10.5605 0.123
NP_440673.1_3 Reverse -95 -102 8.98723 0.203
NP_441714.1_3 Forward -311 -293 15.5546 0.145
NP_441714.1_3 Reverse -288 -306 13.7847 0.211
NP_441052.1_2 Forward -304 -294 19.9412 0.00106
NP_441052.1_2 Reverse -295 -305 19.9412 0.00106
NP_442219.1_8 Reverse -291 -310 13.7718 0.152
NP_442219.1_8 Forward -246 -227 9.80987 0.219
NP_442219.1_9 Forward -303 -294 17.7976 0.00718
NP_442219.1_9 Reverse -296 -305 17.7976 0.00718
NP_440436.1_4 Forward -303 -294 17.2072 0.00233
NP_440436.1_4 Reverse -296 -305 17.2072 0.00233
NP_440436.1_4 Reverse -71 -80 6.48915 0.157
NP_441884.1_9 Reverse -292 -311 -13.0786 0.138
NP_441884.1_9 Forward -79 -60 -22.6167 0.281
NP_441884.1_9 Forward -307 -288 -25.4683 0.29
NP_440648.1_1 Reverse -295 -314 6.88262 0.19
NP_441719.1_2 Forward -307 -293 13.925 0.278
NP_441719.1_4 Forward -303 -296 16.3621 0.0124
NP_441719.1_4 Reverse -296 -303 16.3621 0.0124
NP_440746.1_3 Reverse -83 -102 -0.000545616 0.287
NP_441004.1_4 Forward -105 -95 17.188 0.152
NP_442813.1_5 Forward -202 -183 6.98095 0.202
NP_442366.1_3 Reverse -294 -312 4.05072 0.101
NP_442366.1_3 Forward -305 -287 -5.19239 0.284
NP_442366.1_5 Forward -307 -297 15.4175 0.0374
NP_442873.1_2 Forward -116 -97 14.9449 0.193
NP_442873.1_3 Forward -229 -210 4.52188 0.263
NP_440296.1_10 Forward -115 -96 -13.1769 0.269
NP_442206.1_10 Forward -304 -289 8.04304 0.178
NP_442206.1_10 Reverse -343 -358 3.71647 0.181
NP_443054.1_2 Reverse -293 -307 1.57289 0.245
NP_441851.1_10 Forward -305 -295 15.8113 0.00552
NP_441851.1_10 Reverse -294 -304 15.8113 0.00552
NP_441851.1_10 Reverse -65 -75 7.45319 0.14
NP_442622.1_1 Reverse -84 -103 -12.7836 0.276
NP_442515.1_1 Forward -305 -291 10.7177 0.0469
NP_442515.1_1 Reverse -294 -308 4.42448 0.107
NP_442515.1_1 Reverse -84 -98 -3.93365 0.298
NP_440593.1_3 Reverse -338 -357 -0.000545616 0.198
NP_440593.1_3 Reverse -95 -114 -6.78538 0.28
NP_440463.1_7 Forward -74 -60 14.0609 0.299
NP_442689.1_8 Reverse -21 -38 6.72535 0.155
NP_441349.1_10 Reverse -285 -304 -6.78538 0.236
NP_441349.1_10 Forward -83 -64 -8.85033 0.279
NP_440432.1_9 Forward -303 -288 -1.10174 0.167
NP_440432.1_9 Reverse -296 -311 -1.69173 0.167
NP_442843.1_1 Forward -101 -82 5.01433 0.149
NP_442843.1_1 Forward -111 -92 -8.35868 0.255
NP_442843.1_1 Forward -243 -224 -10.522 0.278
NP_440474.1_8 Forward -303 -289 5.01387 0.26
NP_440431.1_10 Forward -32 -18 20.0591 0.126
NP_442450.1_5 Reverse -293 -303 9.32148 0.115
NP_442450.1_5 Forward -306 -296 7.55152 0.13
NP_442006.1_2 Reverse -301 -318 -11.5642 0.197
NP_442006.1_2 Forward -103 -86 -17.7591 0.282
NP_441003.1_9 Forward -313 -294 3.44104 0.292
NP_441570.1_1 Forward -304 -286 10.7372 0.00838
NP_441078.1_4 Forward -304 -295 19.6659 0.0007
NP_441078.1_4 Reverse -295 -304 19.6659 0.0007
NP_441078.1_4 Reverse -85 -94 -1.18024 0.237
NP_441078.1_4 Forward -94 -85 -1.96689 0.282
NP_442729.1_8 Reverse -291 -304 9.75405 0.125
NP_442729.1_8 Forward -308 -295 9.36073 0.125
NP_442348.1_2 Forward -198 -189 9.4395 0.28
NP_442443.1_1 Reverse -204 -223 -6.68705 0.295
NP_440526.1_3 Forward -303 -292 10.1862 0.0646
NP_440526.1_3 Forward -271 -260 1.72983 0.267
NP_440526.1_3 Reverse -296 -307 1.04151 0.267
NP_441432.1_8 Reverse -294 -303 16.8143 0.00595
NP_441432.1_8 Forward -305 -296 16.8143 0.00595
NP_441432.1_8 Forward -103 -94 3.7363 0.243
NP_441432.1_8 Reverse -348 -357 3.24465 0.252
NP_442320.1_8 Forward -310 -296 4.22782 0.0522
NP_442320.1_8 Reverse -289 -303 3.04785 0.0691
NP_441732.1_2 Forward -308 -292 -7.0213 0.0614
NP_441732.1_2 Reverse -291 -307 -16.5594 0.174
NP_442003.1_4 Forward -303 -284 9.24257 0.3
NP_440760.1_1 Reverse -295 -314 -5.80207 0.0517
NP_440760.1_1 Forward -304 -285 -20.8467 0.225
NP_440199.1_10 Reverse -292 -302 16.7946 0.0381
NP_442353.1_4 Forward -310 -291 10.52 0.106
NP_440913.1_1 Forward -306 -288 3.75572 0.29
NP_440913.1_3 Forward -349 -336 14.9656 0.215
NP_442489.1_7 Forward -304 -295 20.1576 0.000695
NP_442489.1_7 Reverse -295 -304 20.1576 0.000695
NP_440386.1_3 Forward -37 -18 -11.6036 0.286
NP_442079.1_7 Forward -303 -284 1.17943 0.26
NP_440559.1_1 Forward -303 -294 17.4043 0.00658
NP_440559.1_1 Reverse -296 -305 17.4043 0.00658
NP_441659.2_8 Forward -304 -294 18.1713 0.00133
NP_441659.2_8 Reverse -295 -305 18.1713 0.00133
NP_442913.1_10 Forward -313 -294 9.73422 0.0439
NP_442913.1_10 Reverse -286 -305 0.884433 0.15
NP_442346.1_5 Forward -305 -295 16.6963 0.00248
NP_442346.1_5 Reverse -294 -304 16.6963 0.00248
NP_442346.1_5 Forward -80 -70 9.12481 0.118
NP_442346.1_5 Reverse -348 -358 7.84651 0.156
NP_440545.1_3 Forward -116 -99 -0.649475 0.157
NP_440545.1_3 Forward -308 -291 -6.25434 0.273
NP_441629.1_3 Forward -222 -203 0.490334 0.235
NP_440459.1_2 Reverse -91 -108 8.59364 0.254
NP_440459.1_2 Forward -313 -296 7.31533 0.296
NP_440010.1_10 Reverse -97 -116 5.60432 0.232
NP_440010.1_10 Reverse -337 -356 2.0644 0.29
NP_441168.1_7 Forward -226 -207 17.699 0.24
NP_442603.1_7 Reverse -295 -309 13.2736 0.0897
NP_442603.1_7 Forward -352 -338 11.7987 0.112
NP_442603.1_7 Forward -304 -290 7.57046 0.202
NP_440449.1_6 Forward -312 -294 4.36531 0.297
NP_441833.1_4 Forward -303 -296 15.9687 0.0124
NP_441833.1_4 Reverse -296 -303 15.9687 0.0124
NP_442162.1_9 Forward -303 -296 16.2637 0.0124
NP_442162.1_9 Reverse -296 -303 16.2637 0.0124
NP_440671.1_4 Forward -250 -236 5.60446 0.279
NP_442140.1_3 Reverse -296 -306 12.2714 0.0632
NP_442140.1_3 Reverse -344 -354 10.2065 0.0902
NP_442140.1_3 Forward -303 -293 4.40493 0.243
NP_441671.1_10 Forward -55 -36 3.6377 0.222
NP_441813.1_5 Reverse -293 -303 15.9097 0.01
NP_441813.1_5 Forward -306 -296 8.63316 0.0367
NP_441227.1_3 Forward -222 -203 8.65258 0.203
NP_440590.1_4 Reverse -296 -309 17.6205 0.00882
NP_440590.1_4 Forward -108 -95 -3.02898 0.252
NP_440590.1_4 Forward -303 -290 -4.40561 0.261
NP_440567.1_1 Reverse -296 -310 11.7993 0.0267
NP_440567.1_1 Forward -303 -289 10.816 0.0323
NP_442497.1_10 Forward -303 -294 10.4228 0.0087
NP_442497.1_10 Reverse -296 -305 10.4228 0.0087
NP_440821.1_4 Reverse -293 -303 18.2696 0.00448
NP_440821.1_4 Forward -306 -296 9.41981 0.0286
NP_441239.1_9 Reverse -91 -103 5.15219 0.227
NP_441239.1_9 Reverse -293 -305 4.36554 0.253
NP_441239.1_9 Reverse -101 -113 3.97222 0.269
NP_441239.1_9 Forward -306 -294 3.38223 0.285
NP_441009.1_7 Forward -305 -286 9.0459 0.294
NP_440604.1_6 Forward -304 -285 0.294447 0.166
NP_442044.1_1 Forward -357 -338 3.44104 0.132
NP_442643.1_3 Forward -214 -195 -5.99873 0.261
NP_441769.1_10 Reverse -82 -101 15.4374 0.295
NP_440876.1_5 Forward -302 -283 10.0292 0.263
NP_440546.1_4 Forward -352 -342 11.3065 0.0872
NP_440546.1_4 Forward -304 -294 10.046 0.109
NP_440546.1_4 Reverse -295 -305 10.046 0.109
NP_440546.1_4 Forward -244 -234 9.27034 0.146
NP_440675.1_1 Forward -307 -288 6.29264 0.195
NP_440462.1_4 Forward -104 -90 9.34103 0.243
NP_440462.1_6 Reverse -293 -303 7.74818 0.0699
NP_440462.1_6 Forward -306 -296 1.35667 0.294
NP_442340.1_3 Reverse -72 -91 9.73422 0.0851
NP_442611.1_1 Forward -357 -338 -2.0655 0.284
NP_442592.1_7 Forward -303 -284 15.4374 0.292
NP_440868.1_4 Reverse -291 -303 8.20045 0.0602
NP_440868.1_4 Reverse -339 -351 1.21895 0.19
NP_440868.1_4 Forward -308 -296 -0.944332 0.284
NP_441474.1_1 Reverse -90 -109 -2.26292 0.273
NP_442402.1_10 Forward -73 -63 10.6976 0.282
NP_440696.1_3 Reverse -339 -357 0.314141 0.233
NP_440696.1_3 Forward -54 -36 -3.81576 0.29
NP_442882.1_8 Reverse -208 -227 5.89931 0.295
NP_442039.1_4 Forward -303 -296 15.1821 0.0124
NP_442039.1_4 Reverse -296 -303 15.1821 0.0124
NP_441811.1_8 Reverse -64 -78 8.75105 0.231
NP_441811.1_8 Reverse -337 -351 6.19444 0.283
NP_440825.1_7 Reverse -296 -306 12.9096 0.152
NP_442696.1_6 Reverse -80 -99 -13.3736 0.276
NP_442837.1_3 Forward -303 -296 15.7721 0.0124
NP_442837.1_3 Reverse -296 -303 15.7721 0.0124
NP_442053.1_1 Forward -304 -295 18.3876 0.0007
NP_442053.1_1 Reverse -295 -304 18.3876 0.0007
NP_440505.1_3 Reverse -293 -303 16.303 0.00696
NP_440505.1_3 Forward -306 -296 9.22315 0.122
NP_441203.1_1 Reverse -296 -315 -12.2919 0.143
NP_441203.1_2 Forward -173 -154 -4.91709 0.257
NP_440914.1_1 Forward -304 -294 17.5935 0.000537
NP_440914.1_1 Reverse -295 -305 17.5935 0.000537
NP_441011.1_8 Forward -303 -294 8.25953 0.144
NP_441011.1_8 Reverse -296 -305 8.25953 0.144
NP_442101.1_10 Forward -312 -293 -1.08219 0.101
NP_442533.1_1 Forward -176 -157 -15.6352 0.257
NP_442533.1_6 Forward -304 -295 17.2076 0.00137
NP_442533.1_6 Reverse -295 -304 17.2076 0.00137
NP_442533.1_6 Reverse -103 -112 2.16301 0.27
NP_442533.1_6 Reverse -343 -352 1.37636 0.3
NP_442232.1_3 Reverse -62 -81 -15.1435 0.289
NP_441482.1_7 Forward -310 -296 -10.4235 0.209
NP_441482.1_7 Reverse -289 -303 -11.0135 0.229
NP_439944.1_9 Forward -303 -293 19.0562 0.00329
NP_439944.1_9 Reverse -296 -306 10.5014 0.0887
NP_439944.1_9 Reverse -344 -354 5.19158 0.27
NP_441527.1_4 Forward -25 -6 -12.0802 0.285
NP_440115.1_6 Forward -355 -345 8.23984 0.135
NP_440007.1_9 Reverse -291 -305 7.07942 0.213
NP_440903.1_1 Forward -55 -45 16.6963 0.275
NP_441972.1_5 Reverse -296 -315 -3.04881 0.196
NP_441972.1_5 Forward -303 -284 -10.0303 0.296
NP_441106.1_1 Forward -305 -296 9.63616 0.0311
NP_441106.1_1 Reverse -294 -303 9.63616 0.0311
NP_439903.1_6 Reverse -292 -311 -0.886293 0.287
NP_442306.1_10 Reverse -80 -99 -21.4367 0.27
NP_441286.1_1 Forward -305 -293 21.3768 0.00196
NP_441286.1_1 Reverse -294 -306 12.9203 0.00815
NP_442674.1_3 Reverse -287 -306 8.55343 0.194
NP_440670.1_8 Forward -304 -295 18.3876 0.000699
NP_440670.1_8 Reverse -295 -304 18.3876 0.000699
NP_441930.1_2 Forward -103 -93 11.1898 0.298
NP_440886.1_7 Forward -305 -295 7.94438 0.0805
NP_440886.1_7 Reverse -294 -304 7.94438 0.0805
NP_440828.1_1 Reverse -95 -114 5.99684 0.204
NP_442614.1_2 Forward -113 -99 10.0294 0.235
NP_442614.1_2 Forward -304 -290 6.6861 0.287
NP_439995.1_5 Reverse -285 -304 12.1925 0.176
NP_440205.1_1 Reverse -225 -244 9.21203 0.229
NP_442072.1_9 Reverse -294 -312 -21.417 0.208
NP_441808.1_8 Reverse -337 -356 9.3409 0.259
NP_440907.2_8 Reverse -296 -306 7.64939 0.117
NP_441021.1_1 Forward -303 -284 -0.39387 0.101
NP_441021.1_1 Reverse -296 -315 -2.16383 0.133
NP_440841.1_4 Reverse -307 -326 1.57275 0.119
NP_440841.1_4 Reverse -293 -312 -1.7705 0.16
NP_441463.1_3 Reverse -285 -304 6.39097 0.063
NP_441463.1_6 Reverse -293 -307 8.0587 0.25
NP_442842.1_2 Forward -337 -318 10.4225 0.278
NP_441626.1_2 Forward -303 -296 15.7721 0.0124
NP_441626.1_2 Reverse -296 -303 15.7721 0.0124
NP_442238.1_7 Forward -340 -321 14.7483 0.155
NP_442794.1_1 Forward -308 -296 19.1152 0.00716
NP_442794.1_1 Reverse -285 -297 2.89058 0.286
NP_442615.1_1 Forward -313 -295 6.41066 0.0348
NP_441962.1_4 Forward -309 -290 -2.16383 0.129
NP_441962.1_4 Forward -357 -338 -9.44032 0.218
NP_441962.1_4 Forward -43 -24 -15.0452 0.297
NP_440387.1_1 Reverse -295 -311 14.3165 0.00649
NP_440387.1_1 Forward -304 -288 12.6449 0.0112
NP_441431.1_2 Reverse -90 -104 8.25877 0.221
NP_441488.1_8 Forward -309 -295 10.9137 0.146
NP_441836.1_2 Reverse -337 -356 3.93269 0.147
NP_441836.1_2 Reverse -328 -347 -4.22878 0.255
NP_442352.1_1 Forward -73 -60 15.6565 0.215
NP_440114.1_10 Forward -304 -290 9.5377 0.169
NP_441510.2_7 Reverse -289 -303 12.0937 0.28
NP_440293.1_3 Forward -205 -186 -4.81876 0.265
NP_439988.1_3 Forward -106 -92 6.98109 0.278
NP_441237.1_9 Reverse -296 -306 14.828 0.0242
NP_441237.1_9 Forward -351 -341 11.4848 0.176
NP_441311.1_2 Forward -310 -296 13.8636 0.229
NP_442930.1_1 Forward -14 -4 9.81266 0.28
NP_439910.1_2 Reverse -287 -304 -21.6923 0.184
NP_440457.1_1 Reverse -291 -303 -0.0593532 0.25
NP_442561.1_9 Reverse -296 -315 16.1249 0.258
NP_441436.1_2 Forward -109 -90 -3.04881 0.28
NP_442509.1_9 Forward -304 -294 8.14104 0.192
NP_442509.1_9 Reverse -295 -305 8.14104 0.192
NP_442514.1_5 Reverse -239 -258 2.55527 0.167
NP_440554.1_4 Forward -303 -293 7.05986 0.106
NP_441761.1_6 Forward -49 -30 20.5506 0.124
NP_442737.1_5 Forward -299 -280 15.3999 0.166
NP_441885.1_5 Forward -304 -294 20.9245 0.000538
NP_441885.1_5 Reverse -295 -305 20.9245 0.000538
NP_442341.1_7 Reverse -294 -308 17.4042 0.012
NP_442341.1_7 Forward -305 -291 14.3559 0.0299
NP_442341.1_9 Forward -306 -292 8.65209 0.166
NP_440423.1_6 Reverse -287 -306 -18.2901 0.233
NP_440423.1_10 Reverse -323 -342 9.83255 0.259
NP_443000.1_3 Forward -287 -268 15.4008 0.228
NP_443000.1_7 Reverse -293 -303 17.0896 0.00865
NP_443000.1_7 Forward -306 -296 10.3048 0.0345
NP_441842.1_10 Forward -311 -297 7.17775 0.264
NP_440275.1_3 Reverse -293 -303 8.1415 0.0602
NP_440275.1_3 Forward -306 -296 8.04317 0.0602
NP_440091.1_1 Reverse -291 -303 8.88877 0.0567
NP_442275.1_3 Forward -107 -88 11.4058 0.274
NP_440679.1_10 Forward -302 -283 -8.65367 0.18
NP_440679.1_10 Reverse -336 -355 -12.4886 0.198
NP_441122.1_1 Forward -315 -300 3.51981 0.281
NP_439962.1_4 Forward -360 -341 -3.3438 0.251
NP_440149.1_8 Forward -304 -285 -1.86883 0.162
NP_440149.1_8 Reverse -295 -314 -6.39206 0.25
NP_440216.1_1 Reverse -295 -309 -0.787057 0.0284
NP_440216.1_1 Forward -304 -290 -9.73518 0.145
NP_440216.1_1 Forward -94 -80 -12.5868 0.288
NP_440172.1_1 Forward -304 -294 15.0247 0.00945
NP_440172.1_1 Reverse -295 -305 15.0247 0.00945
NP_440172.1_1 Reverse -343 -353 1.74999 0.299
NP_442015.1_10 Forward -308 -295 11.229 0.0372
NP_442015.1_10 Reverse -291 -304 0.510939 0.224
NP_441226.1_7 Forward -303 -296 14.4934 0.0123
NP_441226.1_7 Reverse -296 -303 14.4934 0.0123
NP_441226.1_7 Forward -351 -344 12.4284 0.0404
NP_441111.1_7 Forward -303 -295 18.7023 0.00294
NP_441111.1_7 Reverse -296 -304 18.7023 0.00294
NP_442379.1_10 Reverse -288 -305 3.97208 0.16
NP_441766.1_2 Forward -304 -295 17.5026 0.00297
NP_441766.1_2 Reverse -295 -304 17.5026 0.00297
NP_441766.1_2 Reverse -343 -352 5.40793 0.122
NP_442417.1_5 Reverse -295 -309 9.14437 0.138
NP_440416.1_9 Reverse -92 -111 -11.7019 0.154
NP_440416.1_9 Forward -311 -292 -17.1101 0.231
NP_440416.1_9 Reverse -342 -361 -18.2901 0.256
NP_443052.1_8 Reverse -285 -304 -11.7019 0.236
NP_440261.1_5 Reverse -296 -309 -10.3055 0.201
NP_440261.1_5 Forward -303 -290 -10.5021 0.201
NP_440988.1_10 Reverse -341 -355 9.2554 0.205
NP_440988.1_10 Forward -354 -340 9.15859 0.205
NP_440988.1_10 Reverse -293 -307 8.28727 0.205
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

GTGAAGCCTAAAACTGAATTAGAATCTTTAACCCTAGTAGTGAGCCGTAGCCATCGGGACCAACGTTTCCAAGATTTGATTGACCGTTTACCCTTTGGCGATCGCCATTATGTGGGCAGTGTGGGCTGTAAAATCGTCACGATTTTGGAGGGACAGAGCGATGTGTACATTTCCCTCTCCGGTAAATCCGCCGCTAAGGATTGGGACTTTGCGGCCCCGGAGTTGATTCTCACCGAAGCGGGGGGAGAGTTTACCTATTTTGACCAGACCCCTGTGTTGTATAACCGGGGCGACGTGCGGCAATGGGGCGGTATCCTGGCTAGCAATGGTTCCCACCATGGAGCTTTGTGTGAGCAAGCCGTGGAAATTTTAGCTGAACTAGATCAAAATAATTAACCTA

CDS

ATGGATCAAACTGAAGCGGCCCAACGCTGGTTGGGCATTGACCCCGGTTTAGCCATTATTGGTTGGGCTATTCTCGACGGTCAGCCGGATCTATCGGCTCACTTGGTGGACTATGGCATTATCGAAACATCTAAAAATCTCAGCACCCCAGAAAGATTGGTGGAAATTGAGCAGGATATCCACGTCCTACTAGAAGAATTTTCCCCCCAGGCGATCGCCATGGAAATGCCTTTTTTTAGTCGGCAAATCAAAGCGGCCGGAGGCGTAATGCAGGCCTTGGGGGTGATAAACCTCGTTATTTACCGGGAAAAGAGCATTCAGCCCGTCTTTTTGCACCAATCCAGTTGGAAATGCCATCTGGGCAACGGTAAAGCCAATAAAGCCGAGGTGGCCGCCATGGTGCAGAATTTTTTTGGTCTAGAAGACCTACCCATCGACGATAGTGTAGATGCCATTGCCATTGCCCTGGCTGGTCTGAACGGAGTCCGCAACGACATTGGTTAA

Protein

MDQTEAAQRWLGIDPGLAIIGWAILDGQPDLSAHLVDYGIIETSKNLSTPERLVEIEQDIHVLLEEFSPQAIAMEMPFFSRQIKAAGGVMQALGVINLVIYREKSIQPVFLHQSSWKCHLGNGKANKAEVAAMVQNFFGLEDLPIDDSVDAIAIALAGLNGVRNDIG