Your browser is old and dusty. Try Google Chrome!

Details for sll0892

ORF sll0892
Accession NP_442399.1
Symbol panD
Category Pantothenate
Definition aspartate 1-decarboxylase
Regulatory function No
External resources CyanoBase, KEGG, NCBI

Promoter profile

Table filtering
Motif Direction Start Stop Central FIMO score FIMO q-value
NP_441061.1_2 Reverse -26 -40 0.392915 0.211
NP_441061.1_2 Reverse -216 -230 0.294584 0.213
NP_441061.1_2 Reverse -70 -84 -0.000409212 0.219
NP_441418.1_6 Forward -78 -59 -19.9617 0.0997
NP_441453.1_4 Reverse -69 -77 4.14932 0.264
NP_441630.1_3 Reverse -290 -309 6.29264 0.127
NP_442752.1_4 Forward -291 -284 10.5605 0.1
NP_442975.1_10 Forward -352 -338 1.5723 0.296
NP_440061.1_9 Reverse -67 -81 10.9137 0.121
NP_441476.1_5 Reverse -277 -296 1.27776 0.189
NP_441476.1_5 Reverse -337 -356 -3.54046 0.239
NP_441476.1_5 Reverse -292 -311 -7.86702 0.291
NP_442062.1_8 Forward -78 -68 4.79825 0.198
NP_442062.1_8 Reverse -69 -79 4.60159 0.206
NP_441859.1_1 Forward -114 -95 13.2741 0.296
NP_440304.1_4 Reverse -340 -350 3.51995 0.296
NP_442602.1_3 Reverse -191 -210 -0.4922 0.221
NP_441208.1_9 Forward -104 -90 7.17775 0.226
NP_441594.1_6 Reverse -182 -201 4.42435 0.221
NP_441594.1_6 Forward -75 -56 1.86774 0.261
NP_442110.1_7 Forward -78 -64 -0.197071 0.276
NP_441925.1_4 Forward -256 -237 -13.3743 0.257
NP_441925.1_4 Reverse -272 -291 -16.6192 0.284
NP_441083.1_5 Forward -78 -68 1.06167 0.218
NP_441083.1_5 Reverse -69 -79 1.06167 0.218
NP_442827.1_8 Forward -277 -258 0.0970122 0.215
NP_441434.1_6 Reverse -198 -208 14.7297 0.277
NP_441738.1_2 Forward -99 -92 9.77352 0.143
NP_441558.1_5 Reverse -67 -86 6.68596 0.206
NP_441770.1_5 Forward -109 -90 -1.7705 0.277
NP_441716.1_1 Forward -78 -64 9.34103 0.119
NP_441716.1_1 Forward -72 -58 7.66941 0.163
NP_441716.1_1 Reverse -57 -71 3.44117 0.265
NP_441598.1_1 Forward -148 -129 18.0924 0.0573
NP_441163.1_1 Reverse -290 -307 7.80625 0.236
NP_441533.1_7 Reverse -278 -296 12.8997 0.296
NP_440747.1_10 Reverse -66 -78 -2.02597 0.0196
NP_440747.1_10 Forward -81 -69 -11.8591 0.161
NP_441486.1_1 Reverse -50 -64 1.76955 0.0999
NP_441486.1_1 Forward -65 -51 -5.60527 0.248
NP_442634.1_4 Forward -80 -66 -4.91696 0.223
NP_442848.1_1 Reverse -63 -77 -1.5737 0.263
NP_442848.1_5 Forward -400 -382 -3.12744 0.29
NP_441012.1_4 Reverse -65 -78 8.27909 0.272
NP_443018.1_3 Forward -77 -70 4.26735 0.267
NP_443018.1_3 Reverse -70 -77 4.16902 0.278
NP_440376.1_1 Forward -78 -69 14.356 0.01
NP_440376.1_1 Forward -327 -318 2.94966 0.213
NP_440376.1_1 Reverse -69 -78 0.393051 0.279
NP_442687.1_7 Reverse -68 -78 4.79825 0.234
NP_441846.1_10 Reverse -233 -252 -21.6334 0.256
NP_441013.1_2 Forward -367 -349 -1.55415 0.282
NP_441682.1_2 Forward -77 -58 3.44104 0.241
NP_440667.1_2 Reverse -240 -259 -8.35868 0.289
NP_442658.1_4 Forward -112 -98 21.0417 0.168
NP_442198.1_7 Forward -122 -103 14.9449 0.173
NP_440662.1_2 Forward -359 -340 -4.6221 0.276
NP_441487.1_6 Reverse -192 -211 -1.67217 0.285
NP_442937.1_5 Forward -83 -64 17.8957 0.0288
NP_442937.1_5 Forward -296 -277 13.7658 0.0872
NP_442937.1_5 Forward -77 -58 9.14423 0.202
NP_442321.1_4 Forward -219 -200 -0.983855 0.265
NP_441958.1_5 Reverse -91 -101 -0.314959 0.198
NP_441127.1_1 Reverse -240 -254 15.5359 0.114
NP_442486.1_6 Reverse -347 -366 -1.08219 0.266
NP_442911.1_2 Forward -361 -342 -7.57203 0.214
NP_440153.1_5 Reverse -93 -107 1.17956 0.268
NP_440153.1_8 Reverse -63 -76 3.5592 0.21
NP_440153.1_8 Forward -249 -236 -2.34066 0.235
NP_443055.1_6 Forward -86 -68 6.40989 0.171
NP_440934.1_2 Reverse -167 -186 6.78429 0.209
NP_440827.1_1 Forward -294 -275 15.6341 0.202
NP_442002.1_1 Reverse -229 -247 -8.53565 0.27
NP_441654.1_7 Reverse -60 -79 10.9842 0.298
NP_442567.1_4 Reverse -337 -356 6.58763 0.295
NP_440021.1_1 Forward -228 -209 10.0292 0.252
NP_441938.1_1 Reverse -280 -299 1.57275 0.272
NP_440411.1_10 Forward -195 -176 8.79781 0.293
NP_441646.1_1 Forward -79 -60 3.04771 0.21
NP_441646.1_1 Reverse -62 -81 -0.787193 0.272
NP_442438.1_10 Forward -356 -342 3.73617 0.157
NP_441674.1_6 Reverse -280 -299 3.34271 0.27
NP_440147.1_4 Reverse -67 -80 -0.177378 0.276
NP_441041.1_4 Forward -294 -275 -5.11376 0.148
NP_441041.1_4 Forward -78 -59 -5.70374 0.157
NP_440569.1_7 Reverse -172 -191 13.5691 0.213
NP_442004.1_6 Forward -62 -48 2.65453 0.26
NP_442941.1_3 Forward -77 -67 0.668351 0.19
NP_440674.1_7 Reverse -213 -232 7.4718 0.276
NP_440289.1_2 Reverse -54 -67 -4.01229 0.276
NP_440983.1_5 Reverse -285 -304 -6.78538 0.28
NP_440983.1_5 Reverse -279 -298 -6.78538 0.28
NP_440983.1_5 Reverse -282 -301 -8.94866 0.298
NP_442281.1_1 Reverse -64 -78 5.50552 0.155
NP_442847.1_5 Reverse -381 -400 18.1907 0.077
NP_440498.1_1 Reverse -83 -101 -3.81576 0.276
NP_441644.1_6 Forward -78 -68 6.37109 0.161
NP_441644.1_6 Reverse -69 -79 6.17443 0.165
NP_442029.1_1 Forward -74 -55 5.99764 0.138
NP_442029.1_6 Forward -83 -64 4.42435 0.268
NP_440929.1_8 Reverse -69 -78 6.68623 0.0887
NP_442933.1_10 Forward -78 -69 5.01461 0.204
NP_442554.1_8 Reverse -70 -80 7.55152 0.0893
NP_442554.1_8 Forward -77 -67 5.28991 0.153
NP_442554.1_8 Reverse -64 -74 3.42162 0.226
NP_442142.1_4 Reverse -279 -292 15.1616 0.0289
NP_442142.1_4 Reverse -66 -79 6.21356 0.17
NP_442142.1_4 Reverse -221 -234 5.91857 0.178
NP_442292.1_1 Reverse -70 -79 6.09625 0.116
NP_442292.1_1 Forward -77 -68 -0.786921 0.287
NP_442406.1_9 Reverse -92 -111 3.73603 0.271
NP_442271.1_6 Forward -397 -378 14.3558 0.294
NP_440357.1_1 Forward -245 -226 8.25926 0.296
NP_440379.1_5 Forward -300 -281 -2.26216 0.196
NP_441468.1_1 Forward -77 -70 4.36568 0.237
NP_441015.1_10 Forward -77 -58 -1.96717 0.176
NP_441015.1_10 Forward -83 -64 -2.45882 0.178
NP_441015.1_10 Forward -383 -364 -8.94866 0.278
NP_441015.1_10 Forward -180 -161 -10.817 0.288
NP_441015.1_10 Reverse -235 -254 -11.3086 0.294
NP_441673.1_1 Forward -78 -69 1.57302 0.0764
NP_441673.1_1 Reverse -69 -78 1.57302 0.0764
NP_441731.1_1 Forward -221 -203 14.0393 0.281
NP_442253.1_5 Reverse -60 -77 -1.82945 0.273
NP_441826.1_2 Reverse -63 -77 10.6193 0.0463
NP_442490.1_9 Forward -303 -284 -6.39206 0.273
NP_442227.1_4 Forward -400 -381 11.7983 0.285
NP_443058.1_7 Forward -188 -169 5.89931 0.236
NP_442808.1_1 Reverse -281 -291 5.48612 0.151
NP_442808.1_1 Reverse -68 -78 4.7978 0.19
NP_442808.1_1 Reverse -169 -179 4.40448 0.199
NP_442808.1_1 Forward -328 -318 2.73286 0.256
NP_442808.1_1 Forward -399 -389 1.74956 0.281
NP_442113.1_10 Forward -250 -231 -7.27704 0.265
NP_442050.1_5 Forward -103 -93 9.321 0.193
NP_440342.1_3 Forward -306 -287 13.9625 0.279
NP_440385.1_2 Reverse -114 -128 20.4524 0.152
NP_440558.1_2 Reverse -60 -79 12.7825 0.0742
NP_440558.1_2 Reverse -338 -357 -4.91709 0.249
NP_440558.1_5 Forward -78 -64 18.2892 0.239
NP_441878.1_6 Forward -79 -69 2.43831 0.0379
NP_441878.1_6 Reverse -68 -78 -0.0199663 0.163
NP_441557.1_5 Forward -78 -69 0.688044 0.128
NP_441557.1_5 Reverse -69 -78 0.688044 0.128
NP_441445.1_1 Forward -71 -52 0.982764 0.264
NP_441590.1_4 Reverse -59 -78 2.16195 0.297
NP_441590.1_4 Reverse -4 -23 2.06362 0.297
NP_441433.1_8 Forward -224 -205 -4.81876 0.298
NP_442419.1_2 Forward -296 -277 -0.787193 0.246
NP_442419.1_2 Reverse -64 -83 -2.26216 0.247
NP_441458.1_10 Reverse -60 -79 5.60432 0.215
NP_442183.1_9 Forward -184 -174 9.41981 0.296
NP_441574.1_1 Forward -84 -65 5.30933 0.127
NP_441574.1_1 Forward -303 -284 -5.80207 0.268
NP_440058.1_9 Reverse -274 -293 19.2715 0.252
NP_441633.1_3 Forward -353 -340 -4.9956 0.22
NP_440299.1_1 Reverse -65 -78 11.7201 0.0455
NP_440299.1_1 Forward -76 -63 5.42692 0.176
NP_441799.1_1 Forward -105 -91 5.89884 0.19
NP_440640.1_6 Reverse -228 -247 4.52268 0.212
NP_441007.1_10 Forward -83 -70 1.00259 0.209
NP_442333.2_5 Reverse -223 -242 -5.01543 0.214
NP_440256.1_1 Reverse -66 -85 -9.047 0.273
NP_440915.1_6 Forward -366 -352 -2.16369 0.26
NP_442158.1_4 Forward -206 -196 14.533 0.176
NP_441296.1_6 Forward -359 -340 1.67108 0.299
NP_442031.1_9 Reverse -227 -246 8.75009 0.289
NP_440695.1_5 Reverse -135 -154 -2.26216 0.298
NP_441199.1_6 Reverse -278 -297 5.89931 0.143
NP_442993.1_1 Forward -312 -296 -14.2978 0.298
NP_442386.1_9 Reverse -68 -77 10.324 0.132
NP_442386.1_10 Forward -187 -174 3.16588 0.291
NP_441340.1_5 Reverse -70 -77 4.07068 0.239
NP_440186.1_5 Forward -389 -370 21.4356 0.0713
NP_440327.1_6 Forward -191 -172 4.22769 0.274
NP_441776.1_5 Forward -234 -215 24.8772 0.0158
NP_442714.1_4 Forward -395 -376 19.469 0.0874
NP_440586.1_1 Forward -301 -282 -3.14714 0.263
NP_440586.1_1 Forward -82 -63 -6.09707 0.296
NP_440586.1_8 Reverse -70 -77 7.70858 0.227
NP_440586.1_8 Forward -71 -64 5.8403 0.283
NP_440027.1_3 Reverse -279 -297 2.77167 0.286
NP_440027.1_3 Forward -72 -54 2.18168 0.292
NP_440027.1_3 Reverse -63 -81 2.08335 0.293
NP_439937.1_8 Reverse -289 -308 5.30933 0.192
NP_439937.1_9 Reverse -341 -358 -12.0565 0.269
NP_440408.1_7 Reverse -172 -191 9.73422 0.255
NP_440439.1_1 Forward -104 -91 -1.75067 0.281
NP_439943.1_1 Forward -78 -59 -11.8986 0.292
NP_441803.1_2 Forward -248 -229 3.53937 0.191
NP_441803.1_2 Reverse -277 -296 1.17943 0.238
NP_442384.1_10 Forward -78 -65 7.09911 0.0875
NP_442384.1_10 Reverse -63 -76 4.44418 0.157
NP_442121.1_4 Reverse -356 -375 0.0977854 0.226
NP_441877.1_4 Reverse -115 -134 18.4857 0.0599
NP_441018.1_7 Forward -82 -63 7.07928 0.277
NP_440399.1_4 Forward -362 -343 16.4207 0.139
NP_440531.1_6 Reverse -55 -74 4.03102 0.133
NP_440297.1_9 Reverse -185 -195 0.275027 0.282
NP_440297.1_9 Forward -77 -67 -0.511621 0.289
NP_441896.1_5 Reverse -389 -396 15.3787 0.268
NP_440894.1_10 Reverse -52 -71 4.81767 0.243
NP_442078.1_3 Forward -397 -378 -0.39464 0.274
NP_440999.1_9 Forward -247 -233 5.70279 0.108
NP_440888.1_2 Forward -306 -292 9.53707 0.123
NP_440888.1_2 Reverse -69 -83 8.06211 0.172
NP_440888.1_2 Forward -101 -87 5.89884 0.258
NP_440888.1_2 Forward -78 -64 5.21053 0.288
NP_441543.1_2 Reverse -70 -79 5.21127 0.209
NP_441543.1_3 Forward -400 -386 7.96378 0.286
NP_442845.1_2 Forward -78 -64 7.37441 0.195
NP_442845.1_2 Forward -84 -70 4.71948 0.254
NP_441304.1_10 Forward -151 -142 12.9794 0.271
NP_441178.1_7 Reverse -282 -301 19.9598 0.143
NP_442337.1_8 Forward -204 -185 2.85105 0.217
NP_441462.1_2 Reverse -92 -102 -0.41329 0.225
NP_443062.1_1 Forward -78 -60 5.03566 0.242
NP_441601.1_4 Forward -311 -292 8.65258 0.162
NP_441601.1_7 Forward -311 -292 16.3224 0.108
NP_440544.1_5 Reverse -127 -134 13.8024 0.28
NP_442428.1_5 Forward -77 -70 4.66067 0.244
NP_441443.1_1 Reverse -240 -259 7.37428 0.171
NP_442120.1_10 Reverse -117 -136 -11.8003 0.265
NP_442120.1_10 Forward -84 -65 -12.0953 0.269
NP_442120.1_10 Forward -312 -293 -14.5535 0.288
NP_442120.1_10 Forward -215 -196 -14.7502 0.289
NP_440673.1_2 Forward -72 -53 8.82876 0.263
NP_440673.1_3 Reverse -55 -62 10.4622 0.139
NP_440673.1_3 Reverse -262 -269 8.20058 0.234
NP_441052.1_2 Reverse -69 -79 7.45319 0.0712
NP_441052.1_2 Forward -78 -68 7.25653 0.0765
NP_442219.1_8 Reverse -59 -78 8.26374 0.251
NP_442219.1_9 Forward -77 -68 5.11294 0.186
NP_440436.1_4 Reverse -70 -79 4.81753 0.239
NP_441004.1_1 Forward -297 -278 -0.000545616 0.121
NP_441004.1_1 Forward -84 -65 -11.7019 0.241
NP_441004.1_4 Forward -294 -284 12.6647 0.229
NP_441004.1_5 Forward -295 -281 11.0127 0.241
NP_442206.1_7 Forward -74 -55 15.7324 0.254
NP_442206.1_10 Forward -78 -63 0.569883 0.254
NP_441851.1_10 Forward -79 -69 4.79825 0.247
NP_442700.1_4 Reverse -55 -74 7.07928 0.179
NP_442515.1_1 Reverse -68 -82 3.04785 0.125
NP_440593.1_3 Reverse -58 -77 2.85105 0.168
NP_440593.1_3 Forward -83 -64 -6.29373 0.272
NP_441982.1_6 Reverse -13 -22 10.48 0.296
NP_441349.1_10 Reverse -59 -78 -8.35868 0.274
NP_441349.1_10 Forward -354 -335 -9.047 0.281
NP_441661.1_3 Forward -359 -342 -5.66436 0.283
NP_442024.1_9 Forward -33 -20 18.3088 0.153
NP_442843.1_1 Forward -359 -340 -9.047 0.264
NP_442843.1_1 Reverse -292 -311 -11.3086 0.288
NP_439960.1_2 Reverse -289 -308 11.3075 0.275
NP_439960.1_4 Forward -79 -60 17.0099 0.149
NP_440474.1_8 Forward -311 -297 5.89884 0.237
NP_442168.1_5 Reverse -365 -384 -2.45882 0.264
NP_440954.1_1 Forward -309 -290 -12.0953 0.295
NP_441570.1_1 Forward -78 -60 -0.669169 0.0498
NP_441078.1_4 Forward -78 -69 7.86621 0.0432
NP_441078.1_4 Reverse -318 -327 3.83464 0.13
NP_441078.1_4 Reverse -69 -78 0.884706 0.154
NP_442729.1_5 Forward -73 -63 7.84651 0.261
NP_442348.1_2 Reverse -25 -34 7.86621 0.28
NP_442443.1_1 Forward -358 -339 -1.57384 0.237
NP_442443.1_1 Reverse -290 -309 -2.95047 0.264
NP_440526.1_3 Reverse -70 -81 1.3365 0.267
NP_441432.1_8 Forward -79 -70 11.3078 0.0569
NP_443024.1_3 Forward -353 -343 14.238 0.255
NP_442320.1_8 Forward -84 -70 5.40779 0.0386
NP_441732.1_2 Reverse -65 -81 -7.51295 0.0859
NP_439935.1_1 Reverse -146 -165 7.57094 0.25
NP_440713.1_4 Forward -185 -166 4.916 0.219
NP_442489.1_7 Forward -78 -69 8.35786 0.0225
NP_442489.1_7 Reverse -69 -78 0.884706 0.145
NP_441706.1_10 Forward -69 -50 11.8975 0.183
NP_441659.2_8 Reverse -69 -79 6.76487 0.0678
NP_442008.1_2 Reverse -293 -312 2.45773 0.286
NP_442346.1_5 Forward -73 -63 12.8614 0.0349
NP_442346.1_5 Forward -63 -53 8.04317 0.149
NP_442346.1_5 Forward -79 -69 6.37155 0.205
NP_442346.1_5 Reverse -68 -78 6.17489 0.212
NP_440545.1_3 Forward -82 -65 -6.54933 0.283
NP_441856.1_8 Forward -311 -292 10.6192 0.281
NP_440831.1_3 Forward -75 -56 8.81407 0.221
NP_440831.1_3 Reverse -169 -188 5.22221 0.289
NP_440010.1_4 Reverse -278 -297 12.29 0.157
NP_440010.1_4 Reverse -59 -78 -1.47628 0.267
NP_441112.1_6 Forward -111 -92 -2.65548 0.296
NP_442699.1_8 Forward -362 -343 -11.6036 0.238
NP_443015.1_8 Reverse -11 -25 16.3517 0.295
NP_440772.1_6 Forward -392 -373 9.83255 0.261
NP_442073.1_6 Forward -87 -68 -0.4922 0.269
NP_442199.1_5 Forward -86 -67 -0.787193 0.177
NP_442140.1_3 Forward -290 -280 5.68323 0.198
NP_442140.1_3 Forward -71 -61 3.71661 0.283
NP_442723.1_2 Forward -303 -284 18.289 0.0726
NP_440590.1_4 Reverse -283 -296 -2.24233 0.239
NP_440590.1_4 Reverse -64 -77 -2.93064 0.251
NP_440567.1_4 Reverse -120 -139 0.392778 0.281
NP_441239.1_9 Forward -353 -341 3.57889 0.283
NP_441009.1_4 Forward -119 -100 15.6341 0.158
NP_441727.1_3 Forward -85 -66 14.9458 0.116
NP_441727.1_8 Forward -83 -64 0.491109 0.26
NP_441892.1_1 Reverse -60 -77 -2.41943 0.221
NP_441892.1_1 Reverse -294 -311 -3.69774 0.247
NP_441892.1_1 Reverse -54 -71 -5.07437 0.273
NP_440665.1_1 Reverse -285 -304 -16.5201 0.291
NP_442399.1_2 Forward -141 -127 19.2718 0.181
NP_442193.1_1 Forward -306 -288 13.6872 0.21
NP_442193.1_1 Forward -210 -192 8.47561 0.272
NP_442809.1_1 Reverse -377 -396 13.0766 0.277
NP_440546.1_4 Forward -72 -62 7.42815 0.241
NP_442479.1_9 Forward -210 -191 -14.1602 0.299
NP_440696.1_3 Forward -197 -179 -3.6191 0.287
NP_441811.1_1 Forward -258 -239 7.17762 0.28
NP_442053.1_1 Forward -78 -69 5.3096 0.197
NP_442053.1_1 Forward -101 -92 3.63797 0.298
NP_441408.2_7 Reverse -61 -80 -5.21209 0.292
NP_440914.1_1 Forward -78 -68 6.85846 0.263
NP_440914.1_1 Reverse -92 -102 6.56569 0.273
NP_442470.1_3 Forward -249 -230 10.7167 0.22
NP_442101.1_10 Reverse -192 -211 -7.86702 0.222
NP_442533.1_1 Reverse -230 -249 -15.4385 0.254
NP_442533.1_6 Reverse -69 -78 8.25953 0.0776
NP_442533.1_6 Forward -78 -69 6.8829 0.101
NP_442533.1_6 Forward -72 -63 4.62128 0.179
NP_442533.1_6 Reverse -318 -327 4.22796 0.186
NP_442533.1_6 Reverse -303 -312 2.85133 0.236
NP_442541.1_10 Reverse -69 -83 2.65393 0.254
NP_441482.1_7 Reverse -63 -77 -1.5737 0.0755
NP_439944.1_9 Forward -77 -67 14.1397 0.0439
NP_441028.1_6 Forward -124 -114 10.9926 0.193
NP_440007.1_4 Forward -89 -70 12.7825 0.204
NP_441680.1_4 Reverse -280 -299 -3.04881 0.281
NP_441602.1_3 Forward -311 -292 -4.6221 0.269
NP_441170.1_4 Forward -87 -69 7.09898 0.194
NP_441972.1_5 Reverse -58 -77 -6.68705 0.233
NP_440429.1_2 Forward -311 -292 13.7658 0.177
NP_440444.1_6 Reverse -119 -132 18.2105 0.187
NP_441286.1_1 Reverse -68 -80 2.39892 0.065
NP_441286.1_1 Forward -79 -67 2.10393 0.0737
NP_442674.1_3 Reverse -61 -80 7.37347 0.219
NP_440670.1_8 Reverse -92 -101 5.40793 0.158
NP_440886.1_7 Reverse -281 -291 7.64939 0.0865
NP_440886.1_7 Forward -247 -237 6.46942 0.123
NP_440886.1_7 Forward -244 -234 4.99446 0.205
NP_440828.1_5 Reverse -90 -109 1.37609 0.293
NP_440513.1_4 Forward -78 -59 8.16093 0.295
NP_442022.1_4 Reverse -339 -358 5.89931 0.276
NP_439999.1_3 Reverse -98 -117 23.2047 0.0195
NP_442264.1_2 Forward -82 -65 11.8386 0.179
NP_442264.1_2 Reverse -135 -152 6.43035 0.259
NP_440841.1_4 Reverse -67 -86 -5.31042 0.208
NP_441463.1_3 Reverse -59 -78 -5.21209 0.222
NP_441463.1_3 Forward -88 -69 -10.3253 0.293
NP_441463.1_6 Reverse -67 -81 8.73514 0.25
NP_442221.1_4 Reverse -230 -249 7.57094 0.296
NP_442615.1_1 Forward -87 -69 1.69077 0.0812
NP_441962.1_4 Forward -83 -64 -5.99873 0.175
NP_440387.1_1 Forward -78 -62 -6.52964 0.292
NP_441431.1_3 Forward -297 -278 14.3558 0.162
NP_441836.1_1 Forward -302 -283 11.5967 0.298
NP_441836.1_2 Reverse -57 -76 -3.3438 0.237
NP_441836.1_2 Forward -84 -65 -4.42544 0.255
NP_441993.1_1 Forward -84 -65 9.54836 0.135
NP_441993.1_1 Forward -78 -59 2.1416 0.262
NP_441993.1_1 Reverse -297 -316 1.16703 0.284
NP_441174.1_4 Forward -358 -348 15.123 0.267
NP_440358.1_8 Forward -215 -196 6.68596 0.189
NP_441510.2_7 Reverse -63 -77 9.14375 0.296
NP_440293.1_3 Forward -80 -61 -4.03212 0.257
NP_440766.1_5 Forward -357 -345 10.5205 0.27
NP_441237.1_9 Reverse -70 -80 11.3864 0.184
NP_440643.1_6 Reverse -64 -83 2.94938 0.245
NP_440142.1_7 Reverse -292 -311 7.27595 0.256
NP_441984.1_1 Forward -297 -279 11.2289 0.196
NP_441332.1_6 Forward -247 -237 10.9691 0.278
NP_442439.1_8 Reverse -62 -81 9.3409 0.253
NP_442514.1_10 Reverse -57 -76 7.37428 0.258
NP_441440.1_8 Reverse -237 -250 15.2606 0.299
NP_441885.1_5 Reverse -69 -79 2.24165 0.0822
NP_441885.1_5 Forward -78 -68 1.65166 0.106
NP_442341.1_7 Reverse -56 -70 3.63784 0.217
NP_442341.1_7 Reverse -281 -295 3.14618 0.234
NP_442395.2_4 Reverse -177 -196 -0.197979 0.287
NP_440727.1_3 Reverse -59 -78 19.174 0.109
NP_441842.1_10 Forward -298 -284 6.48943 0.286
NP_440679.1_10 Forward -298 -279 -11.0136 0.182
NP_440679.1_10 Forward -360 -341 -19.4701 0.28
NP_443010.1_10 Forward -105 -88 2.48089 0.275
NP_441122.1_1 Forward -66 -51 7.64971 0.28
NP_439962.1_4 Reverse -292 -311 -0.983855 0.206
NP_441105.1_3 Forward -89 -70 -2.55715 0.164
NP_441105.1_3 Forward -83 -64 -5.50708 0.22
NP_442373.1_2 Reverse -231 -250 -9.24366 0.258
NP_440216.1_9 Reverse -196 -205 15.536 0.128
NP_440216.1_9 Reverse -65 -74 7.37455 0.286
NP_440172.1_1 Forward -78 -68 2.7333 0.268
NP_442015.1_10 Reverse -65 -78 6.50913 0.114
NP_441226.1_7 Reverse -70 -77 11.2485 0.0971
NP_441111.1_7 Forward -77 -69 -0.570565 0.233
NP_441111.1_7 Reverse -70 -78 -0.570565 0.233
NP_440416.1_9 Forward -79 -60 -19.0768 0.269
NP_443052.1_9 Reverse -168 -187 -6.78538 0.289
NP_442154.1_1 Forward -187 -169 -9.61729 0.185
NP_442154.1_1 Reverse -24 -42 -14.6322 0.218
NP_441430.1_2 Forward -253 -234 -4.42544 0.266
NP_442564.1_9 Reverse -342 -356 14.4119 0.24
NP_440988.1_10 Forward -251 -237 10.2235 0.187
NP_440988.1_10 Reverse -67 -81 3.83388 0.277
Motif Direction Start Stop Central FIMO score FIMO q-value

Expression profile

Sequences

Promoter

CCCCCCAAACCATTGAAGAGTTGGTGGAGCGTACCCGTAACGGTGGGGCTGAAATTGCCGCCTTACTACAAACGGGCACAGCCTATTATGCGCCGGCCTCTTCCGCTGCGGTGATGGTGGAGTCCATTTTACGCAATCAGTCTAGAATTCTCCCCGCCGCCACCTACCTTGATGGTGCCTATGGATTGAAGGACATTTTCCTTGGAGTGCCCTGCCGTTTGGGGTGTCGAGGAGTGGAAGATATTCTCGAAGTGCAATTAACCCCTGAAGAAAAAGCTGCCCTCCATCTTTCTGCAGAAGCAGTTCGCCTTAATATTGATGTGGCGTTGGCCATGGTTAGCGACGGTTAACACGATAACGGACAGTGCCAATACCGTTTTTTCACCGAGGTTAGGGCTTA

CDS

ATGGGGAGCATTCGTTTGATGCACGCAAAATTACATCGGGTCTGTGTGACGGAGGCCAATGTTAATTATGTGGGCAGTATCACCATTGACCCAGTAATGTTGGAGCGGGTGGGATTGTTGCCCCTAGAGGAGGTGGATATTATCAATCTCAGCAACGGTAATCGCTTTTCCACCTATGTCCTGCCCGGTCAAGCCCATTCCAAGGAAATTTGCCCCAACGGTGGAGCCGCCTTGCTTTGTCAACCAGGCGATCGCCTGATTATTTTTGCCTACGAACTGTGCGATCGCCGTGAGGTATTACAAAAGGGGCACCAAGCTAAGGTGCTAGTGACCAACGAAAGTAATGAAACGGTGGATTTTTATTTACAAGAACTGATACCCAAGGAAGATGGGGTGAAATTCATCAACAATATTTGTTCGGAAGCCATCCCCCATTGA

Protein

MGSIRLMHAKLHRVCVTEANVNYVGSITIDPVMLERVGLLPLEEVDIINLSNGNRFSTYVLPGQAHSKEICPNGGAALLCQPGDRLIIFAYELCDRREVLQKGHQAKVLVTNESNETVDFYLQELIPKEDGVKFINNICSEAIPH